BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_FL5_O16 (833 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ219483-1|ABB29887.1| 961|Anopheles gambiae cryptochrome 2 pro... 25 2.1 DQ437579-1|ABD96049.1| 575|Anopheles gambiae short neuropeptide... 25 2.8 AY062432-1|AAL47188.1| 391|Anopheles gambiae putative odorant r... 25 2.8 U50468-1|AAA93472.1| 91|Anopheles gambiae protein ( Anopheles ... 24 5.0 AY095933-1|AAM34435.1| 505|Anopheles gambiae cytochrome P450 pr... 24 5.0 AY062197-1|AAL58558.1| 150|Anopheles gambiae cytochrome P450 CY... 24 5.0 AY062189-1|AAL58550.1| 151|Anopheles gambiae cytochrome P450 CY... 24 5.0 AY745216-1|AAU93483.1| 89|Anopheles gambiae cytochrome P450 pr... 24 6.6 AY745212-1|AAU93479.1| 104|Anopheles gambiae cytochrome P450 pr... 24 6.6 AY062200-1|AAL58561.1| 151|Anopheles gambiae cytochrome P450 CY... 24 6.6 AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. 24 6.6 DQ013848-1|AAY40257.1| 304|Anopheles gambiae CYP325D1 protein. 23 8.7 AF002238-1|AAB97731.1| 327|Anopheles gambiae ribosomal protein ... 23 8.7 >DQ219483-1|ABB29887.1| 961|Anopheles gambiae cryptochrome 2 protein. Length = 961 Score = 25.4 bits (53), Expect = 2.1 Identities = 11/30 (36%), Positives = 14/30 (46%) Frame = +1 Query: 688 SSLKNHYFHCFITYSVGRKRCPGR*YRRAH 777 SS +FHC+ GRK P Y R + Sbjct: 403 SSFFQQFFHCYCPVKFGRKADPNGDYIRRY 432 >DQ437579-1|ABD96049.1| 575|Anopheles gambiae short neuropeptide F receptor protein. Length = 575 Score = 25.0 bits (52), Expect = 2.8 Identities = 12/45 (26%), Positives = 22/45 (48%) Frame = +2 Query: 671 EIVSRDRR*KTTTFIVSLLTRLGGSGAPVDNIGGRTVFRSXRSKW 805 E RDR+ +T ++S++ G S P++ + F S + W Sbjct: 311 EEADRDRKKRTNRMLISMVAIFGISWLPLNVVNMCNDFNSDINSW 355 >AY062432-1|AAL47188.1| 391|Anopheles gambiae putative odorant receptor Or5 protein. Length = 391 Score = 25.0 bits (52), Expect = 2.8 Identities = 12/24 (50%), Positives = 15/24 (62%) Frame = +3 Query: 762 ISAGARCFVPXVQSGDVAETPSPF 833 ISAG CFV Q G++A+T F Sbjct: 360 ISAGKFCFVDIEQFGNMAKTSYSF 383 >U50468-1|AAA93472.1| 91|Anopheles gambiae protein ( Anopheles gambiae putativetubulin alpha chain mRNA, complete cds. ). Length = 91 Score = 24.2 bits (50), Expect = 5.0 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = +3 Query: 12 LALRTGACRVWTGSGCGRCRVWSM 83 +++ G V G+ C C VWSM Sbjct: 5 ISVHVGQAGVQIGNPCWDCTVWSM 28 >AY095933-1|AAM34435.1| 505|Anopheles gambiae cytochrome P450 protein. Length = 505 Score = 24.2 bits (50), Expect = 5.0 Identities = 9/28 (32%), Positives = 15/28 (53%) Frame = +1 Query: 673 DRFARSSLKNHYFHCFITYSVGRKRCPG 756 DRFA ++ + H F+ + G + C G Sbjct: 425 DRFALAATHARHTHAFLPFGDGPRNCIG 452 >AY062197-1|AAL58558.1| 150|Anopheles gambiae cytochrome P450 CYP4C27 protein. Length = 150 Score = 24.2 bits (50), Expect = 5.0 Identities = 8/29 (27%), Positives = 17/29 (58%) Frame = +1 Query: 673 DRFARSSLKNHYFHCFITYSVGRKRCPGR 759 DRF + +N + + +I ++ G + C G+ Sbjct: 122 DRFLPENTENRHPYAYIPFTAGPRNCIGQ 150 >AY062189-1|AAL58550.1| 151|Anopheles gambiae cytochrome P450 CYP4G16 protein. Length = 151 Score = 24.2 bits (50), Expect = 5.0 Identities = 7/29 (24%), Positives = 15/29 (51%) Frame = +1 Query: 673 DRFARSSLKNHYFHCFITYSVGRKRCPGR 759 D F N +++ F+ ++ G + C G+ Sbjct: 123 DNFLPEKQANRHYYAFVPFTAGPRNCIGQ 151 >AY745216-1|AAU93483.1| 89|Anopheles gambiae cytochrome P450 protein. Length = 89 Score = 23.8 bits (49), Expect = 6.6 Identities = 9/31 (29%), Positives = 15/31 (48%) Frame = +1 Query: 673 DRFARSSLKNHYFHCFITYSVGRKRCPGR*Y 765 D F + + +CF+ +S G + C G Y Sbjct: 34 DNFLPERTAHRHPYCFLPFSAGPRNCIGYRY 64 >AY745212-1|AAU93479.1| 104|Anopheles gambiae cytochrome P450 protein. Length = 104 Score = 23.8 bits (49), Expect = 6.6 Identities = 9/31 (29%), Positives = 16/31 (51%) Frame = +1 Query: 673 DRFARSSLKNHYFHCFITYSVGRKRCPGR*Y 765 DRF + + H + +S+G + C G+ Y Sbjct: 60 DRFLPERSQGRHPHAYAPFSMGSRDCIGKRY 90 >AY062200-1|AAL58561.1| 151|Anopheles gambiae cytochrome P450 CYP4G17 protein. Length = 151 Score = 23.8 bits (49), Expect = 6.6 Identities = 7/29 (24%), Positives = 16/29 (55%) Frame = +1 Query: 673 DRFARSSLKNHYFHCFITYSVGRKRCPGR 759 D F +N +++ +I ++ G + C G+ Sbjct: 123 DNFLPERTQNRHYYSYIPFTAGPRNCIGQ 151 >AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. Length = 1459 Score = 23.8 bits (49), Expect = 6.6 Identities = 15/38 (39%), Positives = 19/38 (50%), Gaps = 1/38 (2%) Frame = -1 Query: 494 DEAFGYLKRVIVTPAVYPRLLEFLHV-DIQSTGQKSHC 384 D +F L RV TPA P +EFL + D + HC Sbjct: 635 DASFNRLTRV--TPATIPNSIEFLFLNDNHIVHVEPHC 670 >DQ013848-1|AAY40257.1| 304|Anopheles gambiae CYP325D1 protein. Length = 304 Score = 23.4 bits (48), Expect = 8.7 Identities = 10/31 (32%), Positives = 14/31 (45%) Frame = +1 Query: 673 DRFARSSLKNHYFHCFITYSVGRKRCPGR*Y 765 DRF KN F+ ++ G + C G Y Sbjct: 268 DRFLSERCKNRMGCAFMPFNTGSRNCIGSRY 298 >AF002238-1|AAB97731.1| 327|Anopheles gambiae ribosomal protein L5 protein. Length = 327 Score = 23.4 bits (48), Expect = 8.7 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = -2 Query: 301 PLNGGRTESCRSRTKRNR 248 P +GGR SCRS R R Sbjct: 262 PRSGGRWPSCRSPPARRR 279 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 909,144 Number of Sequences: 2352 Number of extensions: 18860 Number of successful extensions: 70 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 66 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 70 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 88065063 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -