BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_FL5_O16 (833 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z73907-1|CAA98124.1| 4753|Caenorhabditis elegans Hypothetical pr... 29 3.1 M96150-1|AAA28105.1| 4753|Caenorhabditis elegans LDL receptor-re... 29 3.1 Z81119-8|CAB03340.1| 504|Caenorhabditis elegans Hypothetical pr... 29 4.1 Z48583-4|CAN99691.1| 3394|Caenorhabditis elegans Hypothetical pr... 29 4.1 Z48583-3|CAA88472.1| 3396|Caenorhabditis elegans Hypothetical pr... 29 4.1 U23529-9|AAL32210.1| 713|Caenorhabditis elegans G-protein-linke... 29 5.4 U23529-8|AAL32209.1| 682|Caenorhabditis elegans G-protein-linke... 29 5.4 AF117300-1|AAF26201.1| 713|Caenorhabditis elegans G protein-lin... 29 5.4 AF075245-1|AAD13747.1| 682|Caenorhabditis elegans G protein-lin... 29 5.4 Z19154-6|CAC35885.2| 388|Caenorhabditis elegans Hypothetical pr... 28 7.2 U29535-9|AAK31453.2| 2148|Caenorhabditis elegans Hypothetical pr... 28 7.2 AC024801-12|AAF59643.4| 569|Caenorhabditis elegans Hypothetical... 28 7.2 AL110490-7|CAD59175.1| 533|Caenorhabditis elegans Hypothetical ... 28 9.5 AL110490-6|CAB54442.2| 687|Caenorhabditis elegans Hypothetical ... 28 9.5 AL033536-1|CAA22138.1| 908|Caenorhabditis elegans Hypothetical ... 28 9.5 >Z73907-1|CAA98124.1| 4753|Caenorhabditis elegans Hypothetical protein F29D11.1 protein. Length = 4753 Score = 29.5 bits (63), Expect = 3.1 Identities = 13/44 (29%), Positives = 19/44 (43%) Frame = +2 Query: 314 WHGQGESDCLIKTKHCDGPRGC*RNVISAQCSECQREEIQASAG 445 W+ G C+ + K CDG + C QCS+ + AG Sbjct: 267 WNCPGTGHCIDQLKLCDGSKDCADGADEQQCSQNLCPSLGCQAG 310 >M96150-1|AAA28105.1| 4753|Caenorhabditis elegans LDL receptor-related protein protein. Length = 4753 Score = 29.5 bits (63), Expect = 3.1 Identities = 13/44 (29%), Positives = 19/44 (43%) Frame = +2 Query: 314 WHGQGESDCLIKTKHCDGPRGC*RNVISAQCSECQREEIQASAG 445 W+ G C+ + K CDG + C QCS+ + AG Sbjct: 267 WNCPGTGHCIDQLKLCDGSKDCADGADEQQCSQNLCPSLGCQAG 310 >Z81119-8|CAB03340.1| 504|Caenorhabditis elegans Hypothetical protein T10H4.10 protein. Length = 504 Score = 29.1 bits (62), Expect = 4.1 Identities = 16/47 (34%), Positives = 22/47 (46%) Frame = +3 Query: 159 DTRENRLTFRTGSGPAFSGLPRIFLAVRSCRFRFVRDRHDSVRPPFN 299 D +L R G +G IF VR RF++ R D++ PFN Sbjct: 200 DPEFEKLVSRLAKGFENTGFLDIFCPVRILESRFLKWRQDTIFEPFN 246 >Z48583-4|CAN99691.1| 3394|Caenorhabditis elegans Hypothetical protein F54B3.1b protein. Length = 3394 Score = 29.1 bits (62), Expect = 4.1 Identities = 16/40 (40%), Positives = 21/40 (52%) Frame = -1 Query: 698 FSDDRAKRSPTYATPLMSPYNARLESSSTGSSFPADSPKP 579 F DD K ++ S + ESSSTGSS +D P+P Sbjct: 1429 FLDDEEKTITDNSSSASSEDSDSDESSSTGSSSSSDDPRP 1468 >Z48583-3|CAA88472.1| 3396|Caenorhabditis elegans Hypothetical protein F54B3.1a protein. Length = 3396 Score = 29.1 bits (62), Expect = 4.1 Identities = 16/40 (40%), Positives = 21/40 (52%) Frame = -1 Query: 698 FSDDRAKRSPTYATPLMSPYNARLESSSTGSSFPADSPKP 579 F DD K ++ S + ESSSTGSS +D P+P Sbjct: 1429 FLDDEEKTITDNSSSASSEDSDSDESSSTGSSSSSDDPRP 1468 >U23529-9|AAL32210.1| 713|Caenorhabditis elegans G-protein-linked acetylcholinereceptor protein 1, isoform b protein. Length = 713 Score = 28.7 bits (61), Expect = 5.4 Identities = 13/28 (46%), Positives = 18/28 (64%) Frame = -3 Query: 114 LTR*NEHNARTSTRPGTGRIRFPSKPDT 31 LT NE+ TS++PG R+ P+K DT Sbjct: 557 LTVNNENRGETSSQPGRDRLAPPNKTDT 584 >U23529-8|AAL32209.1| 682|Caenorhabditis elegans G-protein-linked acetylcholinereceptor protein 1, isoform a protein. Length = 682 Score = 28.7 bits (61), Expect = 5.4 Identities = 13/28 (46%), Positives = 18/28 (64%) Frame = -3 Query: 114 LTR*NEHNARTSTRPGTGRIRFPSKPDT 31 LT NE+ TS++PG R+ P+K DT Sbjct: 526 LTVNNENRGETSSQPGRDRLAPPNKTDT 553 >AF117300-1|AAF26201.1| 713|Caenorhabditis elegans G protein-linked acetylcholinereceptor GAR-1a protein. Length = 713 Score = 28.7 bits (61), Expect = 5.4 Identities = 13/28 (46%), Positives = 18/28 (64%) Frame = -3 Query: 114 LTR*NEHNARTSTRPGTGRIRFPSKPDT 31 LT NE+ TS++PG R+ P+K DT Sbjct: 557 LTVNNENRGETSSQPGRDRLAPPNKTDT 584 >AF075245-1|AAD13747.1| 682|Caenorhabditis elegans G protein-linked acetylcholinereceptor GAR-1b protein. Length = 682 Score = 28.7 bits (61), Expect = 5.4 Identities = 13/28 (46%), Positives = 18/28 (64%) Frame = -3 Query: 114 LTR*NEHNARTSTRPGTGRIRFPSKPDT 31 LT NE+ TS++PG R+ P+K DT Sbjct: 526 LTVNNENRGETSSQPGRDRLAPPNKTDT 553 >Z19154-6|CAC35885.2| 388|Caenorhabditis elegans Hypothetical protein C40H1.7 protein. Length = 388 Score = 28.3 bits (60), Expect = 7.2 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = -3 Query: 786 RNTVRPPILSTGAPLPPNRVSNETMKVVVFQRR 688 RNTV P I +TG P + N+ + V++RR Sbjct: 76 RNTVLPVIAATGTDNPQKCLDNQLPSMKVYKRR 108 >U29535-9|AAK31453.2| 2148|Caenorhabditis elegans Hypothetical protein C25H3.8 protein. Length = 2148 Score = 28.3 bits (60), Expect = 7.2 Identities = 11/20 (55%), Positives = 15/20 (75%) Frame = -2 Query: 97 T*RTNIDQTRHRPHPLPVQT 38 T +++ID T H PHP+ VQT Sbjct: 904 TLKSSIDITNHLPHPIAVQT 923 >AC024801-12|AAF59643.4| 569|Caenorhabditis elegans Hypothetical protein Y50D7A.8 protein. Length = 569 Score = 28.3 bits (60), Expect = 7.2 Identities = 10/31 (32%), Positives = 17/31 (54%) Frame = -3 Query: 96 HNARTSTRPGTGRIRFPSKPDTPRSSEPIPP 4 +N T P + + P +P T ++EP+PP Sbjct: 426 NNLSTINEPSSSSLPPPQQPSTSSTTEPVPP 456 >AL110490-7|CAD59175.1| 533|Caenorhabditis elegans Hypothetical protein Y48B6A.6b protein. Length = 533 Score = 27.9 bits (59), Expect = 9.5 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = -3 Query: 795 RLERNTVRPPILSTGAPLPPN 733 R+ R+ V PP+LS P PPN Sbjct: 249 RISRSPVPPPVLSIPPPPPPN 269 >AL110490-6|CAB54442.2| 687|Caenorhabditis elegans Hypothetical protein Y48B6A.6a protein. Length = 687 Score = 27.9 bits (59), Expect = 9.5 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = -3 Query: 795 RLERNTVRPPILSTGAPLPPN 733 R+ R+ V PP+LS P PPN Sbjct: 249 RISRSPVPPPVLSIPPPPPPN 269 >AL033536-1|CAA22138.1| 908|Caenorhabditis elegans Hypothetical protein Y53C10A.4 protein. Length = 908 Score = 27.9 bits (59), Expect = 9.5 Identities = 16/44 (36%), Positives = 24/44 (54%), Gaps = 5/44 (11%) Frame = -1 Query: 695 SDDRAKRSPTYATP----LMSPYNARLESSSTGSSFPAD-SPKP 579 +DD R P + + L PY + SSS+ SS P+D +P+P Sbjct: 681 NDDSDSRFPAFKSSSVAMLTEPYKSSSSSSSSTSSIPSDPAPRP 724 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,873,475 Number of Sequences: 27780 Number of extensions: 430326 Number of successful extensions: 1323 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 1222 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1322 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 2072006206 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -