BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_FL5_O15 (782 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q9LI74 Cluster: Similarity to pherophorin; n=1; Arabido... 58 2e-07 UniRef50_Q8IU42 Cluster: Formin homology protein A; n=2; Dictyos... 58 3e-07 UniRef50_A7SLQ1 Cluster: Predicted protein; n=2; Nematostella ve... 53 7e-06 UniRef50_A2DM28 Cluster: Diaphanous, putative; n=1; Trichomonas ... 53 9e-06 UniRef50_A6APN4 Cluster: Insecticidal toxin, SepC/Tcc class; n=2... 52 1e-05 UniRef50_Q9DEH3 Cluster: Diaphanous homologue; n=13; Eumetazoa|R... 52 2e-05 UniRef50_P78621 Cluster: Cytokinesis protein sepA; n=14; Fungi/M... 52 2e-05 UniRef50_UPI0000E4896A Cluster: PREDICTED: similar to CG33556-PA... 51 3e-05 UniRef50_Q54H12 Cluster: Actin-binding protein; n=2; Dictyosteli... 50 5e-05 UniRef50_A2DLA9 Cluster: Putative uncharacterized protein; n=1; ... 50 5e-05 UniRef50_O00401 Cluster: Neural Wiskott-Aldrich syndrome protein... 50 5e-05 UniRef50_Q7JP75 Cluster: Cytokinesis defect protein 1, isoform b... 50 7e-05 UniRef50_UPI0000E482F8 Cluster: PREDICTED: similar to dishevelle... 50 9e-05 UniRef50_Q4S986 Cluster: Chromosome 3 SCAF14700, whole genome sh... 50 9e-05 UniRef50_Q9FLQ7 Cluster: Gb|AAD23008.1; n=1; Arabidopsis thalian... 50 9e-05 UniRef50_A5JUU8 Cluster: Formin B; n=2; Trypanosoma brucei|Rep: ... 50 9e-05 UniRef50_Q54SP2 Cluster: Actin-binding protein; n=2; Dictyosteli... 49 1e-04 UniRef50_A6RGJ8 Cluster: Predicted protein; n=1; Ajellomyces cap... 49 1e-04 UniRef50_P48608 Cluster: Protein diaphanous; n=5; Endopterygota|... 49 1e-04 UniRef50_UPI0000F205BB Cluster: PREDICTED: similar to formin 2; ... 49 2e-04 UniRef50_UPI0000E80701 Cluster: PREDICTED: similar to formin, in... 49 2e-04 UniRef50_UPI000023E328 Cluster: hypothetical protein FG01070.1; ... 49 2e-04 UniRef50_A0R2X6 Cluster: Putative uncharacterized protein; n=2; ... 49 2e-04 UniRef50_Q9NZ56 Cluster: Formin-2; n=13; Eumetazoa|Rep: Formin-2... 49 2e-04 UniRef50_A6UHC7 Cluster: Outer membrane autotransporter barrel d... 48 2e-04 UniRef50_Q4QE97 Cluster: Formin, putative; n=3; Leishmania|Rep: ... 48 2e-04 UniRef50_A6R957 Cluster: Cytokinesis protein sepA; n=1; Ajellomy... 48 2e-04 UniRef50_A4R3R8 Cluster: Predicted protein; n=1; Magnaporthe gri... 48 2e-04 UniRef50_P21997 Cluster: Sulfated surface glycoprotein 185 precu... 48 2e-04 UniRef50_UPI0001552F36 Cluster: PREDICTED: similar to SH3 domain... 48 3e-04 UniRef50_Q8L685 Cluster: Pherophorin-dz1 protein precursor; n=1;... 48 3e-04 UniRef50_Q9VY31 Cluster: CG9411-PA; n=2; Sophophora|Rep: CG9411-... 48 3e-04 UniRef50_Q6C9I8 Cluster: Similar to sp|P41832 Saccharomyces cere... 48 3e-04 UniRef50_Q0CQD0 Cluster: Predicted protein; n=1; Aspergillus ter... 48 3e-04 UniRef50_UPI0000D56EFA Cluster: PREDICTED: similar to Protein ca... 48 4e-04 UniRef50_Q2N5D9 Cluster: Autotransporter; n=1; Erythrobacter lit... 48 4e-04 UniRef50_P93797 Cluster: Pherophorin-S precursor; n=1; Volvox ca... 48 4e-04 UniRef50_Q55DK4 Cluster: Actin-binding protein; n=2; Dictyosteli... 48 4e-04 UniRef50_Q1ZXK2 Cluster: Actin-binding protein; n=2; Dictyosteli... 48 4e-04 UniRef50_A2DC30 Cluster: Formin Homology 2 Domain containing pro... 48 4e-04 UniRef50_UPI0000E48C31 Cluster: PREDICTED: hypothetical protein;... 47 5e-04 UniRef50_UPI000049834E Cluster: FH2 domain protein; n=1; Entamoe... 47 5e-04 UniRef50_Q07PB7 Cluster: Peptidase C14, caspase catalytic subuni... 47 5e-04 UniRef50_Q852P0 Cluster: Pherophorin; n=2; Eukaryota|Rep: Pherop... 47 5e-04 UniRef50_Q3HTL0 Cluster: Pherophorin-V1 protein precursor; n=1; ... 47 5e-04 UniRef50_Q86C16 Cluster: Ah1644 protein; n=7; cellular organisms... 47 5e-04 UniRef50_Q7QDL5 Cluster: ENSANGP00000000741; n=1; Anopheles gamb... 47 5e-04 UniRef50_Q16F81 Cluster: Diaphanous; n=3; Endopterygota|Rep: Dia... 47 5e-04 UniRef50_A2DFC2 Cluster: Formin Homology 2 Domain containing pro... 47 5e-04 UniRef50_A0BLV2 Cluster: Chromosome undetermined scaffold_115, w... 47 5e-04 UniRef50_UPI0000E491BF Cluster: PREDICTED: similar to FHOS2L spl... 47 6e-04 UniRef50_Q1IA36 Cluster: Insecticidal toxin, SepC/Tcc class; n=1... 47 6e-04 UniRef50_Q0D4Y8 Cluster: Os07g0596300 protein; n=7; Eukaryota|Re... 47 6e-04 UniRef50_Q01I59 Cluster: H0315A08.9 protein; n=3; Oryza sativa|R... 47 6e-04 UniRef50_Q7RWH7 Cluster: Putative uncharacterized protein NCU014... 47 6e-04 UniRef50_Q0V5Y9 Cluster: Predicted protein; n=1; Phaeosphaeria n... 47 6e-04 UniRef50_Q8T4F7 Cluster: Protein enabled; n=7; Eumetazoa|Rep: Pr... 47 6e-04 UniRef50_UPI00004D7E7F Cluster: CDNA FLJ45135 fis, clone BRAWH30... 46 8e-04 UniRef50_Q4RLQ7 Cluster: Chromosome 10 SCAF15019, whole genome s... 46 8e-04 UniRef50_Q9XIE0 Cluster: F23H11.22 protein; n=1; Arabidopsis tha... 46 8e-04 UniRef50_Q9LUI1 Cluster: Extensin protein-like; n=10; Magnolioph... 46 8e-04 UniRef50_Q3HTK4 Cluster: Pherophorin-C3 protein precursor; n=1; ... 46 8e-04 UniRef50_A7S5P1 Cluster: Predicted protein; n=1; Nematostella ve... 46 8e-04 UniRef50_A2F502 Cluster: Formin Homology 2 Domain containing pro... 46 8e-04 UniRef50_A0DA74 Cluster: Chromosome undetermined scaffold_43, wh... 46 8e-04 UniRef50_UPI000049A0E6 Cluster: diaphanous protein; n=1; Entamoe... 46 0.001 UniRef50_UPI0000F30461 Cluster: Formin-2.; n=2; Bos taurus|Rep: ... 46 0.001 UniRef50_Q4RR29 Cluster: Chromosome 14 SCAF15003, whole genome s... 46 0.001 UniRef50_Q8YQB7 Cluster: All3916 protein; n=2; Nostocaceae|Rep: ... 46 0.001 UniRef50_A2XET4 Cluster: Putative uncharacterized protein; n=2; ... 46 0.001 UniRef50_A0CZ14 Cluster: Chromosome undetermined scaffold_31, wh... 46 0.001 UniRef50_A0BFK7 Cluster: Chromosome undetermined scaffold_104, w... 46 0.001 UniRef50_Q9JL04 Cluster: Formin-2; n=4; Murinae|Rep: Formin-2 - ... 46 0.001 UniRef50_UPI0000F1E7FE Cluster: PREDICTED: similar to formin 2; ... 46 0.001 UniRef50_UPI0000DB6CCB Cluster: PREDICTED: hypothetical protein;... 46 0.001 UniRef50_UPI00015A5D5E Cluster: UPI00015A5D5E related cluster; n... 46 0.001 UniRef50_Q2W222 Cluster: RTX toxins and related Ca2+-binding pro... 46 0.001 UniRef50_Q4U2V7 Cluster: Hydroxyproline-rich glycoprotein GAS31 ... 46 0.001 UniRef50_Q75JU4 Cluster: Similar to Volvox carteri f. nagariensi... 46 0.001 UniRef50_Q54WZ5 Cluster: Slob family protein kinase; n=1; Dictyo... 46 0.001 UniRef50_A3QX14 Cluster: Wiskott-Aldrich syndrome protein; n=1; ... 46 0.001 UniRef50_A2F3Y4 Cluster: Putative uncharacterized protein; n=1; ... 46 0.001 UniRef50_Q6CEK4 Cluster: Similar to tr|O42854 Schizosaccharomyce... 46 0.001 UniRef50_A4QSC9 Cluster: Predicted protein; n=2; Fungi/Metazoa g... 46 0.001 UniRef50_P21260 Cluster: Uncharacterized proline-rich protein; n... 46 0.001 UniRef50_Q9Y4D1 Cluster: Disheveled-associated activator of morp... 46 0.001 UniRef50_UPI0000F1DAD0 Cluster: PREDICTED: hypothetical protein;... 45 0.002 UniRef50_Q7T318 Cluster: Wiskott-Aldrich syndrome; n=7; Euteleos... 45 0.002 UniRef50_Q4A2U1 Cluster: Putative membrane protein precursor; n=... 45 0.002 UniRef50_Q2IHA5 Cluster: Putative uncharacterized protein; n=1; ... 45 0.002 UniRef50_Q3HTK5 Cluster: Pherophorin-C2 protein precursor; n=8; ... 45 0.002 UniRef50_Q01HL2 Cluster: H0211F06-OSIGBa0153M17.6 protein; n=12;... 45 0.002 UniRef50_Q22715 Cluster: Putative uncharacterized protein; n=3; ... 45 0.002 UniRef50_A0E3T6 Cluster: Chromosome undetermined scaffold_77, wh... 45 0.002 UniRef50_UPI0000E4A382 Cluster: PREDICTED: similar to DNA-depend... 45 0.002 UniRef50_Q8IMM6 Cluster: CG5514-PB, isoform B; n=3; Drosophila m... 45 0.002 UniRef50_Q1HMI7 Cluster: Formin B; n=4; Trypanosoma cruzi|Rep: F... 45 0.002 UniRef50_Q1HMI6 Cluster: Formin A; n=4; Trypanosoma cruzi|Rep: F... 45 0.002 UniRef50_A7SHT8 Cluster: Predicted protein; n=2; Nematostella ve... 45 0.002 UniRef50_P12978 Cluster: Epstein-Barr nuclear antigen 2; n=2; Hu... 45 0.002 UniRef50_UPI00015B5CAE Cluster: PREDICTED: similar to conserved ... 44 0.003 UniRef50_Q948Y6 Cluster: VMP4 protein; n=1; Volvox carteri f. na... 44 0.003 UniRef50_Q3HTK2 Cluster: Pherophorin-C5 protein precursor; n=1; ... 44 0.003 UniRef50_Q9VC23 Cluster: CG7016-PA; n=2; Sophophora|Rep: CG7016-... 44 0.003 UniRef50_Q93424 Cluster: Putative uncharacterized protein grl-23... 44 0.003 UniRef50_Q5CLH8 Cluster: Protease; n=3; Cryptosporidium|Rep: Pro... 44 0.003 UniRef50_Q54ER5 Cluster: Formin homology domain-containing prote... 44 0.003 UniRef50_Q54B83 Cluster: Wiscott-Aldrich syndrome protein; n=2; ... 44 0.003 UniRef50_A0DJB7 Cluster: Chromosome undetermined scaffold_53, wh... 44 0.003 UniRef50_Q6BUJ5 Cluster: Similar to sp|P37370 Saccharomyces cere... 44 0.003 UniRef50_Q1E467 Cluster: Putative uncharacterized protein; n=1; ... 44 0.003 UniRef50_Q0U8T6 Cluster: Predicted protein; n=1; Phaeosphaeria n... 44 0.003 UniRef50_A7TP17 Cluster: Putative uncharacterized protein; n=1; ... 44 0.003 UniRef50_A7EKZ0 Cluster: Putative uncharacterized protein; n=1; ... 44 0.003 UniRef50_P42768 Cluster: Wiskott-Aldrich syndrome protein; n=14;... 44 0.003 UniRef50_O60610 Cluster: Protein diaphanous homolog 1; n=43; Eut... 44 0.003 UniRef50_UPI0000D8C71D Cluster: Wiskott-Aldrich syndrome protein... 44 0.004 UniRef50_Q4SUB2 Cluster: Chromosome 3 SCAF13974, whole genome sh... 44 0.004 UniRef50_Q1LVB7 Cluster: Novel protein; n=5; Danio rerio|Rep: No... 44 0.004 UniRef50_Q20IN6 Cluster: HrpW; n=1; Pseudomonas cichorii|Rep: Hr... 44 0.004 UniRef50_Q7YYP6 Cluster: Hydroxyproline-rich glycoprotein dz-hrg... 44 0.004 UniRef50_A0D1C0 Cluster: Chromosome undetermined scaffold_34, wh... 44 0.004 UniRef50_Q9P6T1 Cluster: Putative uncharacterized protein 15E6.2... 44 0.004 UniRef50_Q7SCZ7 Cluster: Predicted protein; n=5; Pezizomycotina|... 44 0.004 UniRef50_Q6FSY6 Cluster: Similar to sp|P47068 Saccharomyces cere... 44 0.004 UniRef50_Q24120 Cluster: Protein cappuccino; n=6; Drosophila mel... 44 0.004 UniRef50_Q4RDJ1 Cluster: Chromosome undetermined SCAF16309, whol... 44 0.006 UniRef50_Q0S917 Cluster: Possible proline rich protein; n=1; Rho... 44 0.006 UniRef50_Q9C946 Cluster: Putative uncharacterized protein T7P1.2... 44 0.006 UniRef50_Q41645 Cluster: Extensin; n=1; Volvox carteri|Rep: Exte... 44 0.006 UniRef50_A2D765 Cluster: Putative uncharacterized protein; n=1; ... 44 0.006 UniRef50_P41484 Cluster: Proline-rich antigen; n=21; Mycobacteri... 44 0.006 UniRef50_UPI00006A2591 Cluster: Wiskott-Aldrich syndrome protein... 43 0.008 UniRef50_Q10R38 Cluster: Transposon protein, putative, CACTA, En... 43 0.008 UniRef50_A4S9A6 Cluster: Predicted protein; n=1; Ostreococcus lu... 43 0.008 UniRef50_A2EVR8 Cluster: Putative uncharacterized protein; n=1; ... 43 0.008 UniRef50_Q7SF15 Cluster: Putative uncharacterized protein NCU074... 43 0.008 UniRef50_A2QUG1 Cluster: Similarity to the N. crassa protein. Ad... 43 0.008 UniRef50_Q8N8S7 Cluster: Protein enabled homolog; n=9; Tetrapoda... 43 0.008 UniRef50_UPI0000DB6BDB Cluster: PREDICTED: similar to prickle CG... 43 0.010 UniRef50_A4QN64 Cluster: Zgc:162320 protein; n=8; Danio rerio|Re... 43 0.010 UniRef50_A4T9C9 Cluster: Integral membrane protein-like protein;... 43 0.010 UniRef50_Q7XMC9 Cluster: OSJNBb0018A10.6 protein; n=11; Oryza sa... 43 0.010 UniRef50_Q010M7 Cluster: Predicted membrane protein; n=3; Eukary... 43 0.010 UniRef50_A2YNB7 Cluster: Putative uncharacterized protein; n=1; ... 43 0.010 UniRef50_A7STU3 Cluster: Predicted protein; n=1; Nematostella ve... 43 0.010 UniRef50_A6R7X5 Cluster: Putative uncharacterized protein; n=1; ... 43 0.010 UniRef50_Q8IV90 Cluster: Wiskott-Aldrich syndrome protein family... 43 0.010 UniRef50_Q03209 Cluster: 61 kDa protein; n=6; Nucleopolyhedrovir... 43 0.010 UniRef50_Q0GNC1 Cluster: Inverted formin-2; n=13; Euteleostomi|R... 43 0.010 UniRef50_Q6P9Q4 Cluster: FH1/FH2 domain-containing protein 1; n=... 43 0.010 UniRef50_UPI0000F2C731 Cluster: PREDICTED: hypothetical protein;... 42 0.013 UniRef50_UPI0000DB6FAC Cluster: PREDICTED: similar to Protein ca... 42 0.013 UniRef50_UPI0000499326 Cluster: actin binding protein; n=1; Enta... 42 0.013 UniRef50_Q4SIS2 Cluster: Chromosome 21 SCAF14577, whole genome s... 42 0.013 UniRef50_Q62CV6 Cluster: Hemagglutinin domain protein; n=8; Burk... 42 0.013 UniRef50_A1UKQ7 Cluster: Putative uncharacterized protein; n=3; ... 42 0.013 UniRef50_Q9SXE7 Cluster: T3P18.6; n=2; core eudicotyledons|Rep: ... 42 0.013 UniRef50_Q01AC1 Cluster: Meltrins, fertilins and related Zn-depe... 42 0.013 UniRef50_A7RXK9 Cluster: Predicted protein; n=2; Nematostella ve... 42 0.013 UniRef50_A7RW05 Cluster: Predicted protein; n=1; Nematostella ve... 42 0.013 UniRef50_A0E1N2 Cluster: Chromosome undetermined scaffold_73, wh... 42 0.013 UniRef50_Q6CDQ5 Cluster: Similarity; n=2; Saccharomycetales|Rep:... 42 0.013 UniRef50_A7EUH8 Cluster: Putative uncharacterized protein; n=1; ... 42 0.013 UniRef50_A7ER22 Cluster: Predicted protein; n=1; Sclerotinia scl... 42 0.013 UniRef50_A6QTR5 Cluster: Adenylyl cyclase-associated protein; n=... 42 0.013 UniRef50_Q68DA7 Cluster: Formin-1; n=14; Theria|Rep: Formin-1 - ... 42 0.013 UniRef50_UPI00015B541C Cluster: PREDICTED: hypothetical protein;... 42 0.017 UniRef50_A2RV11 Cluster: FNBP4 protein; n=7; Danio rerio|Rep: FN... 42 0.017 UniRef50_A1L2E9 Cluster: Putative uncharacterized protein; n=3; ... 42 0.017 UniRef50_Q0ILB7 Cluster: ORF1629; n=1; Leucania separata nuclear... 42 0.017 UniRef50_Q8PPF4 Cluster: Putative uncharacterized protein XAC073... 42 0.017 UniRef50_Q828N1 Cluster: Putative secreted protein; n=5; Strepto... 42 0.017 UniRef50_Q2INY4 Cluster: Putative uncharacterized protein precur... 42 0.017 UniRef50_Q9FF15 Cluster: Arabidopsis thaliana genomic DNA, chrom... 42 0.017 UniRef50_O48809 Cluster: T3P18.1; n=9; Eukaryota|Rep: T3P18.1 - ... 42 0.017 UniRef50_O23374 Cluster: P140mDia like protein; n=2; Arabidopsis... 42 0.017 UniRef50_A4S3R1 Cluster: Predicted protein; n=2; Ostreococcus|Re... 42 0.017 UniRef50_Q9NGX2 Cluster: Diaphanous protein; n=3; Entamoeba hist... 42 0.017 UniRef50_Q54TI7 Cluster: WH2 domain-containing protein; n=1; Dic... 42 0.017 UniRef50_Q54ND2 Cluster: RhoGEF domain-containing protein; n=1; ... 42 0.017 UniRef50_Q2M175 Cluster: GA21777-PA; n=2; pseudoobscura subgroup... 42 0.017 UniRef50_A0D550 Cluster: Chromosome undetermined scaffold_38, wh... 42 0.017 UniRef50_Q7SEJ7 Cluster: Predicted protein; n=1; Neurospora cras... 42 0.017 UniRef50_Q5ANI0 Cluster: Potential fungal zinc cluster transcrip... 42 0.017 UniRef50_Q5AL62 Cluster: Putative uncharacterized protein; n=1; ... 42 0.017 UniRef50_Q4WNW8 Cluster: KH domain protein; n=13; Pezizomycotina... 42 0.017 UniRef50_Q0CLE5 Cluster: Predicted protein; n=1; Aspergillus ter... 42 0.017 UniRef50_A4RC14 Cluster: Predicted protein; n=1; Magnaporthe gri... 42 0.017 UniRef50_A4R506 Cluster: Putative uncharacterized protein; n=1; ... 42 0.017 UniRef50_O60879 Cluster: Protein diaphanous homolog 2; n=26; Eut... 42 0.017 UniRef50_UPI00015B5315 Cluster: PREDICTED: similar to Heterogene... 42 0.023 UniRef50_UPI0000F2D497 Cluster: PREDICTED: similar to Proline-ri... 42 0.023 UniRef50_Q640S7 Cluster: Fmnl1 protein; n=3; Xenopus|Rep: Fmnl1 ... 42 0.023 UniRef50_Q91BL3 Cluster: Essential structural protein pp78/81; n... 42 0.023 UniRef50_Q743K0 Cluster: Putative uncharacterized protein; n=2; ... 42 0.023 UniRef50_Q4USI3 Cluster: Serine protease; n=9; Xanthomonadaceae|... 42 0.023 UniRef50_Q6H7U3 Cluster: Putative formin I2I isoform; n=2; Oryza... 42 0.023 UniRef50_Q1EP07 Cluster: Putative uncharacterized protein; n=1; ... 42 0.023 UniRef50_Q01DC8 Cluster: Plg protein; n=2; Eukaryota|Rep: Plg pr... 42 0.023 UniRef50_A7QNX2 Cluster: Chromosome chr1 scaffold_135, whole gen... 42 0.023 UniRef50_A4S6G3 Cluster: Predicted protein; n=2; Eukaryota|Rep: ... 42 0.023 UniRef50_A2X6K1 Cluster: Putative uncharacterized protein; n=3; ... 42 0.023 UniRef50_Q5CS67 Cluster: Signal peptide containing large protein... 42 0.023 UniRef50_Q38EF1 Cluster: Putative uncharacterized protein; n=1; ... 42 0.023 UniRef50_A7SGL4 Cluster: Predicted protein; n=1; Nematostella ve... 42 0.023 UniRef50_A2DM31 Cluster: Putative uncharacterized protein; n=1; ... 42 0.023 UniRef50_A0EAP8 Cluster: Chromosome undetermined scaffold_86, wh... 42 0.023 UniRef50_A0CJV0 Cluster: Chromosome undetermined scaffold_2, who... 42 0.023 UniRef50_A4R9P2 Cluster: Predicted protein; n=1; Magnaporthe gri... 42 0.023 UniRef50_A2QQW4 Cluster: Contig An08c0110, complete genome; n=2;... 42 0.023 UniRef50_Q9LKA5 Cluster: Uncharacterized mitochondrial protein A... 42 0.023 UniRef50_Q95JC9 Cluster: Basic proline-rich protein precursor [C... 42 0.023 UniRef50_UPI00015BDD6A Cluster: UPI00015BDD6A related cluster; n... 41 0.030 UniRef50_UPI0000E4922C Cluster: PREDICTED: similar to Enabled ho... 41 0.030 UniRef50_UPI0000498915 Cluster: hypothetical protein 9.t00033; n... 41 0.030 UniRef50_Q4A2Z7 Cluster: Putative membrane protein precursor; n=... 41 0.030 UniRef50_Q4A263 Cluster: Putative membrane protein; n=1; Emilian... 41 0.030 UniRef50_Q0M671 Cluster: Glycoside hydrolase, family 16:Hemolysi... 41 0.030 UniRef50_A4M4S8 Cluster: Putative uncharacterized protein precur... 41 0.030 UniRef50_Q948Y7 Cluster: VMP3 protein; n=1; Volvox carteri f. na... 41 0.030 UniRef50_Q8L7S5 Cluster: AT4g18560/F28J12_220; n=2; Arabidopsis ... 41 0.030 UniRef50_A7QGU9 Cluster: Chromosome chr16 scaffold_94, whole gen... 41 0.030 UniRef50_A5BR16 Cluster: Putative uncharacterized protein; n=1; ... 41 0.030 UniRef50_Q9VAT0 Cluster: CG1520-PA, isoform A; n=3; Sophophora|R... 41 0.030 UniRef50_Q61QV1 Cluster: Putative uncharacterized protein CBG068... 41 0.030 UniRef50_Q0KI93 Cluster: CG12946-PB, isoform B; n=4; Sophophora|... 41 0.030 UniRef50_Q6CD36 Cluster: Similar to sp|P53281 Saccharomyces cere... 41 0.030 UniRef50_A7F7G2 Cluster: Putative uncharacterized protein; n=2; ... 41 0.030 UniRef50_A6SD70 Cluster: Putative uncharacterized protein; n=1; ... 41 0.030 UniRef50_Q6P0D5 Cluster: WW domain-binding protein 11; n=7; Eute... 41 0.030 UniRef50_UPI00015B5C8A Cluster: PREDICTED: similar to formin 1,2... 41 0.040 UniRef50_UPI0000F2CB43 Cluster: PREDICTED: hypothetical protein;... 41 0.040 UniRef50_UPI0000F2B52B Cluster: PREDICTED: similar to diaphanous... 41 0.040 UniRef50_UPI0000D9F058 Cluster: PREDICTED: hypothetical protein;... 41 0.040 UniRef50_UPI0000499A11 Cluster: hypothetical protein 42.t00003; ... 41 0.040 UniRef50_UPI0000DC1448 Cluster: UPI0000DC1448 related cluster; n... 41 0.040 UniRef50_UPI0000F31107 Cluster: PREDICTED: Bos taurus similar to... 41 0.040 UniRef50_Q4RHV8 Cluster: Chromosome 8 SCAF15044, whole genome sh... 41 0.040 UniRef50_Q2NNS2 Cluster: 1629capsid; n=1; Hyphantria cunea nucle... 41 0.040 UniRef50_Q9A2R2 Cluster: OmpA family protein; n=5; Caulobacter|R... 41 0.040 UniRef50_Q8GD27 Cluster: Adhesin FhaB; n=3; cellular organisms|R... 41 0.040 UniRef50_Q0ANI5 Cluster: OmpA/MotB domain protein precursor; n=2... 41 0.040 UniRef50_A1SEF2 Cluster: Putative uncharacterized protein; n=1; ... 41 0.040 UniRef50_A1G4V0 Cluster: Putative uncharacterized protein; n=2; ... 41 0.040 UniRef50_Q9MAV4 Cluster: F24O1.6; n=10; cellular organisms|Rep: ... 41 0.040 UniRef50_Q9LRJ8 Cluster: Genomic DNA, chromosome 3, P1 clone:MZN... 41 0.040 UniRef50_Q6MWG9 Cluster: B1160F02.7 protein; n=3; Oryza sativa|R... 41 0.040 UniRef50_Q08194 Cluster: Cysteine-rich extensin-like protein-1; ... 41 0.040 UniRef50_O65514 Cluster: Putative glycine-rich cell wall protein... 41 0.040 UniRef50_A5BAX2 Cluster: Putative uncharacterized protein; n=1; ... 41 0.040 UniRef50_Q86BM9 Cluster: CG33003-PA; n=1; Drosophila melanogaste... 41 0.040 UniRef50_Q7QCG4 Cluster: ENSANGP00000002933; n=2; Culicidae|Rep:... 41 0.040 UniRef50_Q7KW17 Cluster: CG14622-PC, isoform C; n=10; Coelomata|... 41 0.040 UniRef50_Q60R78 Cluster: Putative uncharacterized protein CBG214... 41 0.040 UniRef50_Q5C200 Cluster: SJCHGC08716 protein; n=1; Schistosoma j... 41 0.040 UniRef50_Q4DD51 Cluster: Putative uncharacterized protein; n=2; ... 41 0.040 UniRef50_A0CYS3 Cluster: Chromosome undetermined scaffold_31, wh... 41 0.040 UniRef50_Q5KAA5 Cluster: Cytokinesis protein sepa (Fh1/2 protein... 41 0.040 UniRef50_Q2H9B7 Cluster: Putative uncharacterized protein; n=1; ... 41 0.040 UniRef50_Q0U6P9 Cluster: Predicted protein; n=1; Phaeosphaeria n... 41 0.040 UniRef50_Q0U3V3 Cluster: Putative uncharacterized protein; n=1; ... 41 0.040 UniRef50_Q9S8M0 Cluster: Chitin-binding lectin 1 precursor; n=1;... 41 0.040 UniRef50_Q6BSP4 Cluster: Branchpoint-bridging protein; n=2; Sacc... 41 0.040 UniRef50_UPI0000D8E03E Cluster: WAS/WASL interacting protein fam... 40 0.053 UniRef50_Q0S5Y2 Cluster: Putative uncharacterized protein; n=1; ... 40 0.053 UniRef50_A3ZRC6 Cluster: Putative uncharacterized protein; n=2; ... 40 0.053 UniRef50_Q8W5K6 Cluster: Putative uncharacterized protein OSJNBa... 40 0.053 UniRef50_Q8H9E1 Cluster: Extensin; n=6; Eukaryota|Rep: Extensin ... 40 0.053 UniRef50_A4S0H7 Cluster: Predicted protein; n=1; Ostreococcus lu... 40 0.053 UniRef50_Q4R8N9 Cluster: Testis cDNA clone: QtsA-11950, similar ... 40 0.053 UniRef50_O61948 Cluster: Ground-like (Grd related) protein 29; n... 40 0.053 UniRef50_Q2H4B1 Cluster: Putative uncharacterized protein; n=1; ... 40 0.053 UniRef50_Q1DS16 Cluster: Putative uncharacterized protein; n=1; ... 40 0.053 UniRef50_A3LVW7 Cluster: Predicted protein; n=1; Pichia stipitis... 40 0.053 UniRef50_P59983 Cluster: Uncharacterized protein Mb2590; n=13; M... 40 0.053 UniRef50_Q70E73 Cluster: Ras-associated and pleckstrin homology ... 40 0.053 UniRef50_P10569 Cluster: Myosin IC heavy chain; n=4; Eukaryota|R... 40 0.053 UniRef50_Q64467 Cluster: Glyceraldehyde-3-phosphate dehydrogenas... 40 0.053 UniRef50_O95466 Cluster: Formin-like protein 1; n=39; Tetrapoda|... 40 0.053 UniRef50_UPI00015B55AC Cluster: PREDICTED: similar to GA10757-PA... 40 0.070 UniRef50_UPI0000DB73DE Cluster: PREDICTED: similar to bancal CG1... 40 0.070 UniRef50_Q2V2M9-2 Cluster: Isoform 2 of Q2V2M9 ; n=9; Amniota|Re... 40 0.070 UniRef50_Q4SE62 Cluster: Chromosome undetermined SCAF14625, whol... 40 0.070 UniRef50_Q4RLP1 Cluster: Chromosome 10 SCAF15019, whole genome s... 40 0.070 UniRef50_Q89X06 Cluster: Blr0521 protein; n=7; Bradyrhizobiaceae... 40 0.070 UniRef50_Q6M9P0 Cluster: Putative uncharacterized protein; n=1; ... 40 0.070 UniRef50_Q08RT8 Cluster: Putative uncharacterized protein; n=1; ... 40 0.070 UniRef50_Q022J1 Cluster: Putative secreted protein precursor; n=... 40 0.070 UniRef50_A6G312 Cluster: Serine/threonine protein kinase; n=1; P... 40 0.070 UniRef50_A6C6U0 Cluster: Putative uncharacterized protein; n=1; ... 40 0.070 UniRef50_P93845 Cluster: Putative uncharacterized protein; n=1; ... 40 0.070 UniRef50_A7Q8L0 Cluster: Chromosome chr5 scaffold_64, whole geno... 40 0.070 UniRef50_Q7JW27 Cluster: RH66493p; n=2; Sophophora|Rep: RH66493p... 40 0.070 UniRef50_Q5TJB8 Cluster: Diaphanous-related formin dDia2; n=2; D... 40 0.070 UniRef50_Q55FU3 Cluster: Putative uncharacterized protein; n=1; ... 40 0.070 UniRef50_Q17G68 Cluster: Formin 1,2/cappuccino; n=2; Culicidae|R... 40 0.070 UniRef50_A2EJF1 Cluster: LIM domain containing protein; n=4; Tri... 40 0.070 UniRef50_A0CS42 Cluster: Chromosome undetermined scaffold_26, wh... 40 0.070 UniRef50_Q5KG31 Cluster: Putative uncharacterized protein; n=3; ... 40 0.070 UniRef50_Q560V3 Cluster: Putative uncharacterized protein; n=2; ... 40 0.070 UniRef50_Q2GSB8 Cluster: Predicted protein; n=1; Chaetomium glob... 40 0.070 UniRef50_A3LN86 Cluster: Protein involved in actin organization ... 40 0.070 UniRef50_Q15427 Cluster: Splicing factor 3B subunit 4; n=37; Euk... 40 0.070 UniRef50_P28702 Cluster: Retinoic acid receptor RXR-beta; n=240;... 40 0.070 UniRef50_Q05858 Cluster: Formin; n=26; Euteleostomi|Rep: Formin ... 40 0.070 UniRef50_Q2V2M9 Cluster: FH1/FH2 domain-containing protein 3; n=... 40 0.070 UniRef50_P22357 Cluster: Anther-specific protein SF18 precursor;... 40 0.070 UniRef50_Q9W3G1 Cluster: CG10555-PA; n=2; Drosophila melanogaste... 35 0.072 UniRef50_UPI0000DA3CD5 Cluster: PREDICTED: hypothetical protein;... 40 0.093 UniRef50_UPI0000DA1F29 Cluster: PREDICTED: hypothetical protein;... 40 0.093 UniRef50_UPI0000DA1EB9 Cluster: PREDICTED: hypothetical protein;... 40 0.093 UniRef50_Q4SS96 Cluster: Chromosome 11 SCAF14479, whole genome s... 40 0.093 UniRef50_Q4A373 Cluster: Putative lectin protein precursor; n=1;... 40 0.093 UniRef50_Q5XHX3 Cluster: Enabled homolog; n=5; Tetrapoda|Rep: En... 40 0.093 UniRef50_Q56B20 Cluster: Cell surface antigen Sca2-6; n=4; Ricke... 40 0.093 UniRef50_Q02AB7 Cluster: RNP-1 like RNA-binding protein; n=2; ce... 40 0.093 UniRef50_A3PW04 Cluster: U5 snRNP spliceosome subunit-like prote... 40 0.093 UniRef50_A0QHS8 Cluster: Putative uncharacterized protein; n=2; ... 40 0.093 UniRef50_Q9SN46 Cluster: Extensin-like protein; n=4; Magnoliophy... 40 0.093 UniRef50_Q7XLQ4 Cluster: OSJNBa0044M19.2 protein; n=2; Oryza sat... 40 0.093 UniRef50_Q6PSU8 Cluster: Formin homology 2 domain-containing pro... 40 0.093 UniRef50_Q10Q99 Cluster: Transposon protein, putative, unclassif... 40 0.093 UniRef50_Q00TD0 Cluster: Chromosome 17 contig 1, DNA sequence; n... 40 0.093 UniRef50_A7DWG3 Cluster: Cell wall glycoprotein GP2; n=4; Chlamy... 40 0.093 UniRef50_Q9VEJ1 Cluster: CG5836-PA; n=10; Eumetazoa|Rep: CG5836-... 40 0.093 UniRef50_Q9UA70 Cluster: Unconventional myosin heavy chain MyoK;... 40 0.093 UniRef50_Q6IIW5 Cluster: HDC16773; n=3; Endopterygota|Rep: HDC16... 40 0.093 UniRef50_Q54XH4 Cluster: SAP DNA-binding domain-containing prote... 40 0.093 UniRef50_Q54CK9 Cluster: Putative uncharacterized protein; n=1; ... 40 0.093 UniRef50_A7RNZ0 Cluster: Predicted protein; n=1; Nematostella ve... 40 0.093 UniRef50_A7RKG0 Cluster: Predicted protein; n=1; Nematostella ve... 40 0.093 UniRef50_A7RJG2 Cluster: Predicted protein; n=1; Nematostella ve... 40 0.093 UniRef50_Q96JH1 Cluster: KIAA1856 protein; n=21; Eutheria|Rep: K... 40 0.093 UniRef50_Q6AHS6 Cluster: Protease-1 (PRT1) protein, putative; n=... 40 0.093 UniRef50_Q0CUB4 Cluster: Predicted protein; n=1; Aspergillus ter... 40 0.093 UniRef50_A5DRR5 Cluster: Putative uncharacterized protein; n=1; ... 40 0.093 UniRef50_A4RD40 Cluster: Putative uncharacterized protein; n=2; ... 40 0.093 UniRef50_Q82K53 Cluster: Translation initiation factor IF-2; n=5... 40 0.093 UniRef50_Q03173 Cluster: Protein enabled homolog; n=18; Euteleos... 40 0.093 UniRef50_UPI00015B56FF Cluster: PREDICTED: similar to splicing f... 39 0.12 UniRef50_UPI0000F1EA7E Cluster: PREDICTED: similar to LOC495114 ... 39 0.12 UniRef50_UPI0000E7FD76 Cluster: PREDICTED: similar to SH3 domain... 39 0.12 UniRef50_UPI0000498407 Cluster: hypothetical protein 13.t00006; ... 39 0.12 UniRef50_UPI0000ECCC14 Cluster: WAS/WASL interacting protein fam... 39 0.12 UniRef50_P42859-2 Cluster: Isoform Short of P42859 ; n=7; Deuter... 39 0.12 UniRef50_Q4RY48 Cluster: Chromosome 3 SCAF14978, whole genome sh... 39 0.12 UniRef50_Q1L903 Cluster: Novel protein similar to vertebrate for... 39 0.12 UniRef50_Q08D38 Cluster: LOC779576 protein; n=3; Xenopus tropica... 39 0.12 UniRef50_A6G1X8 Cluster: Single-stranded DNA-binding protein; n=... 39 0.12 UniRef50_Q0JD12 Cluster: Os04g0438100 protein; n=2; Oryza sativa... 39 0.12 UniRef50_Q09084 Cluster: Extensin (Class II) precursor; n=3; Sol... 39 0.12 UniRef50_A5BPY4 Cluster: Putative uncharacterized protein; n=1; ... 39 0.12 UniRef50_Q54CQ8 Cluster: Putative uncharacterized protein; n=1; ... 39 0.12 UniRef50_A7SIC8 Cluster: Predicted protein; n=2; Nematostella ve... 39 0.12 UniRef50_A2D8Z8 Cluster: Putative uncharacterized protein; n=1; ... 39 0.12 UniRef50_Q59P09 Cluster: Putative uncharacterized protein; n=2; ... 39 0.12 UniRef50_Q0UMH1 Cluster: Putative uncharacterized protein; n=1; ... 39 0.12 UniRef50_A4R0U8 Cluster: Predicted protein; n=1; Magnaporthe gri... 39 0.12 UniRef50_A1CLV3 Cluster: Putative uncharacterized protein; n=2; ... 39 0.12 UniRef50_Q8WZX5 Cluster: 5'-3' exoribonuclease 2; n=11; Pezizomy... 39 0.12 UniRef50_Q96S59 Cluster: Ran-binding protein 9; n=51; Euteleosto... 39 0.12 UniRef50_Q16630 Cluster: Cleavage and polyadenylation specificit... 39 0.12 UniRef50_UPI00015B5EB5 Cluster: PREDICTED: similar to CG3606-PB;... 39 0.16 UniRef50_UPI0000E45FF5 Cluster: PREDICTED: hypothetical protein;... 39 0.16 UniRef50_UPI0000E24FE8 Cluster: PREDICTED: hypothetical protein;... 39 0.16 UniRef50_UPI0000DA32FB Cluster: PREDICTED: hypothetical protein;... 39 0.16 UniRef50_UPI0000D561BD Cluster: PREDICTED: hypothetical protein;... 39 0.16 UniRef50_UPI0000F30DFE Cluster: UPI0000F30DFE related cluster; n... 39 0.16 UniRef50_Q4A2S6 Cluster: Putative membrane protein precursor; n=... 39 0.16 UniRef50_Q67N42 Cluster: Putative uncharacterized protein; n=1; ... 39 0.16 UniRef50_Q127H7 Cluster: Putative uncharacterized protein precur... 39 0.16 UniRef50_A5NR52 Cluster: Putative uncharacterized protein; n=1; ... 39 0.16 UniRef50_Q9SRL3 Cluster: F9F8.15 protein; n=13; Magnoliophyta|Re... 39 0.16 UniRef50_Q69XV3 Cluster: Putative glycine-rich cell wall structu... 39 0.16 UniRef50_Q5JNC9 Cluster: Putative receptor protein kinase PERK1;... 39 0.16 UniRef50_Q3ECQ3 Cluster: Uncharacterized protein At1g54215.1; n=... 39 0.16 UniRef50_Q10I10 Cluster: Transposon protein, putative, CACTA, En... 39 0.16 UniRef50_Q0JLP7 Cluster: Os01g0584100 protein; n=5; Oryza sativa... 39 0.16 UniRef50_Q0DME4 Cluster: Os03g0813200 protein; n=4; Oryza sativa... 39 0.16 UniRef50_A7Q9D7 Cluster: Chromosome chr19 scaffold_66, whole gen... 39 0.16 UniRef50_A5B0K8 Cluster: Putative uncharacterized protein; n=1; ... 39 0.16 UniRef50_A4S1Y9 Cluster: Predicted protein; n=1; Ostreococcus lu... 39 0.16 UniRef50_A4S0Z6 Cluster: Predicted protein; n=2; Ostreococcus|Re... 39 0.16 UniRef50_Q9BL72 Cluster: Putative uncharacterized protein; n=2; ... 39 0.16 UniRef50_Q7KUL0 Cluster: CG9425-PB, isoform B; n=4; Diptera|Rep:... 39 0.16 UniRef50_Q581C6 Cluster: Flagellum-adhesion glycoprotein, putati... 39 0.16 UniRef50_Q4QAM2 Cluster: Formin, putative; n=3; Leishmania|Rep: ... 39 0.16 UniRef50_Q20327 Cluster: Ground-like (Grd related) protein 4; n=... 39 0.16 UniRef50_Q1ZXG9 Cluster: Argonaut-like protein; n=1; Dictyosteli... 39 0.16 UniRef50_A7S7W0 Cluster: Predicted protein; n=1; Nematostella ve... 39 0.16 UniRef50_A2FMX2 Cluster: DnaK protein; n=2; Trichomonas vaginali... 39 0.16 UniRef50_Q6C7Q8 Cluster: Similar to tr|Q95JC9 Sus scrofa Basic p... 39 0.16 UniRef50_Q9FPQ6 Cluster: Vegetative cell wall protein gp1 precur... 39 0.16 UniRef50_UPI0000E49E39 Cluster: PREDICTED: similar to Wiskott-Al... 38 0.21 UniRef50_UPI0000E47360 Cluster: PREDICTED: hypothetical protein;... 38 0.21 UniRef50_UPI0000DA3E0C Cluster: PREDICTED: similar to tumor endo... 38 0.21 UniRef50_UPI000049858C Cluster: hypothetical protein 101.t00009;... 38 0.21 UniRef50_UPI00004D6F7D Cluster: formin-like 2; n=3; Euteleostomi... 38 0.21 UniRef50_UPI0000F30E84 Cluster: UPI0000F30E84 related cluster; n... 38 0.21 UniRef50_Q4SVG8 Cluster: Chromosome undetermined SCAF13758, whol... 38 0.21 UniRef50_Q06KR7 Cluster: Viral capsid associated protein; n=3; N... 38 0.21 UniRef50_Q9L252 Cluster: Putative uncharacterized protein SCO266... 38 0.21 UniRef50_Q0C0P5 Cluster: OmpA family protein; n=1; Hyphomonas ne... 38 0.21 UniRef50_A4FBY5 Cluster: Putative uncharacterized protein; n=1; ... 38 0.21 UniRef50_A4F8P4 Cluster: PE-PGRS family protein; n=1; Saccharopo... 38 0.21 UniRef50_Q9XEV2 Cluster: Putative uncharacterized protein; n=2; ... 38 0.21 UniRef50_Q9FF14 Cluster: Similarity to unknown protein; n=3; Ara... 38 0.21 UniRef50_Q8GWD9 Cluster: Putative uncharacterized protein At4g28... 38 0.21 UniRef50_Q53LC9 Cluster: Transposon protein, putative, CACTA, En... 38 0.21 UniRef50_Q0J2H9 Cluster: Os09g0341100 protein; n=8; Oryza sativa... 38 0.21 UniRef50_Q00X46 Cluster: Chromosome 13 contig 1, DNA sequence; n... 38 0.21 UniRef50_Q00TR5 Cluster: Homology to unknown gene; n=3; Ostreoco... 38 0.21 UniRef50_Q9GZH1 Cluster: Putative uncharacterized protein; n=1; ... 38 0.21 UniRef50_Q7PNI8 Cluster: ENSANGP00000013088; n=1; Anopheles gamb... 38 0.21 UniRef50_Q6NMX2 Cluster: RE20733p; n=1; Drosophila melanogaster|... 38 0.21 UniRef50_Q61N21 Cluster: Putative uncharacterized protein CBG082... 38 0.21 UniRef50_Q18880 Cluster: Putative uncharacterized protein grl-17... 38 0.21 UniRef50_A7SL00 Cluster: Predicted protein; n=2; Fungi/Metazoa g... 38 0.21 UniRef50_A2E6V2 Cluster: WH2 motif family protein; n=3; Trichomo... 38 0.21 UniRef50_A2DXB4 Cluster: Formin Homology 2 Domain containing pro... 38 0.21 UniRef50_A0CRC9 Cluster: Chromosome undetermined scaffold_25, wh... 38 0.21 UniRef50_Q5T8W7 Cluster: Espin; n=51; Euteleostomi|Rep: Espin - ... 38 0.21 UniRef50_Q8WZK9 Cluster: Putative uncharacterized protein B14D6.... 38 0.21 UniRef50_Q6C5T8 Cluster: Similar to tr|O94060 Candida albicans H... 38 0.21 UniRef50_Q3HYB9 Cluster: Proline-and threonine-rich protein; n=2... 38 0.21 UniRef50_Q2H239 Cluster: Putative uncharacterized protein; n=1; ... 38 0.21 UniRef50_A7LNW5 Cluster: Hydrophobin; n=1; Trichoderma atrovirid... 38 0.21 UniRef50_A4R5L4 Cluster: Putative uncharacterized protein; n=1; ... 38 0.21 UniRef50_P50552 Cluster: Vasodilator-stimulated phosphoprotein; ... 38 0.21 UniRef50_Q61900 Cluster: Submaxillary gland androgen-regulated p... 38 0.21 UniRef50_Q15637 Cluster: Splicing factor 1; n=57; Euteleostomi|R... 38 0.21 UniRef50_P19835 Cluster: Bile salt-activated lipase precursor; n... 38 0.21 UniRef50_UPI00015B42DB Cluster: PREDICTED: hypothetical protein;... 38 0.28 UniRef50_UPI0000F2E6AE Cluster: PREDICTED: hypothetical protein;... 38 0.28 UniRef50_UPI0000E494ED Cluster: PREDICTED: similar to FIP1 like ... 38 0.28 UniRef50_UPI0000D5542F Cluster: PREDICTED: similar to CG1105-PA;... 38 0.28 UniRef50_UPI000023F6A5 Cluster: hypothetical protein FG10389.1; ... 38 0.28 UniRef50_UPI0000DC00CB Cluster: SH3 domain binding protein CR16;... 38 0.28 UniRef50_UPI000066086F Cluster: Homolog of Gallus gallus "Diapha... 38 0.28 UniRef50_Q5RGE7 Cluster: Novel protein similar to vertebrate SH3... 38 0.28 UniRef50_Q4T4L4 Cluster: Chromosome undetermined SCAF9593, whole... 38 0.28 UniRef50_Q82I93 Cluster: Putative uncharacterized protein; n=1; ... 38 0.28 UniRef50_Q7WHU6 Cluster: Autotransporter; n=16; Bordetella|Rep: ... 38 0.28 UniRef50_Q0M4S1 Cluster: TonB-like; n=1; Caulobacter sp. K31|Rep... 38 0.28 UniRef50_Q0LTW4 Cluster: Peptidase M56, BlaR1 precursor; n=1; Ca... 38 0.28 UniRef50_A3ET02 Cluster: Putative uncharacterized protein; n=2; ... 38 0.28 UniRef50_A0GWT4 Cluster: Putative uncharacterized protein; n=2; ... 38 0.28 UniRef50_Q9LMQ1 Cluster: F7H2.17 protein; n=2; Arabidopsis thali... 38 0.28 UniRef50_Q9ATK5 Cluster: PF6 protein; n=1; Chlamydomonas reinhar... 38 0.28 UniRef50_Q8S9B5 Cluster: Matrix metalloproteinase; n=1; Volvox c... 38 0.28 UniRef50_Q76KW3 Cluster: Hydroxyproline-rich glycoprotein-2; n=1... 38 0.28 UniRef50_Q6ZD62 Cluster: Putative pherophorin-dz1 protein; n=4; ... 38 0.28 UniRef50_Q6Z5P9 Cluster: Putative uncharacterized protein OSJNBa... 38 0.28 UniRef50_Q10MZ1 Cluster: Expressed protein; n=3; Oryza sativa|Re... 38 0.28 UniRef50_Q0IS03 Cluster: Os11g0579700 protein; n=1; Oryza sativa... 38 0.28 UniRef50_Q0DSG8 Cluster: Os03g0308700 protein; n=1; Oryza sativa... 38 0.28 UniRef50_Q01A81 Cluster: Serine/threonine specific protein phosp... 38 0.28 UniRef50_A7QQ26 Cluster: Chromosome chr2 scaffold_140, whole gen... 38 0.28 UniRef50_A5BK18 Cluster: Putative uncharacterized protein; n=1; ... 38 0.28 UniRef50_Q581B0 Cluster: Putative uncharacterized protein; n=5; ... 38 0.28 UniRef50_Q57WJ7 Cluster: Calpain, putative; n=3; Trypanosoma bru... 38 0.28 UniRef50_Q55FT9 Cluster: Component of SCAR regulatory complex; n... 38 0.28 UniRef50_Q54U84 Cluster: Putative uncharacterized protein; n=1; ... 38 0.28 UniRef50_A7SPL8 Cluster: Predicted protein; n=1; Nematostella ve... 38 0.28 UniRef50_A4HCC8 Cluster: Putative uncharacterized protein; n=2; ... 38 0.28 UniRef50_A2F4E1 Cluster: Putative uncharacterized protein; n=1; ... 38 0.28 UniRef50_Q6BNL1 Cluster: Similar to sp|P32521 Saccharomyces cere... 38 0.28 UniRef50_Q5A2S7 Cluster: Potential actin-binding protein; n=1; C... 38 0.28 UniRef50_Q2HGM6 Cluster: Putative uncharacterized protein; n=1; ... 38 0.28 UniRef50_Q2H9M3 Cluster: Putative uncharacterized protein; n=1; ... 38 0.28 UniRef50_Q2H3D5 Cluster: Putative uncharacterized protein; n=3; ... 38 0.28 UniRef50_A3GHC4 Cluster: Predicted protein; n=1; Pichia stipitis... 38 0.28 UniRef50_Q5V7N6 Cluster: Putative uncharacterized protein; n=1; ... 38 0.28 UniRef50_O36027 Cluster: Wiskott-Aldrich syndrome homolog protei... 38 0.28 UniRef50_Q9ULL5 Cluster: Proline-rich protein 12; n=19; Eutheria... 38 0.28 UniRef50_Q03211 Cluster: Pistil-specific extensin-like protein p... 38 0.28 UniRef50_O95835 Cluster: Serine/threonine-protein kinase LATS1; ... 38 0.28 UniRef50_O94532 Cluster: Formin-3; n=1; Schizosaccharomyces pomb... 38 0.28 UniRef50_UPI00015B52EC Cluster: PREDICTED: similar to ENSANGP000... 38 0.37 UniRef50_UPI0001555783 Cluster: PREDICTED: similar to antifreeze... 38 0.37 UniRef50_UPI0000E4908A Cluster: PREDICTED: hypothetical protein;... 38 0.37 UniRef50_UPI0000E464D4 Cluster: PREDICTED: similar to ENSANGP000... 38 0.37 UniRef50_UPI0000DB6D2F Cluster: PREDICTED: hypothetical protein;... 38 0.37 UniRef50_UPI0000584BDF Cluster: PREDICTED: similar to MGC84378 p... 38 0.37 UniRef50_UPI0000EB2E07 Cluster: UPI0000EB2E07 related cluster; n... 38 0.37 UniRef50_Q7SZN7 Cluster: Enah/Vasp-like a; n=3; Danio rerio|Rep:... 38 0.37 UniRef50_Q5ZIC9 Cluster: Putative uncharacterized protein; n=4; ... 38 0.37 UniRef50_Q4T4H8 Cluster: Chromosome 2 SCAF9640, whole genome sho... 38 0.37 UniRef50_Q9YMX1 Cluster: Essential structural protein pp78-81; n... 38 0.37 UniRef50_Q6N0Q5 Cluster: Putative uncharacterized protein precur... 38 0.37 UniRef50_Q5YPL1 Cluster: Putative stress protein; n=1; Nocardia ... 38 0.37 UniRef50_Q2J3C8 Cluster: OmpA/MotB precursor; n=4; Alphaproteoba... 38 0.37 UniRef50_A4LPA5 Cluster: Intracellular motility protein A; n=6; ... 38 0.37 UniRef50_A3Q026 Cluster: Putative uncharacterized protein precur... 38 0.37 UniRef50_A1UGS6 Cluster: Fibronectin-attachment family protein p... 38 0.37 UniRef50_A0LQ52 Cluster: Putative uncharacterized protein; n=1; ... 38 0.37 UniRef50_Q9FXA1 Cluster: F14J22.4 protein; n=2; Arabidopsis thal... 38 0.37 UniRef50_Q9FW12 Cluster: Putative proteophosphoglycan; n=1; Oryz... 38 0.37 UniRef50_Q7XCX5 Cluster: Plus-3 domain containing protein, expre... 38 0.37 >UniRef50_Q9LI74 Cluster: Similarity to pherophorin; n=1; Arabidopsis thaliana|Rep: Similarity to pherophorin - Arabidopsis thaliana (Mouse-ear cress) Length = 1004 Score = 58.4 bits (135), Expect = 2e-07 Identities = 27/53 (50%), Positives = 27/53 (50%), Gaps = 1/53 (1%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPX-GXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 PPR GGG PP G PPPPP PPPP GGG PPPPP P Sbjct: 655 PPRSAGGGKSTNLPSARPPLPGGGPPPPPPPPGGGPPPPP--GGGPPPPPPPP 705 Score = 39.5 bits (88), Expect = 0.093 Identities = 14/20 (70%), Positives = 14/20 (70%) Frame = -1 Query: 404 PPPPPPGGXXXTPXGGXPPP 345 PPPPPPGG P GG PPP Sbjct: 681 PPPPPPGGGPPPPPGGGPPP 700 Score = 37.5 bits (83), Expect = 0.37 Identities = 18/42 (42%), Positives = 18/42 (42%), Gaps = 2/42 (4%) Frame = -1 Query: 464 GGGGGXXXPXGGXXXXXKXXPPPPPP--GGXXXTPXGGXPPP 345 GGG P PPPPPP GG P GG PPP Sbjct: 660 GGGKSTNLPSARPPLPGGGPPPPPPPPGGGPPPPPGGGPPPP 701 Score = 33.9 bits (74), Expect = 4.6 Identities = 23/65 (35%), Positives = 24/65 (36%), Gaps = 5/65 (7%) Frame = -1 Query: 536 RGGGGGGXSX-----PXXGGGGXXXXXXXGGGGGXXXPXGGXXXXXKXXPPPPPPGGXXX 372 R GGG + P GGG GGG P GG PPPPPPG Sbjct: 657 RSAGGGKSTNLPSARPPLPGGGPPPPPPPPGGGPPPPPGGGPP------PPPPPPGALGR 710 Query: 371 TPXGG 357 GG Sbjct: 711 GAGGG 715 >UniRef50_Q8IU42 Cluster: Formin homology protein A; n=2; Dictyostelium discoideum|Rep: Formin homology protein A - Dictyostelium discoideum (Slime mold) Length = 1218 Score = 57.6 bits (133), Expect = 3e-07 Identities = 30/67 (44%), Positives = 30/67 (44%), Gaps = 5/67 (7%) Frame = +3 Query: 381 PPRGGGGGXXFXXX-----GXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXX 545 PP GGGG G PP PPPPP PPPP GGG PPPPP P Sbjct: 670 PPMTGGGGPPPPPPPPPMTGGGPPP--PPPPPPMTGGGPPPPPPPPGGGPPPPPPPPGAK 727 Query: 546 AXXXXPP 566 A PP Sbjct: 728 AGGPPPP 734 Score = 52.4 bits (120), Expect = 1e-05 Identities = 27/68 (39%), Positives = 27/68 (39%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXX 560 PP GGG G PPPPP PPPP GGG PPPPP P Sbjct: 655 PPMTGGGAPPPPPPPPPMTGGGGPPPPP-------PPPPMTGGGPPPPPPPPPMTGGGPP 707 Query: 561 PPXXXXXG 584 PP G Sbjct: 708 PPPPPPGG 715 Score = 46.4 bits (105), Expect = 8e-04 Identities = 23/54 (42%), Positives = 23/54 (42%), Gaps = 2/54 (3%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXXPPPPPXXXXXXSPPPPXXG--GGXPPPPPXP 536 PP GGG G PPPPP PPPP G G PPPPP P Sbjct: 684 PPPMTGGGPPPPPPPPPMTGGGPPPPPPPPGGGPPPPPPPPGAKAGGPPPPPPP 737 Score = 46.0 bits (104), Expect = 0.001 Identities = 18/35 (51%), Positives = 18/35 (51%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPP 534 PP G PPPPP K PPPP PPPPP Sbjct: 712 PPGGGPPPPPPPPGAKAGGPPPPPPPFGKGPPPPP 746 Score = 45.6 bits (103), Expect = 0.001 Identities = 24/62 (38%), Positives = 24/62 (38%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXX 560 P GGG G PP PPPPP PPPP G PPPPP Sbjct: 700 PMTGGGPPPPPPPPGGGPPP---PPPPPGAKAGGPPPPPPPFGKGPPPPPGGFGMKKAAA 756 Query: 561 PP 566 PP Sbjct: 757 PP 758 Score = 42.3 bits (95), Expect = 0.013 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 P G PPPPP PPPP PPPPP A PP Sbjct: 713 PGGGPPPPPPPPGAKAGGPPPPPPPFGKGPPPPPGGFGMKKAAAPP 758 Score = 41.5 bits (93), Expect = 0.023 Identities = 24/68 (35%), Positives = 24/68 (35%), Gaps = 2/68 (2%) Frame = +1 Query: 337 PXXGGGXPPXGVXSXXXXXXXXXXFXXXXXXPPXGXXXPPPPPXXXKXXXPPPPXXG--X 510 P GGG PP P G PPPPP PPPP G Sbjct: 671 PMTGGGGPPPPPPPPPMTGGGPPP--PPPPPPMTGGGPPPPPPPPGGGPPPPPPPPGAKA 728 Query: 511 XXPPPPPP 534 PPPPPP Sbjct: 729 GGPPPPPP 736 Score = 40.7 bits (91), Expect = 0.040 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = +3 Query: 486 PPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PPPP GGG PPPPP P PP Sbjct: 653 PPPPMTGGGAPPPPPPPPPMTGGGGPP 679 Score = 39.9 bits (89), Expect = 0.070 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = +1 Query: 439 GXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 G PPPPP PPPP PPPPP PP Sbjct: 704 GGPPPPPPPPGGGPPPPPPPPGAKAGGPPPPPPPFGKGPPPPP 746 Score = 37.5 bits (83), Expect = 0.37 Identities = 18/46 (39%), Positives = 19/46 (41%), Gaps = 7/46 (15%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXX-------GXXXPPPPPPLXXXXXAXXPP 567 PPPPP PPPP G PPPPPP+ PP Sbjct: 652 PPPPPMTGGGAPPPPPPPPPMTGGGGPPPPPPPPPMTGGGPPPPPP 697 Score = 36.7 bits (81), Expect = 0.65 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = +3 Query: 453 PPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PPPP PPP GG PPPPP P PP Sbjct: 650 PPPP-------PPPMTGGGAPPPPPPPPPMTGGGGPPP 680 Score = 34.3 bits (75), Expect = 3.5 Identities = 23/67 (34%), Positives = 23/67 (34%) Frame = -2 Query: 583 PXXXXXGGXXXXAXXXGXGGGGGXPPPXXGGGGXXFXXXXGGGGGXXPXGGXXPXFXKXX 404 P GG GGG PPP GGG G P P F K Sbjct: 684 PPPMTGGGPPPPPPPPPMTGGGPPPPPPPPGGGPPPPPPPPGAKAGGPP-PPPPPFGK-G 741 Query: 403 PPPPPRG 383 PPPPP G Sbjct: 742 PPPPPGG 748 >UniRef50_A7SLQ1 Cluster: Predicted protein; n=2; Nematostella vectensis|Rep: Predicted protein - Nematostella vectensis Length = 1027 Score = 53.2 bits (122), Expect = 7e-06 Identities = 27/62 (43%), Positives = 27/62 (43%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXX 560 PP G GG P G PPPPP PPPP GGG PPPPP P Sbjct: 432 PPPPGMGGAPPPPPPPPPGMGGGPPPPP-------PPPPGPGGGPPPPPPPPGGGPPGPP 484 Query: 561 PP 566 PP Sbjct: 485 PP 486 Score = 51.2 bits (117), Expect = 3e-05 Identities = 27/68 (39%), Positives = 27/68 (39%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXX 560 PP GG P G PPPPP PPPP GGG PPPPP P Sbjct: 418 PPPPPPGGVPPPPPPPPPGMGGAPPPPP-------PPPPGMGGGPPPPPPPPPGPGGGPP 470 Query: 561 PPXXXXXG 584 PP G Sbjct: 471 PPPPPPGG 478 Score = 48.8 bits (111), Expect = 2e-04 Identities = 21/43 (48%), Positives = 21/43 (48%), Gaps = 1/43 (2%) Frame = +3 Query: 441 GXXPPPPPXXXXXXSPPPPXXG-GGXPPPPPXPXXXAXXXXPP 566 G PPPPP PPPP G GG PPPPP P PP Sbjct: 415 GPPPPPPPPGGVPPPPPPPPPGMGGAPPPPPPPPPGMGGGPPP 457 Score = 47.6 bits (108), Expect = 4e-04 Identities = 25/52 (48%), Positives = 25/52 (48%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 PP G GGG PP PPPPP PPPP GGG P PPP P Sbjct: 447 PPPGMGGGPP-------PP----PPPPPGPGGGPPPPPPPPGGGPPGPPPPP 487 Score = 42.3 bits (95), Expect = 0.013 Identities = 20/46 (43%), Positives = 20/46 (43%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP G PPPP PPPP G PPPPPP PP Sbjct: 447 PPPGMGGGPPPPP------PPPPGPGGGPPPPPPPPGGGPPGPPPP 486 Score = 37.5 bits (83), Expect = 0.37 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PPPP PPPP G PPPPP PP Sbjct: 446 PPPPGMGGGPPPPPPPPPGPGGGPPPPPPPPGGGPPGPP 484 Score = 33.9 bits (74), Expect = 4.6 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = -1 Query: 461 GGGGXXXPXGGXXXXXKXXPPPPPPGGXXXTPXGGXPPP 345 GGG P PPPPPPGG P G PPP Sbjct: 452 GGGPPPPPPPPPGPGGGPPPPPPPPGGG---PPGPPPPP 487 >UniRef50_A2DM28 Cluster: Diaphanous, putative; n=1; Trichomonas vaginalis G3|Rep: Diaphanous, putative - Trichomonas vaginalis G3 Length = 620 Score = 52.8 bits (121), Expect = 9e-06 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 P G PPPPP PPPP GG PPPPP P PP Sbjct: 517 PGAGVPPPPPPPGAGAPPPPPPPAGGAPPPPPPPPPKGGAPPPPP 561 Score = 48.8 bits (111), Expect = 2e-04 Identities = 21/51 (41%), Positives = 21/51 (41%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPPXXXXXG 584 P PP PP PPPP G G PPPPP P A PP G Sbjct: 505 PSAPGVPPAPPLPGAGVPPPPPPPGAGAPPPPPPPAGGAPPPPPPPPPKGG 555 Score = 47.2 bits (107), Expect = 5e-04 Identities = 20/46 (43%), Positives = 20/46 (43%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 P G PPPPP PPPP PPPPPP A PP Sbjct: 515 PLPGAGVPPPPPPPGAGAPPPPPPPAGGAPPPPPPPPPKGGAPPPP 560 Score = 46.8 bits (106), Expect = 6e-04 Identities = 20/38 (52%), Positives = 20/38 (52%), Gaps = 3/38 (7%) Frame = +3 Query: 432 PPXGXX---PPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 PP G PPPPP PPPP GG PPPPP P Sbjct: 526 PPPGAGAPPPPPPPAGGAPPPPPPPPPKGGAPPPPPPP 563 Score = 46.0 bits (104), Expect = 0.001 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PP PP PPPP G PPPPPP PP Sbjct: 504 PPSAPGVPPAPPLPGAGVPPPPPPPGAGAPPPPPPPAGGAPPPPPP 549 Score = 44.0 bits (99), Expect = 0.004 Identities = 17/33 (51%), Positives = 17/33 (51%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPP 528 PP G PPPPP K PPPP PPPP Sbjct: 538 PPAGGAPPPPPPPPPKGGAPPPPPPPARAPPPP 570 Score = 42.3 bits (95), Expect = 0.013 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = +3 Query: 456 PPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PPP P PP G G PPPPP P A PP Sbjct: 502 PPPPSAPGVPPAPPLPGAGVPPPPPPPGAGAPPPPPP 538 Score = 40.3 bits (90), Expect = 0.053 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPP 534 PP PPPPP PPPP PPPPPP Sbjct: 108 PPPPPARPPPPPPTAPPATPPPPPPN--HPPPPPP 140 Score = 39.5 bits (88), Expect = 0.093 Identities = 15/32 (46%), Positives = 16/32 (50%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPP 527 PP PPPPP +PPPP PPPP Sbjct: 109 PPPPARPPPPPPTAPPATPPPPPPNHPPPPPP 140 Score = 39.1 bits (87), Expect = 0.12 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPP 534 PP PPPPP PPPP PPPPPP Sbjct: 101 PPPKSDAPPPPP---ARPPPPPPTAPPATPPPPPP 132 Score = 37.9 bits (84), Expect = 0.28 Identities = 19/45 (42%), Positives = 20/45 (44%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP +PPPP PPPPP A PP Sbjct: 93 PPPARPPPPPPKSD---APPPPP---ARPPPPPPTAPPATPPPPP 131 Score = 37.1 bits (82), Expect = 0.50 Identities = 18/48 (37%), Positives = 18/48 (37%), Gaps = 2/48 (4%) Frame = +2 Query: 431 PPXGXX--XPPPPXXXXKXXXPPPXXXGXXXPPPPXPXXXXXXXXPPP 568 PP PPPP PPP G PPPP P PPP Sbjct: 514 PPLPGAGVPPPPPPPGAGAPPPPPPPAGGAPPPPPPPPPKGGAPPPPP 561 Score = 37.1 bits (82), Expect = 0.50 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 4/39 (10%) Frame = +1 Query: 430 PPXGXX----XPPPPPXXXKXXXPPPPXXGXXXPPPPPP 534 PP PPPPP PPPP PPPPPP Sbjct: 524 PPPPPGAGAPPPPPPPAGGAPPPPPPPPPKGGAPPPPPP 562 Score = 36.7 bits (81), Expect = 0.65 Identities = 17/48 (35%), Positives = 18/48 (37%), Gaps = 2/48 (4%) Frame = +1 Query: 430 PPXGXXXPP--PPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PP PPP PPPP PPPP + PP Sbjct: 116 PPPPPTAPPATPPPPPPNHPPPPPPKSNDIPPPPPAAIPPPAPPATPP 163 Score = 36.7 bits (81), Expect = 0.65 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = +1 Query: 439 GXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 G PPP P PP G PPPPPP PP Sbjct: 496 GEAPSAPPPPSAPGVPPAPPLPGAGVPPPPPPPGAGAPPPPPP 538 Score = 36.3 bits (80), Expect = 0.86 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PPPPP K PPPP PPPPPP PP Sbjct: 98 PPPPPP--KSDAPPPPPA---RPPPPPPTAPPATPPPPP 131 Score = 36.3 bits (80), Expect = 0.86 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPP 530 PP P PP PPPP PPPPP Sbjct: 118 PPPTAPPATPPPPPPNHPPPPPPKSNDIPPPPP 150 Score = 36.3 bits (80), Expect = 0.86 Identities = 20/49 (40%), Positives = 21/49 (42%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPP 527 PP GG P G PPPPP +PPPP G PPPP Sbjct: 535 PPPPPAGGAPPPPPPPPPKGGAPPPPPP---PARAPPPP---AGTPPPP 577 Score = 35.1 bits (77), Expect = 2.0 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPP P A P Sbjct: 129 PPPPNHPPPPPPKSNDIPPPPP---AAIPPPAPPATPPAAPPKKP 170 Score = 33.9 bits (74), Expect = 4.6 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +3 Query: 435 PXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 P P P P PPPP PPPPP PP Sbjct: 81 PAEEPPAPAPAAPPPARPPPPPPKSDAPPPPPARPPPPPPTAPP 124 Score = 33.5 bits (73), Expect = 6.1 Identities = 15/46 (32%), Positives = 15/46 (32%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 P P P P PPPP PPPPP PP Sbjct: 79 PAPAEEPPAPAPAAPPPARPPPPPPKSDAPPPPPARPPPPPPTAPP 124 Score = 33.5 bits (73), Expect = 6.1 Identities = 18/60 (30%), Positives = 18/60 (30%) Frame = -1 Query: 524 GGGXSXPXXGGGGXXXXXXXGGGGGXXXPXGGXXXXXKXXPPPPPPGGXXXTPXGGXPPP 345 G G P G GG P PPPPPP P G PPP Sbjct: 518 GAGVPPPPPPPGAGAPPPPPPPAGGAPPPPPPPPPKGGAPPPPPPPARAPPPPAGTPPPP 577 Score = 33.1 bits (72), Expect = 8.1 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PPPP PP P G PPPPPP PP Sbjct: 502 PPPPSAPGVPPAPPLPGAGVP-PPPPPPGAGAPPPPPPP 539 >UniRef50_A6APN4 Cluster: Insecticidal toxin, SepC/Tcc class; n=2; Vibrio harveyi|Rep: Insecticidal toxin, SepC/Tcc class - Vibrio harveyi HY01 Length = 378 Score = 52.4 bits (120), Expect = 1e-05 Identities = 20/35 (57%), Positives = 20/35 (57%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 PP PPPPP PPPP GGG PPPPP P Sbjct: 87 PPRMAPPPPPPPAGGMPPPPPPPMGGGAPPPPPGP 121 Score = 47.2 bits (107), Expect = 5e-04 Identities = 19/33 (57%), Positives = 20/33 (60%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPP 530 PP G PPPPP +PPPP G G PPPPP Sbjct: 97 PPAGGMPPPPPPPMGGGAPPPPP-GPGAPPPPP 128 Score = 46.8 bits (106), Expect = 6e-04 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = +3 Query: 453 PPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PPPP PPPP GG PPPPP P PP Sbjct: 82 PPPPPPPRMAPPPPPPPAGGMPPPPPPPMGGGAPPPPP 119 Score = 44.0 bits (99), Expect = 0.004 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPP 531 PP PPPPP PPPP G PPPPP Sbjct: 86 PPPRMAPPPPPPPAGGMPPPPPPPMGGGAPPPPP 119 Score = 41.1 bits (92), Expect = 0.030 Identities = 16/38 (42%), Positives = 17/38 (44%) Frame = +1 Query: 454 PPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PPPP + PPPP PPPPPP PP Sbjct: 82 PPPPPPPRMAPPPPPPPAGGMPPPPPPPMGGGAPPPPP 119 Score = 40.7 bits (91), Expect = 0.040 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPP 531 PP PPPPP PPPP G PPPPP Sbjct: 96 PPPAGGMPPPPPPPMGGGAPPPP-PGPGAPPPPP 128 Score = 33.1 bits (72), Expect = 8.1 Identities = 16/28 (57%), Positives = 16/28 (57%), Gaps = 3/28 (10%) Frame = -1 Query: 404 PPPPPP--GGXXXTPXG-GXPPPXXGXK 330 PPPPPP GG P G G PPP G K Sbjct: 104 PPPPPPMGGGAPPPPPGPGAPPPPPGAK 131 >UniRef50_Q9DEH3 Cluster: Diaphanous homologue; n=13; Eumetazoa|Rep: Diaphanous homologue - Gallus gallus (Chicken) Length = 1253 Score = 51.6 bits (118), Expect = 2e-05 Identities = 23/52 (44%), Positives = 23/52 (44%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 PP GG P G PPPPP PPPP GGG PPPP P Sbjct: 702 PPPLPGGAAAVLPPPPPLPGGTIPPPPPLFGGAVPPPPPLPGGGAGPPPPPP 753 Score = 51.2 bits (117), Expect = 3e-05 Identities = 20/39 (51%), Positives = 20/39 (51%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PPPPP PPPP GG PPPPP P A PP Sbjct: 714 PPPPPLPGGTIPPPPPLFGGAVPPPPPLPGGGAGPPPPP 752 Score = 41.9 bits (94), Expect = 0.017 Identities = 19/41 (46%), Positives = 19/41 (46%), Gaps = 2/41 (4%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGG--XPPPPPXPXXXAXXXXPP 566 PPP P PPPP GG PPPPP P A PP Sbjct: 625 PPPLPGGAAVIPPPPPLPGGAAVIPPPPPLPGGAAVIPPPP 665 Score = 41.9 bits (94), Expect = 0.017 Identities = 19/41 (46%), Positives = 19/41 (46%), Gaps = 2/41 (4%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGG--XPPPPPXPXXXAXXXXPP 566 PPP P PPPP GG PPPPP P A PP Sbjct: 638 PPPLPGGAAVIPPPPPLPGGAAVIPPPPPLPGGAAVIPPPP 678 Score = 41.9 bits (94), Expect = 0.017 Identities = 19/41 (46%), Positives = 19/41 (46%), Gaps = 2/41 (4%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGG--XPPPPPXPXXXAXXXXPP 566 PPP P PPPP GG PPPPP P A PP Sbjct: 651 PPPLPGGAAVIPPPPPLPGGAAVIPPPPPLPGGAAVIPPPP 691 Score = 41.5 bits (93), Expect = 0.023 Identities = 24/65 (36%), Positives = 24/65 (36%), Gaps = 3/65 (4%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXXPPPPPXXXXXXSPP-PPXXGGGX--PPPPPXPXXXAX 551 PP GG P PP PP PP PP GG PPPPP P A Sbjct: 575 PPPPLPGGAAIPPAPPLPGGAAIPPAPPLPGGTVVPPAPPLPGGAAVIPPPPPLPGGAAV 634 Query: 552 XXXPP 566 PP Sbjct: 635 IPPPP 639 Score = 41.5 bits (93), Expect = 0.023 Identities = 23/64 (35%), Positives = 24/64 (37%), Gaps = 2/64 (3%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXXPPPPPXXXXXXS--PPPPXXGGGXPPPPPXPXXXAXX 554 PP GG P PPPPP + PPPP GG PPPP A Sbjct: 677 PPPLPGGAAVIPPPPLLPGGTVIPPPPPLPGGAAAVLPPPPPLPGGTIPPPPPLFGGAVP 736 Query: 555 XXPP 566 PP Sbjct: 737 PPPP 740 Score = 40.7 bits (91), Expect = 0.040 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PPPPP PPPP G PPPPP L PP Sbjct: 714 PPPPPLPGGTIPPPPPLFGGAVPPPPP-LPGGGAGPPPP 751 Score = 39.5 bits (88), Expect = 0.093 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +2 Query: 452 PPPPXXXXKXXXPPPXXXGXXXPPPPXPXXXXXXXXPPP 568 PPPP PPP G PPPP P PPP Sbjct: 715 PPPPLPGGTIPPPPPLFGGAVPPPPPLPGGGAGPPPPPP 753 Score = 39.1 bits (87), Expect = 0.12 Identities = 18/40 (45%), Positives = 18/40 (45%), Gaps = 2/40 (5%) Frame = +3 Query: 453 PPPPXXXXXXSPPPPXXGGG--XPPPPPXPXXXAXXXXPP 566 PP P PPPP GG PPPPP P A PP Sbjct: 613 PPLPGGAAVIPPPPPLPGGAAVIPPPPPLPGGAAVIPPPP 652 Score = 39.1 bits (87), Expect = 0.12 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 2/47 (4%) Frame = +1 Query: 433 PXGXXXPPPPPXXX--KXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 P G PPPPP PPPP PPPPPL PP Sbjct: 694 PGGTVIPPPPPLPGGAAAVLPPPPPLPGGTIPPPPPLFGGAVPPPPP 740 Score = 38.3 bits (85), Expect = 0.21 Identities = 19/46 (41%), Positives = 19/46 (41%), Gaps = 1/46 (2%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGX-PPPPPXPXXXAXXXXPPXXXXXG 584 PPP P PPP GG PPPPP P A PP G Sbjct: 677 PPPLPGGAAVIPPPPLLPGGTVIPPPPPLPGGAAAVLPPPPPLPGG 722 Score = 37.9 bits (84), Expect = 0.28 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PPP P PPP G PPPPPL A PP Sbjct: 677 PPPLPGGAAVIPPPPLLPGGTVIPPPPPLPGGAAAVLPP 715 Score = 37.1 bits (82), Expect = 0.50 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 2/41 (4%) Frame = +3 Query: 450 PPPPPXXXXXXSPP-PPXXGG-GXPPPPPXPXXXAXXXXPP 566 PPPPP PP PP GG PP PP P PP Sbjct: 574 PPPPPLPGGAAIPPAPPLPGGAAIPPAPPLPGGTVVPPAPP 614 Score = 36.7 bits (81), Expect = 0.65 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PPP P PPPP G PPPPL PP Sbjct: 664 PPPLPGGAAVIPPPPPLPGGAAVIPPPPLLPGGTVIPPP 702 Score = 36.3 bits (80), Expect = 0.86 Identities = 17/40 (42%), Positives = 17/40 (42%), Gaps = 1/40 (2%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXP-PPPPPLXXXXXAXXPP 567 PPP P PPPP G PPPPPL PP Sbjct: 625 PPPLPGGAAVIPPPPPLPGGAAVIPPPPPLPGGAAVIPPP 664 Score = 36.3 bits (80), Expect = 0.86 Identities = 17/40 (42%), Positives = 17/40 (42%), Gaps = 1/40 (2%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXP-PPPPPLXXXXXAXXPP 567 PPP P PPPP G PPPPPL PP Sbjct: 638 PPPLPGGAAVIPPPPPLPGGAAVIPPPPPLPGGAAVIPPP 677 Score = 36.3 bits (80), Expect = 0.86 Identities = 17/40 (42%), Positives = 17/40 (42%), Gaps = 1/40 (2%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXP-PPPPPLXXXXXAXXPP 567 PPP P PPPP G PPPPPL PP Sbjct: 651 PPPLPGGAAVIPPPPPLPGGAAVIPPPPPLPGGAAVIPPP 690 Score = 36.3 bits (80), Expect = 0.86 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 2/41 (4%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGG--XPPPPPXPXXXAXXXXPP 566 PPP P PPPP GG PPPP P PP Sbjct: 664 PPPLPGGAAVIPPPPPLPGGAAVIPPPPLLPGGTVIPPPPP 704 Score = 35.9 bits (79), Expect = 1.1 Identities = 21/57 (36%), Positives = 21/57 (36%), Gaps = 5/57 (8%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXXPPPPPXXXXXX--SPPPPXXGGG---XPPPPPXP 536 PP GG P PPPP PPPP GG PPPPP P Sbjct: 664 PPPLPGGAAVIPPPPPLPGGAAVIPPPPLLPGGTVIPPPPPLPGGAAAVLPPPPPLP 720 Score = 35.5 bits (78), Expect = 1.5 Identities = 19/48 (39%), Positives = 19/48 (39%), Gaps = 3/48 (6%) Frame = +1 Query: 433 PXGXXXPPPPPXXX--KXXXPPPPXXGXXXP-PPPPPLXXXXXAXXPP 567 P G PP PP PPPP G PPPPPL PP Sbjct: 604 PGGTVVPPAPPLPGGAAVIPPPPPLPGGAAVIPPPPPLPGGAAVIPPP 651 Score = 34.7 bits (76), Expect = 2.6 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXP 564 P G PPPPP PPPP G PP P L A P Sbjct: 729 PLFGGAVPPPPPLPGGGAGPPPPPPG--GPPMAPSLGSYPFAPVP 771 Score = 34.7 bits (76), Expect = 2.6 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +3 Query: 441 GXXPPPPPXXXXXXSPPPPXXGGGXPPPPP 530 G PPPPP PPPP GG PP P Sbjct: 733 GAVPPPPPLPGGGAGPPPPPPGG--PPMAP 760 Score = 34.3 bits (75), Expect = 3.5 Identities = 19/50 (38%), Positives = 19/50 (38%), Gaps = 6/50 (12%) Frame = +3 Query: 435 PXGXXPPPPPXXXXXX---SPPPP---XXGGGXPPPPPXPXXXAXXXXPP 566 P G PP PP PPPP G PP PP P A PP Sbjct: 553 PGGTVPPSPPALSSGVVPLPPPPPPPLPGGAAIPPAPPLPGGAAIPPAPP 602 >UniRef50_P78621 Cluster: Cytokinesis protein sepA; n=14; Fungi/Metazoa group|Rep: Cytokinesis protein sepA - Emericella nidulans (Aspergillus nidulans) Length = 1790 Score = 51.6 bits (118), Expect = 2e-05 Identities = 28/62 (45%), Positives = 28/62 (45%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXX 560 PP GG GG PP G PPPP PPPP GG PPPPP P A Sbjct: 1060 PPPGGLGGPP-PPPPPPPPGGFGGPPPP-------PPPPGGFGGPPPPPPPPPGGAFGVP 1111 Query: 561 PP 566 PP Sbjct: 1112 PP 1113 Score = 46.4 bits (105), Expect = 8e-04 Identities = 22/51 (43%), Positives = 22/51 (43%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPPXXXXXG 584 P G PPPPP PPPP GG PPPPP P PP G Sbjct: 1045 PGAGAAPPPPPPPP----PPPPGGLGGPPPPPPPPPPGGFGGPPPPPPPPG 1091 Score = 43.6 bits (98), Expect = 0.006 Identities = 23/62 (37%), Positives = 23/62 (37%), Gaps = 8/62 (12%) Frame = +3 Query: 423 GXXPPXGXXPPPPPXXXXXXSPPPPXX--------GGGXPPPPPXPXXXAXXXXPPXXXX 578 G PP PPPPP PPPP GG PPPPP P PP Sbjct: 1031 GAAPPPPPPPPPPPPGAGAAPPPPPPPPPPPPGGLGGPPPPPPPPPPGGFGGPPPPPPPP 1090 Query: 579 XG 584 G Sbjct: 1091 GG 1092 Score = 43.2 bits (97), Expect = 0.008 Identities = 21/53 (39%), Positives = 21/53 (39%), Gaps = 2/53 (3%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGG--GXPPPPPXPXXXAXXXXPPXXXXXG 584 PP PPPP PPPP G G PPPPP P PP G Sbjct: 1053 PPPPPPPPPPGGLGGPPPPPPPPPPGGFGGPPPPPPPPGGFGGPPPPPPPPPG 1105 Score = 39.9 bits (89), Expect = 0.070 Identities = 19/48 (39%), Positives = 19/48 (39%), Gaps = 2/48 (4%) Frame = +1 Query: 430 PPXGXXXPPPPP--XXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPP PPPP G PPPPPP PP Sbjct: 1052 PPPPPPPPPPPGGLGGPPPPPPPPPPGGFGGPPPPPPPPGGFGGPPPP 1099 Score = 39.5 bits (88), Expect = 0.093 Identities = 17/32 (53%), Positives = 17/32 (53%) Frame = +1 Query: 439 GXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPP 534 G PPPPP PPPP G PPPPPP Sbjct: 1031 GAAPPPPPPPP-----PPPPGAGAAPPPPPPP 1057 Score = 39.1 bits (87), Expect = 0.12 Identities = 25/66 (37%), Positives = 25/66 (37%), Gaps = 4/66 (6%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXX--PPPPPXXXXXXSPPPPXXGGGX--PPPPPXPXXXA 548 PP G G PP G PPPPP PPPP GG PPPPP Sbjct: 1043 PPPGAGAAPPPPPPPPPPPPGGLGGPPPPPP------PPPPGGFGGPPPPPPPPGGFGGP 1096 Query: 549 XXXXPP 566 PP Sbjct: 1097 PPPPPP 1102 Score = 37.1 bits (82), Expect = 0.50 Identities = 18/45 (40%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPP +PPPP PPPPP P A PP Sbjct: 1016 PPPPPPPPPAHPGLSGAAPPPP-----PPPPPPPPGAGAAPPPPP 1055 Score = 36.3 bits (80), Expect = 0.86 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -1 Query: 440 PXGGXXXXXKXXPPPPPPGGXXXTPXGGXPPPXXG 336 P G PPPPPPGG P PPP G Sbjct: 1045 PGAGAAPPPPPPPPPPPPGGLGGPPPPPPPPPPGG 1079 Score = 34.7 bits (76), Expect = 2.6 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -3 Query: 354 PPPXXGXKXXXXXXPPXKKXPPPPPXGGXGXP 259 PPP PP PPPPP GG G P Sbjct: 1037 PPPPPPPPPGAGAAPPPPPPPPPPPPGGLGGP 1068 Score = 33.9 bits (74), Expect = 4.6 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -3 Query: 363 GGXPPPXXGXKXXXXXXPPXKKXPPPPPXGGXGXP 259 GG PPP PP PPPPP GG G P Sbjct: 1066 GGPPPPPPPPPPGGFGGPP----PPPPPPGGFGGP 1096 Score = 33.1 bits (72), Expect = 8.1 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -1 Query: 404 PPPPPPGGXXXTPXGGXPPP 345 PPPPPPGG P PPP Sbjct: 1085 PPPPPPGGFGGPPPPPPPPP 1104 >UniRef50_UPI0000E4896A Cluster: PREDICTED: similar to CG33556-PA; n=1; Strongylocentrotus purpuratus|Rep: PREDICTED: similar to CG33556-PA - Strongylocentrotus purpuratus Length = 1472 Score = 51.2 bits (117), Expect = 3e-05 Identities = 26/69 (37%), Positives = 26/69 (37%), Gaps = 1/69 (1%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXXPPPPPXXXXXXS-PPPPXXGGGXPPPPPXPXXXAXXX 557 PP GG P G PPPPP PPPP GG PPPPP P Sbjct: 443 PPPPLPGGSCIPPPPPPPGMGGAPPPPPPPPFPGGVPPPPPLPGGAPPPPPPPPFPGGGV 502 Query: 558 XPPXXXXXG 584 PP G Sbjct: 503 PPPPFPGGG 511 Score = 49.6 bits (113), Expect = 9e-05 Identities = 24/50 (48%), Positives = 24/50 (48%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPP 530 PP GG G PP PPPPP PPPP GGG PPPPP Sbjct: 472 PPFPGGVPPPPPLPGGAPP----PPPPPPFPGGGVPPPPFPGGGPPPPPP 517 Score = 49.2 bits (112), Expect = 1e-04 Identities = 22/49 (44%), Positives = 22/49 (44%), Gaps = 1/49 (2%) Frame = +3 Query: 423 GXXPPXGXXPPPP-PXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 G PP PPPP P PPPP GG PPPPP P PP Sbjct: 434 GAPPPPPPPPPPPLPGGSCIPPPPPPPGMGGAPPPPPPPPFPGGVPPPP 482 Score = 44.8 bits (101), Expect = 0.002 Identities = 21/52 (40%), Positives = 21/52 (40%), Gaps = 4/52 (7%) Frame = +3 Query: 423 GXXPPXGXXPPPPP----XXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 G P PPPPP PPPP GG PPPPP P PP Sbjct: 432 GVGAPPPPPPPPPPPLPGGSCIPPPPPPPGMGGAPPPPPPPPFPGGVPPPPP 483 Score = 44.4 bits (100), Expect = 0.003 Identities = 17/33 (51%), Positives = 17/33 (51%) Frame = +1 Query: 433 PXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPP 531 P G PPPPP PPPP G PPPPP Sbjct: 485 PGGAPPPPPPPPFPGGGVPPPPFPGGGPPPPPP 517 Score = 43.2 bits (97), Expect = 0.008 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP GG PPPP P PP Sbjct: 430 PPGVGAPPPPPPP-----PPPPLPGGSCIPPPPPPPGMGGAPPPP 469 Score = 41.1 bits (92), Expect = 0.030 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = +1 Query: 433 PXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 P G PPPPP PPPP G PPPPP A PP Sbjct: 430 PPGVGAPPPPPPP-----PPPPLPGGSCIPPPPPPPGMGGAPPPP 469 Score = 39.1 bits (87), Expect = 0.12 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PPPPP PPPP PPPPPPL PP Sbjct: 424 PPPPPLPPGVGAPPPPP-----PPPPPPLPGGSCIPPPP 457 Score = 38.3 bits (85), Expect = 0.21 Identities = 17/39 (43%), Positives = 18/39 (46%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PPPPP +PPPP PPPPP P PP Sbjct: 424 PPPPPLPPGVGAPPPP------PPPPPPPLPGGSCIPPP 456 Score = 38.3 bits (85), Expect = 0.21 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPPP PPPP PPPP PP Sbjct: 472 PPFPGGVPPPPPLPGGAPPPPPPPPFPGGGVPPPPFPGGGPPPPPP 517 Score = 35.5 bits (78), Expect = 1.5 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = +3 Query: 435 PXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 P PPPPP P PP G PPPPP P Sbjct: 416 PAAAPPPPPPPP-----PLPPGVGAPPPPPPPPP 444 Score = 34.3 bits (75), Expect = 3.5 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPP 534 PPPPP P PP G PPPPPP Sbjct: 421 PPPPPP-----PPLPPGVGAPPPPPPPP 443 Score = 33.1 bits (72), Expect = 8.1 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 2/35 (5%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXP--PPPP 530 P G PPPP PPPP G G P P PP Sbjct: 496 PFPGGGVPPPPFPGGGPPPPPPIGGMGVPRLPGPP 530 >UniRef50_Q54H12 Cluster: Actin-binding protein; n=2; Dictyostelium discoideum|Rep: Actin-binding protein - Dictyostelium discoideum AX4 Length = 1220 Score = 50.4 bits (115), Expect = 5e-05 Identities = 22/47 (46%), Positives = 22/47 (46%), Gaps = 2/47 (4%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXX--GGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP GGG PPPPP P PP Sbjct: 578 PPAPPAPPPPPMMGGGPPPPPPPPMMGGGGPPPPPPPPMMGGGPPPP 624 Score = 45.6 bits (103), Expect = 0.001 Identities = 24/50 (48%), Positives = 24/50 (48%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPP 530 PP GGGG PP PPPPP PPPP G G PPPPP Sbjct: 600 PPMMGGGGP--------PP----PPPPPMMGGGPPPPPPMGGKGGPPPPP 637 Score = 44.4 bits (100), Expect = 0.003 Identities = 20/48 (41%), Positives = 20/48 (41%), Gaps = 2/48 (4%) Frame = +1 Query: 430 PPXGXXXPPPPP--XXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPPP PPPP G PPPPPP PP Sbjct: 577 PPPAPPAPPPPPMMGGGPPPPPPPPMMGGGGPPPPPPPPMMGGGPPPP 624 Score = 41.9 bits (94), Expect = 0.017 Identities = 18/34 (52%), Positives = 18/34 (52%), Gaps = 4/34 (11%) Frame = +3 Query: 441 GXXPPPPPXXXXXXSPPPPXX----GGGXPPPPP 530 G PPPPP PPPP GGG PPPPP Sbjct: 593 GPPPPPPPPMMGGGGPPPPPPPPMMGGGPPPPPP 626 Score = 41.9 bits (94), Expect = 0.017 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = +1 Query: 439 GXXXPPPPPXXXKXXXPPPPXXGXXXPPPPP 531 G PPPPP PPPP G PPPPP Sbjct: 607 GPPPPPPPPMMGGGPPPPPPMGGKGGPPPPP 637 Score = 41.1 bits (92), Expect = 0.030 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = +1 Query: 439 GXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPP 534 G PPPPP PPPP G PPPPP Sbjct: 606 GGPPPPPPPPMMGGGPPPPPPMGGKGGPPPPP 637 Score = 38.7 bits (86), Expect = 0.16 Identities = 18/46 (39%), Positives = 19/46 (41%), Gaps = 3/46 (6%) Frame = +1 Query: 439 GXXXPPPPPXXXKXXXPPPPXXG---XXXPPPPPPLXXXXXAXXPP 567 G PPPPP PPPP PPPPPP+ PP Sbjct: 592 GGPPPPPPPPMMGGGGPPPPPPPPMMGGGPPPPPPMGGKGGPPPPP 637 Score = 36.3 bits (80), Expect = 0.86 Identities = 20/51 (39%), Positives = 20/51 (39%), Gaps = 1/51 (1%) Frame = +3 Query: 435 PXGXXPPPPPXXXXXXSPPPPXXGGGX-PPPPPXPXXXAXXXXPPXXXXXG 584 P PPP P PPPP GGG PPPPP PP G Sbjct: 572 PIVTTPPPAPPAP----PPPPMMGGGPPPPPPPPMMGGGGPPPPPPPPMMG 618 Score = 35.1 bits (77), Expect = 2.0 Identities = 21/57 (36%), Positives = 21/57 (36%) Frame = -1 Query: 506 PXXGGGGXXXXXXXGGGGGXXXPXGGXXXXXKXXPPPPPPGGXXXTPXGGXPPPXXG 336 P GGG GGG P PPPPP GG GG PPP G Sbjct: 588 PMMGGGPPPPPPPPMMGGGGPPPPPPPPMMGGGPPPPPPMGG-----KGGPPPPPGG 639 >UniRef50_A2DLA9 Cluster: Putative uncharacterized protein; n=1; Trichomonas vaginalis G3|Rep: Putative uncharacterized protein - Trichomonas vaginalis G3 Length = 461 Score = 50.4 bits (115), Expect = 5e-05 Identities = 26/60 (43%), Positives = 26/60 (43%), Gaps = 4/60 (6%) Frame = +3 Query: 399 GGXXFXXXGXXPPXGXXPPPPPXXXXXXSPPPPXXG----GGXPPPPPXPXXXAXXXXPP 566 GG F G PP G PPPPP PPPP G G PPPPP P A P Sbjct: 265 GGSGFTAGGA-PPDGSAPPPPPSDGSLPPPPPPPPGAPGGGAPPPPPPPPPAAAGGAGVP 323 Score = 43.2 bits (97), Expect = 0.008 Identities = 21/50 (42%), Positives = 21/50 (42%), Gaps = 4/50 (8%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXX----GXXXPPPPPPLXXXXXAXXPP 567 PP G PPPP PPPP G PPPPPP A PP Sbjct: 275 PPDGSAPPPPPSDGSLPPPPPPPPGAPGGGAPPPPPPPPPAAAGGAGVPP 324 Score = 39.9 bits (89), Expect = 0.070 Identities = 20/39 (51%), Positives = 20/39 (51%), Gaps = 1/39 (2%) Frame = +3 Query: 435 PXGXXPPPPPXXXXXXSPPPPXXGG-GXPPPPPXPXXXA 548 P G PPPPP PPP GG G PPPPP P A Sbjct: 301 PGGGAPPPPPP------PPPAAAGGAGVPPPPPPPPPPA 333 Score = 35.1 bits (77), Expect = 2.0 Identities = 28/77 (36%), Positives = 28/77 (36%), Gaps = 4/77 (5%) Frame = +1 Query: 349 GGXPPXGVXSXXXXXXXXXXFXXXXXXPPX--GXXXPPPPPXXXKXXXPPPPXX--GXXX 516 GG PP G S PP G PPPPP PPPP G Sbjct: 272 GGAPPDG--SAPPPPPSDGSLPPPPPPPPGAPGGGAPPPPP-------PPPPAAAGGAGV 322 Query: 517 PPPPPPLXXXXXAXXPP 567 PPPPPP A PP Sbjct: 323 PPPPPP--PPPPANLPP 337 Score = 35.1 bits (77), Expect = 2.0 Identities = 22/52 (42%), Positives = 22/52 (42%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 PP G GG G PP PPPPP PPP PPPPP P Sbjct: 296 PPPGAPGG------GAPPPP---PPPPPAAAGGAGVPPP------PPPPPPP 332 >UniRef50_O00401 Cluster: Neural Wiskott-Aldrich syndrome protein; n=39; Eukaryota|Rep: Neural Wiskott-Aldrich syndrome protein - Homo sapiens (Human) Length = 505 Score = 50.4 bits (115), Expect = 5e-05 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 P G PPPPP PPPP G G PPPPP A PP Sbjct: 282 PSRGGPPPPPPPPHNSGPPPPPARGRGAPPPPPSRAPTAAPPPPP 326 Score = 46.0 bits (104), Expect = 0.001 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPPP PPPP G PPPPP PP Sbjct: 281 PPSRGGPPPPPPPPHNSGPPPPPARGRGAPPPPPSRAPTAAPPPPP 326 Score = 46.0 bits (104), Expect = 0.001 Identities = 19/46 (41%), Positives = 20/46 (43%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPPP + PPPP PPPPP A PP Sbjct: 292 PPPHNSGPPPPPARGRGAPPPPPSRAPTAAPPPPPPSRPSVAVPPP 337 Score = 45.2 bits (102), Expect = 0.002 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPPP PPPP PPPPP A PP Sbjct: 280 PPPSRGGPPPPPPPPHNSGPPPPPARGRGAPPPPPSRAPTAAPPPP 325 Score = 41.9 bits (94), Expect = 0.017 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 2/47 (4%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXG--GGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP A PP Sbjct: 293 PPHNSGPPPPPARGRGAPPPPPSRAPTAAPPPPPPSRPSVAVPPPPP 339 Score = 39.5 bits (88), Expect = 0.093 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = +3 Query: 435 PXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPPXXXXXG 584 P PPPPP PPPP PPPP P PP G Sbjct: 318 PTAAPPPPPPSRPSVAVPPPPPNRMYPPPPPALPSSAPSGPPPPPPSVLG 367 Score = 39.1 bits (87), Expect = 0.12 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXP 563 PPPPP PPPP PPPPP A P Sbjct: 277 PPPPPPSRGGPPPPPPPPHNSGPPPPPARGRGAPPPPP 314 Score = 37.5 bits (83), Expect = 0.37 Identities = 15/38 (39%), Positives = 16/38 (42%) Frame = +1 Query: 454 PPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PPPP + PPPP PPPPP PP Sbjct: 277 PPPPPPSRGGPPPPPPPPHNSGPPPPPARGRGAPPPPP 314 Score = 36.3 bits (80), Expect = 0.86 Identities = 21/58 (36%), Positives = 21/58 (36%), Gaps = 7/58 (12%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXX--SPPPPXX-----GGGXPPPPPXPXXXAXXXXPPXXXXXG 584 PP PPPPP PPPP G PPPPP P PP G Sbjct: 338 PPNRMYPPPPPALPSSAPSGPPPPPPSVLGVGPVAPPPPPPPPPPPGPPPPPGLPSDG 395 Score = 35.9 bits (79), Expect = 1.1 Identities = 13/28 (46%), Positives = 15/28 (53%) Frame = +3 Query: 483 SPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 +PPPP G PPPPP P + PP Sbjct: 276 APPPPPPSRGGPPPPPPPPHNSGPPPPP 303 Score = 35.9 bits (79), Expect = 1.1 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 3/37 (8%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPP---XXGXXXPPPPP 531 P G PPPPP PPPP PPPPP Sbjct: 303 PARGRGAPPPPPSRAPTAAPPPPPPSRPSVAVPPPPP 339 Score = 35.1 bits (77), Expect = 2.0 Identities = 16/40 (40%), Positives = 16/40 (40%), Gaps = 2/40 (5%) Frame = +1 Query: 454 PPPPXXXKXXXPPP--PXXGXXXPPPPPPLXXXXXAXXPP 567 PPPP PPP P PPPPPP PP Sbjct: 335 PPPPPNRMYPPPPPALPSSAPSGPPPPPPSVLGVGPVAPP 374 Score = 34.7 bits (76), Expect = 2.6 Identities = 17/46 (36%), Positives = 17/46 (36%), Gaps = 2/46 (4%) Frame = +3 Query: 435 PXGXXPPPPPXXXXXXSPP--PPXXGGGXPPPPPXPXXXAXXXXPP 566 P PPPPP PP P G PPPPP PP Sbjct: 330 PSVAVPPPPPNRMYPPPPPALPSSAPSGPPPPPPSVLGVGPVAPPP 375 Score = 33.5 bits (73), Expect = 6.1 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +1 Query: 433 PXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPP 534 P G PPP PPPP P PPPP Sbjct: 355 PSGPPPPPPSVLGVGPVAPPPPPPPPPPPGPPPP 388 >UniRef50_Q7JP75 Cluster: Cytokinesis defect protein 1, isoform b; n=6; cellular organisms|Rep: Cytokinesis defect protein 1, isoform b - Caenorhabditis elegans Length = 1437 Score = 50.0 bits (114), Expect = 7e-05 Identities = 27/72 (37%), Positives = 27/72 (37%), Gaps = 4/72 (5%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXXPPPPPXXXXXX----SPPPPXXGGGXPPPPPXPXXXA 548 PP GG G P G PPPPP PPPP GG PPPPP P Sbjct: 720 PPITGGPPPPPPPGGLPPITGGPPPPPPPGGLPPISGGPPPPPPPPGGCPPPPPPPPPGG 779 Query: 549 XXXXPPXXXXXG 584 PP G Sbjct: 780 FKGGPPPPPPPG 791 Score = 48.0 bits (109), Expect = 3e-04 Identities = 25/59 (42%), Positives = 25/59 (42%), Gaps = 3/59 (5%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXXPPPPPXXXXXXSPPPPXXGG---GXPPPPPXPXXXA 548 PP GG G P G PPPPP PPPP G G PPPPP P A Sbjct: 736 PPITGGPPPPPPPGGLPPISGGPPPPPPPPGGCPPPPPPPPPGGFKGGPPPPPPPGMFA 794 Score = 41.9 bits (94), Expect = 0.017 Identities = 23/57 (40%), Positives = 23/57 (40%), Gaps = 9/57 (15%) Frame = +3 Query: 423 GXXPPXGXXPPPPP----XXXXXXSPPPPXXGG-----GXPPPPPXPXXXAXXXXPP 566 G P G PPPPP PPPP GG G PPPPP P PP Sbjct: 718 GLPPITGGPPPPPPPGGLPPITGGPPPPPPPGGLPPISGGPPPPPPPPGGCPPPPPP 774 Score = 40.3 bits (90), Expect = 0.053 Identities = 20/42 (47%), Positives = 20/42 (47%), Gaps = 7/42 (16%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXS--PPPPXXGG-----GXPPPPPXP 536 PP PPPPP PPPP GG G PPPPP P Sbjct: 707 PPITGGPPPPPGLPPITGGPPPPPPPGGLPPITGGPPPPPPP 748 Score = 39.5 bits (88), Expect = 0.093 Identities = 22/62 (35%), Positives = 23/62 (37%), Gaps = 2/62 (3%) Frame = -1 Query: 524 GGGXSXPXXGGGGXXXXXXXG--GGGGXXXPXGGXXXXXKXXPPPPPPGGXXXTPXGGXP 351 GG + P GG GG P GG PPPPPPGG G P Sbjct: 701 GGSSALPPITGGPPPPPGLPPITGGPPPPPPPGGLPPITGGPPPPPPPGGLPPISGGPPP 760 Query: 350 PP 345 PP Sbjct: 761 PP 762 Score = 37.5 bits (83), Expect = 0.37 Identities = 21/59 (35%), Positives = 21/59 (35%) Frame = -1 Query: 512 SXPXXGGGGXXXXXXXGGGGGXXXPXGGXXXXXKXXPPPPPPGGXXXTPXGGXPPPXXG 336 S P GG GG P G PPPPPPGG G PPP G Sbjct: 694 SAPSTSAGGSSALPPITGG---PPPPPGLPPITGGPPPPPPPGGLPPITGGPPPPPPPG 749 Score = 36.7 bits (81), Expect = 0.65 Identities = 20/52 (38%), Positives = 20/52 (38%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 PP GG G PP PPPPP PPPP G P P P Sbjct: 752 PPISGGPPPPPPPPGGCPPP--PPPPPPGGFKGGPPPPPPPGMFAPMAPVIP 801 Score = 35.5 bits (78), Expect = 1.5 Identities = 23/64 (35%), Positives = 23/64 (35%) Frame = -1 Query: 521 GGXSXPXXGGGGXXXXXXXGGGGGXXXPXGGXXXXXKXXPPPPPPGGXXXTPXGGXPPPX 342 GG P GG GG P GG PPPPPP G P PPP Sbjct: 724 GGPPPPPPPGG----LPPITGGPPPPPPPGGLPPISGGPPPPPPPPGGCPPPP--PPPPP 777 Query: 341 XGXK 330 G K Sbjct: 778 GGFK 781 Score = 35.1 bits (77), Expect = 2.0 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 2/35 (5%) Frame = +1 Query: 430 PPXGXXXPPPPPXXX--KXXXPPPPXXGXXXPPPP 528 PP G PPPPP K PPPP G P P Sbjct: 764 PPGGCPPPPPPPPPGGFKGGPPPPPPPGMFAPMAP 798 >UniRef50_UPI0000E482F8 Cluster: PREDICTED: similar to dishevelled associated activator of morphogenesis 1 like; n=3; Strongylocentrotus purpuratus|Rep: PREDICTED: similar to dishevelled associated activator of morphogenesis 1 like - Strongylocentrotus purpuratus Length = 801 Score = 49.6 bits (113), Expect = 9e-05 Identities = 22/49 (44%), Positives = 22/49 (44%), Gaps = 1/49 (2%) Frame = +3 Query: 423 GXXPPXGXXPPPPPXXXXXXSPPPPXXG-GGXPPPPPXPXXXAXXXXPP 566 G G PPPPP PPPP G GG PPPPP P PP Sbjct: 248 GVPAAPGAPPPPPPMMGGAPPPPPPPPGPGGAPPPPPPPGMFGGGGPPP 296 Score = 42.3 bits (95), Expect = 0.013 Identities = 18/34 (52%), Positives = 19/34 (55%), Gaps = 4/34 (11%) Frame = +3 Query: 441 GXXPPPPPXXXXXXSPPPPXX----GGGXPPPPP 530 G PPPPP +PPPP GGG PPPPP Sbjct: 265 GAPPPPPPPPGPGGAPPPPPPPGMFGGGGPPPPP 298 Score = 41.9 bits (94), Expect = 0.017 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PPPPP PPPP G PPPPP PP Sbjct: 257 PPPPPMMGGAPPPPPPPPGPGGAPPPPPPPGMFGGGGPP 295 Score = 40.3 bits (90), Expect = 0.053 Identities = 19/48 (39%), Positives = 19/48 (39%), Gaps = 3/48 (6%) Frame = +1 Query: 433 PXGXXXPPPPPXXX---KXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 P PPPPP PPPP G PPPPPP PP Sbjct: 250 PAAPGAPPPPPPMMGGAPPPPPPPPGPGGAPPPPPPPGMFGGGGPPPP 297 Score = 38.7 bits (86), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +3 Query: 486 PPPPXXGGGXPPPPPXPXXXAXXXXPPXXXXXG 584 PPPP GG PPPPP P PP G Sbjct: 258 PPPPMMGGAPPPPPPPPGPGGAPPPPPPPGMFG 290 >UniRef50_Q4S986 Cluster: Chromosome 3 SCAF14700, whole genome shotgun sequence; n=1; Tetraodon nigroviridis|Rep: Chromosome 3 SCAF14700, whole genome shotgun sequence - Tetraodon nigroviridis (Green puffer) Length = 1204 Score = 49.6 bits (113), Expect = 9e-05 Identities = 23/54 (42%), Positives = 23/54 (42%) Frame = +3 Query: 423 GXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPPXXXXXG 584 G PP PPPP PPPP G G PPPPP P A PP G Sbjct: 624 GAPPPP--PPPPPSAAGLPPPPPPPLPGAGPPPPPPPPLPGAGPPPPPPPPLSG 675 Score = 48.4 bits (110), Expect = 2e-04 Identities = 23/58 (39%), Positives = 24/58 (41%), Gaps = 4/58 (6%) Frame = +3 Query: 423 GXXPPXGXXPPPPPXXXXXXSPPPPXX----GGGXPPPPPXPXXXAXXXXPPXXXXXG 584 G PP PPPPP +PPPP G PPPPP P A PP G Sbjct: 605 GGVPPPPPPPPPPPALGAMGAPPPPPPPPPSAAGLPPPPPPPLPGAGPPPPPPPPLPG 662 Score = 48.0 bits (109), Expect = 3e-04 Identities = 22/48 (45%), Positives = 22/48 (45%) Frame = +3 Query: 423 GXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 G PP PPP P PPPP G G PPPPP P A PP Sbjct: 638 GLPPPP---PPPLPGAGPPPPPPPPLPGAGPPPPPPPPLSGAGPPPPP 682 Score = 45.2 bits (102), Expect = 0.002 Identities = 22/55 (40%), Positives = 22/55 (40%), Gaps = 3/55 (5%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXXPPPPPXXXXXXSPPPPXX---GGGXPPPPPXP 536 PP G P G PPPPP PPPP G G PPPPP P Sbjct: 631 PPPPSAAGLPPPPPPPLPGAGPPPPPPPPLPGAGPPPPPPPPLSGAGPPPPPPMP 685 Score = 44.4 bits (100), Expect = 0.003 Identities = 23/53 (43%), Positives = 23/53 (43%), Gaps = 2/53 (3%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXG--GGXPPPPPXPXXXAXXXXPPXXXXXG 584 P G PPPPP PPPP G G PPPPP P A PP G Sbjct: 602 PALGGVPPPPPPP-----PPPPALGAMGAPPPPPPPPPSAAGLPPPPPPPLPG 649 Score = 41.9 bits (94), Expect = 0.017 Identities = 18/45 (40%), Positives = 19/45 (42%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPPXXXXXG 584 PPPPP PPPP G PPPP P + PP G Sbjct: 642 PPPPPLPGAGPPPPPPPPLPGAGPPPPPPPPLSGAGPPPPPPMPG 686 Score = 41.1 bits (92), Expect = 0.030 Identities = 19/45 (42%), Positives = 19/45 (42%), Gaps = 2/45 (4%) Frame = +1 Query: 439 GXXXPPPP--PXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 G PPPP P PPPP G PPPPPP PP Sbjct: 638 GLPPPPPPPLPGAGPPPPPPPPLPGAGPPPPPPPPLSGAGPPPPP 682 Score = 40.3 bits (90), Expect = 0.053 Identities = 16/34 (47%), Positives = 17/34 (50%) Frame = +3 Query: 435 PXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 P G P P +PPPP GG PPPPP P Sbjct: 581 PGGNLSPAPASDVCDSAPPPPPALGGVPPPPPPP 614 Score = 37.1 bits (82), Expect = 0.50 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXA 548 P P P PPPP GG PPPPP P A Sbjct: 581 PGGNLSPAPASDVCDSAPPPPPALGGVPPPPPPPPPPPA 619 Score = 34.3 bits (75), Expect = 3.5 Identities = 17/40 (42%), Positives = 17/40 (42%), Gaps = 4/40 (10%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXX----GXXXPPPPPPL 537 P G PPPPP PPPP G PPP P L Sbjct: 648 PGAGPPPPPPPPLPGAGPPPPPPPPLSGAGPPPPPPMPGL 687 >UniRef50_Q9FLQ7 Cluster: Gb|AAD23008.1; n=1; Arabidopsis thaliana|Rep: Gb|AAD23008.1 - Arabidopsis thaliana (Mouse-ear cress) Length = 1289 Score = 49.6 bits (113), Expect = 9e-05 Identities = 23/54 (42%), Positives = 23/54 (42%) Frame = +3 Query: 423 GXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPPXXXXXG 584 G PP PPPPP PPPP GG PPPPP P PP G Sbjct: 1059 GGAPP----PPPPPMFGGAQPPPPPPMRGGAPPPPPPPMRGGAPPPPPPPMRGG 1108 Score = 49.6 bits (113), Expect = 9e-05 Identities = 23/54 (42%), Positives = 23/54 (42%) Frame = +3 Query: 423 GXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPPXXXXXG 584 G PP PPPPP PPPP GG PPPPP P PP G Sbjct: 1083 GGAPP----PPPPPMRGGAPPPPPPPMRGGAPPPPPPPMHGGAPPPPPPPMRGG 1132 Score = 49.6 bits (113), Expect = 9e-05 Identities = 23/54 (42%), Positives = 23/54 (42%) Frame = +3 Query: 423 GXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPPXXXXXG 584 G PP PPPPP PPPP GG PPPPP P PP G Sbjct: 1095 GGAPP----PPPPPMRGGAPPPPPPPMHGGAPPPPPPPMRGGAPPPPPPPGGRG 1144 Score = 49.6 bits (113), Expect = 9e-05 Identities = 23/54 (42%), Positives = 23/54 (42%) Frame = +3 Query: 423 GXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPPXXXXXG 584 G PP PPPPP PPPP GG PPPPP P PP G Sbjct: 1107 GGAPP----PPPPPMHGGAPPPPPPPMRGGAPPPPPPPGGRGPGAPPPPPPPGG 1156 Score = 49.2 bits (112), Expect = 1e-04 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPPXXXXXG 584 PPPPP PPPP GG PPPPP P PP G Sbjct: 1076 PPPPPMRGGAPPPPPPPMRGGAPPPPPPPMRGGAPPPPPPPMHGG 1120 Score = 48.4 bits (110), Expect = 2e-04 Identities = 22/48 (45%), Positives = 22/48 (45%) Frame = +3 Query: 423 GXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 G PP PPPPP PPPP G G PPPPP P PP Sbjct: 954 GSPPPP---PPPPPSYGSPPPPPPPPPGYGSPPPPPPPPPSYGSPPPP 998 Score = 48.4 bits (110), Expect = 2e-04 Identities = 26/67 (38%), Positives = 26/67 (38%), Gaps = 5/67 (7%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXXPPPPPXXXXXXS-----PPPPXXGGGXPPPPPXPXXX 545 PP G G P G PPPPP S PPPP GG PPPPP P Sbjct: 973 PPPPPGYGSPPPPPPPPPSYGSPPPPPPPPFSHVSSIPPPPPPPPMHGGAPPPPPPPPMH 1032 Query: 546 AXXXXPP 566 PP Sbjct: 1033 GGAPPPP 1039 Score = 46.8 bits (106), Expect = 6e-04 Identities = 22/54 (40%), Positives = 22/54 (40%) Frame = +3 Query: 423 GXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPPXXXXXG 584 G PP PPPP PPPP GG PPPPP P PP G Sbjct: 1020 GGAPPP--PPPPPMHGGAPPPPPPPPMHGGAPPPPPPPPMHGGAPPPPPPPMFG 1071 Score = 46.8 bits (106), Expect = 6e-04 Identities = 22/54 (40%), Positives = 22/54 (40%) Frame = +3 Query: 423 GXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPPXXXXXG 584 G PP PPPP PPPP GG PPPPP P PP G Sbjct: 1033 GGAPPP--PPPPPMHGGAPPPPPPPPMHGGAPPPPPPPMFGGAQPPPPPPMRGG 1084 Score = 46.4 bits (105), Expect = 8e-04 Identities = 18/39 (46%), Positives = 19/39 (48%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PPPPP PPPP G PPPPPP + PP Sbjct: 960 PPPPPSYGSPPPPPPPPPGYGSPPPPPPPPPSYGSPPPP 998 Score = 46.4 bits (105), Expect = 8e-04 Identities = 21/46 (45%), Positives = 21/46 (45%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP G PPPPP PPPP G PPPPPP PP Sbjct: 975 PPPGYGSPPPPP-------PPPPSYGSPPPPPPPPFSHVSSIPPPP 1013 Score = 46.4 bits (105), Expect = 8e-04 Identities = 22/54 (40%), Positives = 22/54 (40%) Frame = +3 Query: 423 GXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPPXXXXXG 584 G PP PPPPP PPPP GG PPPP P PP G Sbjct: 1046 GGAPPP---PPPPPMHGGAPPPPPPPMFGGAQPPPPPPMRGGAPPPPPPPMRGG 1096 Score = 46.0 bits (104), Expect = 0.001 Identities = 21/48 (43%), Positives = 21/48 (43%) Frame = +3 Query: 423 GXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 G PP PPPPP PPPP G PPPPP P PP Sbjct: 941 GSPPPP---PPPPPSYGSPPPPPPPPPSYGSPPPPPPPPPGYGSPPPP 985 Score = 46.0 bits (104), Expect = 0.001 Identities = 21/48 (43%), Positives = 21/48 (43%) Frame = +3 Query: 423 GXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 G PP PPPPP PPPP G PPPPP P PP Sbjct: 967 GSPPPP---PPPPPGYGSPPPPPPPPPSYGSPPPPPPPPFSHVSSIPP 1011 Score = 46.0 bits (104), Expect = 0.001 Identities = 22/56 (39%), Positives = 22/56 (39%), Gaps = 5/56 (8%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXS-----PPPPXXGGGXPPPPPXPXXXAXXXXPPXXXXXG 584 P G PPPPP PPPP GG PPPPP P PP G Sbjct: 1017 PMHGGAPPPPPPPPMHGGAPPPPPPPPMHGGAPPPPPPPPMHGGAPPPPPPPMFGG 1072 Score = 45.6 bits (103), Expect = 0.001 Identities = 20/49 (40%), Positives = 22/49 (44%), Gaps = 3/49 (6%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXK---XXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPPP + PPPP G PPPPPP+ PP Sbjct: 1079 PPMRGGAPPPPPPPMRGGAPPPPPPPMRGGAPPPPPPPMHGGAPPPPPP 1127 Score = 45.6 bits (103), Expect = 0.001 Identities = 23/50 (46%), Positives = 23/50 (46%), Gaps = 2/50 (4%) Frame = +3 Query: 423 GXXPPXGXXPPPPPXXXXXXSPPPP--XXGGGXPPPPPXPXXXAXXXXPP 566 G PP PPPPP PPPP G G PPPPP P A PP Sbjct: 1119 GGAPP----PPPPPMRGGAPPPPPPPGGRGPGAPPPPPPPGGRAPGPPPP 1164 Score = 45.6 bits (103), Expect = 0.001 Identities = 22/52 (42%), Positives = 22/52 (42%), Gaps = 2/52 (3%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXXPPPPPXXXXXXSPPP--PXXGGGXPPPPP 530 PP GG G P PPPPP PPP P GG PPPPP Sbjct: 1127 PPMRGGAPPPPPPPGGRGPGAPPPPPPPGGRAPGPPPPPGPRPPGGGPPPPP 1178 Score = 45.2 bits (102), Expect = 0.002 Identities = 22/56 (39%), Positives = 23/56 (41%), Gaps = 5/56 (8%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXX-----SPPPPXXGGGXPPPPPXPXXXAXXXXPPXXXXXG 584 PP PPPPP SPPPP G PPPPP P + PP G Sbjct: 912 PPVKTAPPPPPPPPFSNAHSVLSPPPPSYGSPPPPPPPPPSYGSPPPPPPPPPSYG 967 Score = 45.2 bits (102), Expect = 0.002 Identities = 22/56 (39%), Positives = 23/56 (41%), Gaps = 5/56 (8%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXX-----GGGXPPPPPXPXXXAXXXXPPXXXXXG 584 P G PPPPP SPPPP G PPPPP P + PP G Sbjct: 938 PSYGSPPPPPPPPPSYGSPPPPPPPPPSYGSPPPPPPPPPGYGSPPPPPPPPPSYG 993 Score = 45.2 bits (102), Expect = 0.002 Identities = 21/49 (42%), Positives = 21/49 (42%), Gaps = 4/49 (8%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXG----GGXPPPPPXPXXXAXXXXPP 566 P G PPPPP SPPPP G PPPPP P PP Sbjct: 964 PSYGSPPPPPPPPPGYGSPPPPPPPPPSYGSPPPPPPPPFSHVSSIPPP 1012 Score = 45.2 bits (102), Expect = 0.002 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PPPP PPPP GG PPPPP P PP Sbjct: 1014 PPPPMHGGAPPPPPPPPMHGGAPPPPPPPPMHGGAPPPP 1052 Score = 44.8 bits (101), Expect = 0.002 Identities = 21/50 (42%), Positives = 22/50 (44%), Gaps = 5/50 (10%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXX-----GGGXPPPPPXPXXXAXXXXPP 566 P G PPPPP SPPPP G PPPPP P + PP Sbjct: 951 PSYGSPPPPPPPPPSYGSPPPPPPPPPGYGSPPPPPPPPPSYGSPPPPPP 1000 Score = 44.8 bits (101), Expect = 0.002 Identities = 20/47 (42%), Positives = 20/47 (42%), Gaps = 2/47 (4%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXX--GGGXPPPPPXPXXXAXXXXPPXXXXXG 584 PPPPP PPPP GG PPPPP P PP G Sbjct: 1013 PPPPPMHGGAPPPPPPPPMHGGAPPPPPPPPMHGGAPPPPPPPPMHG 1059 Score = 44.8 bits (101), Expect = 0.002 Identities = 20/48 (41%), Positives = 21/48 (43%), Gaps = 2/48 (4%) Frame = +1 Query: 430 PPXGXXXPPPPP--XXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 P G PPPPP PPPP G PPPPPP+ PP Sbjct: 1056 PMHGGAPPPPPPPMFGGAQPPPPPPMRGGAPPPPPPPMRGGAPPPPPP 1103 Score = 44.8 bits (101), Expect = 0.002 Identities = 20/48 (41%), Positives = 21/48 (43%), Gaps = 2/48 (4%) Frame = +1 Query: 430 PPXGXXXPPPPP--XXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 P G PPPPP PPPP G PPPPPP+ PP Sbjct: 1068 PMFGGAQPPPPPPMRGGAPPPPPPPMRGGAPPPPPPPMRGGAPPPPPP 1115 Score = 44.4 bits (100), Expect = 0.003 Identities = 21/48 (43%), Positives = 21/48 (43%), Gaps = 2/48 (4%) Frame = +1 Query: 430 PPXGXXXPPPPP--XXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 P G PPPPP PPPP G PPPPPP A PP Sbjct: 1104 PMRGGAPPPPPPPMHGGAPPPPPPPMRGGAPPPPPPPGGRGPGAPPPP 1151 Score = 44.0 bits (99), Expect = 0.004 Identities = 21/51 (41%), Positives = 22/51 (43%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPPXXXXXG 584 PP PPPPP PPPP G PPPPP P + PP G Sbjct: 937 PPSYGSPPPPP-------PPPPSYGSPPPPPPPPPSYGSPPPPPPPPPGYG 980 Score = 44.0 bits (99), Expect = 0.004 Identities = 17/39 (43%), Positives = 18/39 (46%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PPPPP PPPP PPPPPP + PP Sbjct: 947 PPPPPSYGSPPPPPPPPPSYGSPPPPPPPPPGYGSPPPP 985 Score = 44.0 bits (99), Expect = 0.004 Identities = 17/39 (43%), Positives = 18/39 (46%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PPPPP PPPP PPPPPP + PP Sbjct: 973 PPPPPGYGSPPPPPPPPPSYGSPPPPPPPPFSHVSSIPP 1011 Score = 44.0 bits (99), Expect = 0.004 Identities = 20/49 (40%), Positives = 21/49 (42%), Gaps = 3/49 (6%) Frame = +1 Query: 430 PPXGXXXPPPPP---XXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 P G PPPPP PPPP G PPPPPP+ PP Sbjct: 1043 PMHGGAPPPPPPPPMHGGAPPPPPPPMFGGAQPPPPPPMRGGAPPPPPP 1091 Score = 42.7 bits (96), Expect = 0.010 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = +3 Query: 453 PPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPPXXXXXG 584 PPPP PPPP G PPPPP P PP G Sbjct: 935 PPPPSYGSPPPPPPPPPSYGSPPPPPPPPPSYGSPPPPPPPPPG 978 Score = 42.7 bits (96), Expect = 0.010 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PPPP PPPP G PPPPP P PP Sbjct: 935 PPPPSYGSPPPPPPPPPSYGSPPPPPPPPPSYGSPPPPP 973 Score = 42.7 bits (96), Expect = 0.010 Identities = 20/46 (43%), Positives = 20/46 (43%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPPP PPPP G PPPPPP PP Sbjct: 962 PPPSYGSPPPPP-------PPPPGYGSPPPPPPPPPSYGSPPPPPP 1000 Score = 42.3 bits (95), Expect = 0.013 Identities = 21/54 (38%), Positives = 21/54 (38%), Gaps = 3/54 (5%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXS---PPPPXXGGGXPPPPPXPXXXAXXXXPPXXXXXG 584 P G PPPPP PPPP GG P PPP P PP G Sbjct: 1128 PMRGGAPPPPPPPGGRGPGAPPPPPPPGGRAPGPPPPPGPRPPGGGPPPPPMLG 1181 Score = 41.1 bits (92), Expect = 0.030 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = +1 Query: 439 GXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 G PPPPP PPPP G PPPP A PP Sbjct: 1120 GAPPPPPPPMRGGAPPPPPPPGGRGPGAPPPPPPPGGRAPGPP 1162 Score = 40.7 bits (91), Expect = 0.040 Identities = 18/42 (42%), Positives = 19/42 (45%), Gaps = 3/42 (7%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXX---GXXXPPPPPPLXXXXXAXXPP 567 PPPPP PPPP G PPPPPP+ PP Sbjct: 1013 PPPPPMHGGAPPPPPPPPMHGGAPPPPPPPPMHGGAPPPPPP 1054 Score = 40.7 bits (91), Expect = 0.040 Identities = 20/50 (40%), Positives = 22/50 (44%), Gaps = 4/50 (8%) Frame = +1 Query: 430 PPXGXX-XPPPPPXXXK---XXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPPP + PPPP G PPPPPP+ PP Sbjct: 1090 PPPMRGGAPPPPPPPMRGGAPPPPPPPMHGGAPPPPPPPMRGGAPPPPPP 1139 Score = 40.3 bits (90), Expect = 0.053 Identities = 21/57 (36%), Positives = 21/57 (36%), Gaps = 6/57 (10%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXX------GGGXPPPPPXPXXXAXXXXPPXXXXXG 584 P G PPPPP SPPPP PPPPP P PP G Sbjct: 977 PGYGSPPPPPPPPPSYGSPPPPPPPPFSHVSSIPPPPPPPPMHGGAPPPPPPPPMHG 1033 Score = 39.9 bits (89), Expect = 0.070 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 2/41 (4%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXG--XXXPPPPPPLXXXXXAXXPP 567 PPPPP PPPP PPPPPP A PP Sbjct: 986 PPPPPSYGSPPPPPPPPFSHVSSIPPPPPPPPMHGGAPPPP 1026 Score = 38.7 bits (86), Expect = 0.16 Identities = 20/52 (38%), Positives = 21/52 (40%), Gaps = 6/52 (11%) Frame = +1 Query: 430 PPXGXXXPPPPPXXX--KXXXPPPP----XXGXXXPPPPPPLXXXXXAXXPP 567 P G PPPPP PPPP G PPPPPP+ PP Sbjct: 990 PSYGSPPPPPPPPFSHVSSIPPPPPPPPMHGGAPPPPPPPPMHGGAPPPPPP 1041 Score = 37.5 bits (83), Expect = 0.37 Identities = 21/52 (40%), Positives = 23/52 (44%), Gaps = 6/52 (11%) Frame = +1 Query: 430 PPXGXXX---PPPPPXXXKXXXPPPPXXGXXXP---PPPPPLXXXXXAXXPP 567 PP G PPPPP + PPPP G P PPPPP+ A P Sbjct: 1139 PPGGRGPGAPPPPPPPGGRAPGPPPPP-GPRPPGGGPPPPPMLGARGAAVDP 1189 Score = 37.1 bits (82), Expect = 0.50 Identities = 18/50 (36%), Positives = 19/50 (38%), Gaps = 4/50 (8%) Frame = +2 Query: 431 PPXGXXXPPPPXXXXKXXXPPPXXX----GXXXPPPPXPXXXXXXXXPPP 568 PP PPPP + PPP G PPPP P PPP Sbjct: 1115 PPMHGGAPPPPPPPMRGGAPPPPPPPGGRGPGAPPPPPPPGGRAPGPPPP 1164 Score = 36.7 bits (81), Expect = 0.65 Identities = 21/52 (40%), Positives = 22/52 (42%), Gaps = 4/52 (7%) Frame = +3 Query: 423 GXXPPXGXXPPPPPXXXXXXSPPPPXX----GGGXPPPPPXPXXXAXXXXPP 566 G PP PPPPP +PPPP G PPPPP P PP Sbjct: 1131 GGAPP----PPPPPGGRGPGAPPPPPPPGGRAPG-PPPPPGPRPPGGGPPPP 1177 Score = 35.9 bits (79), Expect = 1.1 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +2 Query: 452 PPPPXXXXKXXXPPPXXXGXXXPPPPXPXXXXXXXXPPP 568 PPPP PPP PPPP P PPP Sbjct: 974 PPPPGYGSPPPPPPPPPSYGSPPPPPPPPFSHVSSIPPP 1012 Score = 34.7 bits (76), Expect = 2.6 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPL 537 P G PPPPP P PPPPPPL Sbjct: 682 PNSGTVLPPPPPPPPPFSSERPNSGTVLPPPPPPPL 717 Score = 34.7 bits (76), Expect = 2.6 Identities = 24/72 (33%), Positives = 24/72 (33%), Gaps = 8/72 (11%) Frame = -1 Query: 536 RGGGGGGXSXPXXGGGGXXXXXXXGGGGGXXXPXGGXXXXXKXXPPPPPPGG-------- 381 RGG P GG GG P G PPPPPPGG Sbjct: 1106 RGGAPPPPPPPMHGGAPPPPPPPMRGGAPPPPPPPGGRGPGAP-PPPPPPGGRAPGPPPP 1164 Query: 380 XXXTPXGGXPPP 345 P GG PPP Sbjct: 1165 PGPRPPGGGPPP 1176 Score = 33.9 bits (74), Expect = 4.6 Identities = 20/65 (30%), Positives = 20/65 (30%) Frame = -2 Query: 583 PXXXXXGGXXXXAXXXGXGGGGGXPPPXXGGGGXXFXXXXGGGGGXXPXGGXXPXFXKXX 404 P GG GG PPP GG GG G P P Sbjct: 1101 PPPPMRGGAPPPPPPPMHGGAPPPPPPPMRGGAPPPPPPPGGRGPGAPPPPPPPGGRAPG 1160 Query: 403 PPPPP 389 PPPPP Sbjct: 1161 PPPPP 1165 Score = 33.1 bits (72), Expect = 8.1 Identities = 22/69 (31%), Positives = 23/69 (33%) Frame = -1 Query: 536 RGGGGGGXSXPXXGGGGXXXXXXXGGGGGXXXPXGGXXXXXKXXPPPPPPGGXXXTPXGG 357 RGG P GG GG P PPPPPPGG P Sbjct: 1094 RGGAPPPPPPPMRGGAPPPPPPPMHGGAPPPPPP---PMRGGAPPPPPPPGGRG--PGAP 1148 Query: 356 XPPPXXGXK 330 PPP G + Sbjct: 1149 PPPPPPGGR 1157 >UniRef50_A5JUU8 Cluster: Formin B; n=2; Trypanosoma brucei|Rep: Formin B - Trypanosoma brucei TREU927 Length = 1004 Score = 49.6 bits (113), Expect = 9e-05 Identities = 19/35 (54%), Positives = 19/35 (54%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 PP PPPPP PPPP GG PPPPP P Sbjct: 483 PPVKLPPPPPPPGGKLPPPPPPPPGGKLPPPPPPP 517 Score = 49.2 bits (112), Expect = 1e-04 Identities = 19/35 (54%), Positives = 19/35 (54%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPP 534 PP PPPPP K PPPP G PPPPPP Sbjct: 482 PPPVKLPPPPPPPGGKLPPPPPPPPGGKLPPPPPP 516 Score = 49.2 bits (112), Expect = 1e-04 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP G PPPPP PPPP G PPPPP P PP Sbjct: 515 PPPGKAPPPPP-GGKLPPPPPPGGKGAPPPPPPPPGKLGPGGGPP 558 Score = 48.4 bits (110), Expect = 2e-04 Identities = 20/46 (43%), Positives = 20/46 (43%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP P PPP K PPPP G PPPPPP PP Sbjct: 471 PPAAERLPAPPPPPVKLPPPPPPPGGKLPPPPPPPPGGKLPPPPPP 516 Score = 46.8 bits (106), Expect = 6e-04 Identities = 26/68 (38%), Positives = 27/68 (39%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXX 560 PP G PP G PPPPP +PPPP GG PPPPP A Sbjct: 488 PPPPPPPGGKLPPPPPPPPGGKLPPPPPPPGK--APPPPP-GGKLPPPPPPGGKGAPPPP 544 Query: 561 PPXXXXXG 584 PP G Sbjct: 545 PPPPGKLG 552 Score = 45.2 bits (102), Expect = 0.002 Identities = 20/40 (50%), Positives = 20/40 (50%), Gaps = 5/40 (12%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGG-----GXPPPPPXP 536 PP G PPPPP PPPP G G PPPPP P Sbjct: 524 PPGGKLPPPPPPGGKGAPPPPPPPPGKLGPGGGPPPPPPP 563 Score = 44.8 bits (101), Expect = 0.002 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPP K PPPP PPPPPP PP Sbjct: 513 PPPPPGKAPPPPPGGKLPPPPPPGGKGAPPPPPPPPGKLGPGGGPP 558 Score = 44.4 bits (100), Expect = 0.003 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPPP PPP G PPPPPP PP Sbjct: 514 PPPPGKAPPPPPGGKLPPPPPPGGKGAPPPPPPPPGKLGPGGGPPP 559 Score = 43.2 bits (97), Expect = 0.008 Identities = 16/34 (47%), Positives = 17/34 (50%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPP 531 PP PPPPP + PPPP PPPPP Sbjct: 461 PPSATLPPPPPPAAERLPAPPPPPVKLPPPPPPP 494 Score = 43.2 bits (97), Expect = 0.008 Identities = 25/74 (33%), Positives = 25/74 (33%), Gaps = 8/74 (10%) Frame = +1 Query: 337 PXXGGGXPPXGVXSXXXXXXXXXXFXXXXXXPPXGXXXPPPPPXXXKXXXPPPPXX---- 504 P GG PP PP G PPPPP K PPPP Sbjct: 492 PPPGGKLPPPPPPPPGGKLPPPPPPPGKAPPPPPGGKLPPPPPPGGKGAPPPPPPPPGKL 551 Query: 505 ----GXXXPPPPPP 534 G PPPPPP Sbjct: 552 GPGGGPPPPPPPPP 565 Score = 39.9 bits (89), Expect = 0.070 Identities = 17/45 (37%), Positives = 18/45 (40%) Frame = +1 Query: 433 PXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 P PPPPP + PPP PPPPPP PP Sbjct: 461 PPSATLPPPPPPAAERLPAPPPPPVKLPPPPPPPGGKLPPPPPPP 505 Score = 39.5 bits (88), Expect = 0.093 Identities = 18/45 (40%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 P PPPPP +PPPP PPPPP P PP Sbjct: 462 PSATLPPPPPPAAERLPAPPPPPV--KLPPPPPPPGGKLPPPPPP 504 Score = 37.9 bits (84), Expect = 0.28 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 2/44 (4%) Frame = -1 Query: 455 GGXXXPXGGXXXXXKXXPPPPPPGGXXXTPXGG--XPPPXXGXK 330 GG P K PPPPPPG P GG PPP G K Sbjct: 495 GGKLPPPPPPPPGGKLPPPPPPPGKAPPPPPGGKLPPPPPPGGK 538 Score = 37.1 bits (82), Expect = 0.50 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -3 Query: 363 GGXPPPXXGXKXXXXXXPPXKKXPPPPPXGGXGXP 259 GG PP PP K PPPPP GG G P Sbjct: 507 GGKLPPPPPPPGKAPPPPPGGKLPPPPPPGGKGAP 541 Score = 36.3 bits (80), Expect = 0.86 Identities = 22/59 (37%), Positives = 22/59 (37%) Frame = -1 Query: 521 GGXSXPXXGGGGXXXXXXXGGGGGXXXPXGGXXXXXKXXPPPPPPGGXXXTPXGGXPPP 345 GG P G GG P GG K PPPPPP P GG PPP Sbjct: 507 GGKLPPPPPPPGKAPPPPPGGKLPPPPPPGG-----KGAPPPPPPPPGKLGPGGGPPPP 560 Score = 35.5 bits (78), Expect = 1.5 Identities = 19/48 (39%), Positives = 19/48 (39%), Gaps = 2/48 (4%) Frame = +2 Query: 431 PPXGXX--XPPPPXXXXKXXXPPPXXXGXXXPPPPXPXXXXXXXXPPP 568 PP PPPP K PPP G PPPP P PPP Sbjct: 480 PPPPPVKLPPPPPPPGGKLPPPPPPPPGGKLPPPPPP--PGKAPPPPP 525 Score = 34.7 bits (76), Expect = 2.6 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = -3 Query: 354 PPPXXGXKXXXXXXPPXKKXPPPPPXGGXGXP 259 PPP + PP K PPPPP GG P Sbjct: 469 PPPPAAERLPAPPPPPVKLPPPPPPPGGKLPP 500 Score = 33.9 bits (74), Expect = 4.6 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -3 Query: 354 PPPXXGXKXXXXXXPPXKKXPPPPPXGGXGXP 259 PPP G PP K PPPPP G P Sbjct: 491 PPPPGGKLPPPPPPPPGGKLPPPPPPPGKAPP 522 Score = 33.1 bits (72), Expect = 8.1 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = -1 Query: 413 KXXPPPPPPGGXXXTPXGGXPPPXXGXK 330 K PPPPPPGG P PPP G K Sbjct: 486 KLPPPPPPPGGKLPPP----PPPPPGGK 509 >UniRef50_Q54SP2 Cluster: Actin-binding protein; n=2; Dictyostelium discoideum|Rep: Actin-binding protein - Dictyostelium discoideum AX4 Length = 1126 Score = 49.2 bits (112), Expect = 1e-04 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 P G PPPPP PPPP GGG PPPPP P PP Sbjct: 556 PVSGGGPPPPPP------PPPPSSGGGPPPPPPPPSSGGPPPPPP 594 Score = 48.8 bits (111), Expect = 2e-04 Identities = 19/38 (50%), Positives = 19/38 (50%) Frame = +3 Query: 423 GXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 G PP PPPP PPPP GG PPPPP P Sbjct: 559 GGGPPPPPPPPPPSSGGGPPPPPPPPSSGGPPPPPPPP 596 Score = 47.2 bits (107), Expect = 5e-04 Identities = 21/45 (46%), Positives = 22/45 (48%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 P G PPPPP P PP GGG PPPPP P + PP Sbjct: 540 PSLGAPPPPPPPP-----PAPPVSGGGPPPPPPPPPPSSGGGPPP 579 Score = 43.2 bits (97), Expect = 0.008 Identities = 20/46 (43%), Positives = 20/46 (43%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPPP PPPP G PPPPPP PP Sbjct: 555 PPVSGGGPPPPPP------PPPPSSGGGPPPPPPPPSSGGPPPPPP 594 Score = 39.9 bits (89), Expect = 0.070 Identities = 21/49 (42%), Positives = 21/49 (42%) Frame = +3 Query: 384 PRGGGGGXXFXXXGXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPP 530 P GGG P G PPPP PPPP GG PPPPP Sbjct: 555 PPVSGGGPPPPPPPPPPSSGGGPPPP--------PPPPSSGGPPPPPPP 595 Score = 36.3 bits (80), Expect = 0.86 Identities = 21/53 (39%), Positives = 21/53 (39%), Gaps = 3/53 (5%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPX---GXXPPPPPXXXXXXSPPPPXXGGGXPPPPP 530 PP GGG PP G PPPPP PPPP GG P P Sbjct: 555 PPVSGGGPPP--PPPPPPPSSGGGPPPPPPPPSSGGPPPPPPPPGGMKKPGAP 605 Score = 33.1 bits (72), Expect = 8.1 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +3 Query: 423 GXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 G PP PPPPP PPPP G P P P Sbjct: 574 GGGPPP---PPPPPSSGGPPPPPPPPGGMKKPGAPAVP 608 >UniRef50_A6RGJ8 Cluster: Predicted protein; n=1; Ajellomyces capsulatus NAm1|Rep: Predicted protein - Ajellomyces capsulatus NAm1 Length = 757 Score = 49.2 bits (112), Expect = 1e-04 Identities = 29/68 (42%), Positives = 29/68 (42%), Gaps = 1/68 (1%) Frame = -1 Query: 536 RGGGGGGXSXPXXGGGGXXXXXXXGGGGGXXXPXGGXXXXXKXXPPPPPPGGXXXTP-XG 360 RGGGGGG P GGGG GGGGG GG PP GG P G Sbjct: 354 RGGGGGGGGGPPEGGGGSDGAPGRGGGGGGPPGGGGGG----GGPPGGGGGGGGGPPGGG 409 Query: 359 GXPPPXXG 336 G PP G Sbjct: 410 GGGPPGSG 417 Score = 48.4 bits (110), Expect = 2e-04 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = -2 Query: 565 GGXXXXAXXXGXGGGGGXPPPXXGGGGXXFXXXXGGGGGXXPXGG 431 GG G GGGGG PP GGGG GGGGG P GG Sbjct: 386 GGGGGGGGPPGGGGGGGGGPPGGGGGGPPGSGGGGGGGGGPPEGG 430 Score = 48.4 bits (110), Expect = 2e-04 Identities = 28/72 (38%), Positives = 28/72 (38%), Gaps = 9/72 (12%) Frame = -1 Query: 533 GGGGGGXSXPXXGGGGXXXXXXXGGGGGXXXPXGGXXXXXK---------XXPPPPPPGG 381 GGGGGG P GGGG GGGGG P GG PP GG Sbjct: 396 GGGGGGGGGPPGGGGGGPPGSGGGGGGGGGPPEGGGGSDGAPGRGGGGGGGGGPPGGGGG 455 Query: 380 XXXTPXGGXPPP 345 P GG PP Sbjct: 456 GGGPPGGGGDPP 467 Score = 44.4 bits (100), Expect = 0.003 Identities = 20/38 (52%), Positives = 20/38 (52%) Frame = -2 Query: 535 GXGGGGGXPPPXXGGGGXXFXXXXGGGGGXXPXGGXXP 422 G GGGGG PP GGGG GGGGG GG P Sbjct: 376 GRGGGGGGPPGGGGGGGGPPGGGGGGGGGPPGGGGGGP 413 Score = 44.4 bits (100), Expect = 0.003 Identities = 28/73 (38%), Positives = 28/73 (38%) Frame = -1 Query: 566 GGXXAXXXXXRGGGGGGXSXPXXGGGGXXXXXXXGGGGGXXXPXGGXXXXXKXXPPPPPP 387 GG GGGGGG P GGG GGGGG P GG PP Sbjct: 407 GGGGGGPPGSGGGGGGGGGPPEGGGGSDGAPGRGGGGGGGGGPPGGGGGGG------GPP 460 Query: 386 GGXXXTPXGGXPP 348 GG GG PP Sbjct: 461 GG------GGDPP 467 Score = 42.3 bits (95), Expect = 0.013 Identities = 21/54 (38%), Positives = 21/54 (38%) Frame = -2 Query: 583 PXXXXXGGXXXXAXXXGXGGGGGXPPPXXGGGGXXFXXXXGGGGGXXPXGGXXP 422 P GG G GG G P GGGG GGGGG P GG P Sbjct: 413 PPGSGGGGGGGGGPPEGGGGSDGAPGRGGGGGGGGGPPGGGGGGGGPPGGGGDP 466 Score = 41.5 bits (93), Expect = 0.023 Identities = 22/51 (43%), Positives = 22/51 (43%) Frame = -2 Query: 583 PXXXXXGGXXXXAXXXGXGGGGGXPPPXXGGGGXXFXXXXGGGGGXXPXGG 431 P GG G GGGGG P GGGG GGGGG P GG Sbjct: 341 PPASGGGGGGPPGRGGGGGGGGG---PPEGGGGSDGAPGRGGGGGGPPGGG 388 Score = 41.5 bits (93), Expect = 0.023 Identities = 22/52 (42%), Positives = 22/52 (42%), Gaps = 2/52 (3%) Frame = -1 Query: 533 GGGGGGXSXPXXGGGGXXXXXXXGGGGGX--XXPXGGXXXXXKXXPPPPPPG 384 GGGGGG P GGGG GGGGG P GG PPG Sbjct: 417 GGGGGGGGGPPEGGGGSDGAPGRGGGGGGGGGPPGGGGGGGGPPGGGGDPPG 468 Score = 38.3 bits (85), Expect = 0.21 Identities = 26/78 (33%), Positives = 26/78 (33%), Gaps = 1/78 (1%) Frame = -1 Query: 566 GGXXAXXXXXRGGGGGGXSXPXXGGGGXXXXXXXGGGGGX-XXPXGGXXXXXKXXPPPPP 390 GG GGGG P GGGG GGGGG GG P Sbjct: 355 GGGGGGGGGPPEGGGGSDGAPGRGGGGGGPPGGGGGGGGPPGG-GGGGGGGPPGGGGGGP 413 Query: 389 PGGXXXTPXGGXPPPXXG 336 PG GG PP G Sbjct: 414 PGSGGGGGGGGGPPEGGG 431 Score = 37.9 bits (84), Expect = 0.28 Identities = 25/62 (40%), Positives = 25/62 (40%) Frame = -2 Query: 565 GGXXXXAXXXGXGGGGGXPPPXXGGGGXXFXXXXGGGGGXXPXGGXXPXFXKXXPPPPPR 386 GG A G GGGGG PP GGG GGGGG GG P PR Sbjct: 430 GGGSDGAPGRGGGGGGGGGPP---GGG-------GGGGGPPGGGGDPPGVPSAAARSHPR 479 Query: 385 GG 380 G Sbjct: 480 NG 481 Score = 37.5 bits (83), Expect = 0.37 Identities = 24/70 (34%), Positives = 24/70 (34%), Gaps = 2/70 (2%) Frame = -2 Query: 583 PXXXXXGGXXXXAXXXGXGGGGGXPPPXXGGGGXXFXXXXGGG--GGXXPXGGXXPXFXK 410 P GG G GG G P GGGG GGG GG GG P Sbjct: 351 PPGRGGGGGGGGGPPEGGGGSDGAPGRGGGGGGPPGGGGGGGGPPGGGGGGGGGPPGGGG 410 Query: 409 XXPPPPPRGG 380 PP GG Sbjct: 411 GGPPGSGGGG 420 Score = 36.7 bits (81), Expect = 0.65 Identities = 22/65 (33%), Positives = 22/65 (33%) Frame = -1 Query: 530 GGGGGXSXPXXGGGGXXXXXXXGGGGGXXXPXGGXXXXXKXXPPPPPPGGXXXTPXGGXP 351 G GG P GGGG GGGGG P G GG GG Sbjct: 334 GPAGGRVPPASGGGGGGPPGRGGGGGGGGGPPEGGGGSDGAPGRGGGGGGPPGGGGGGGG 393 Query: 350 PPXXG 336 PP G Sbjct: 394 PPGGG 398 Score = 35.1 bits (77), Expect = 2.0 Identities = 24/69 (34%), Positives = 25/69 (36%), Gaps = 3/69 (4%) Frame = -1 Query: 533 GGGGGGXSXPXXGGGGXXXXXXXGGGGGXXXPXGG---XXXXXKXXPPPPPPGGXXXTPX 363 G GG GGGG GGGGG P GG + PPGG Sbjct: 334 GPAGGRVPPASGGGGGGPPGRGGGGGGGGGPPEGGGGSDGAPGRGGGGGGPPGGGG---G 390 Query: 362 GGXPPPXXG 336 GG PP G Sbjct: 391 GGGPPGGGG 399 Score = 34.7 bits (76), Expect = 2.6 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = -3 Query: 567 GGGXXXXXXXKGXGGGGXXXPXXXGGGXXXFXXXXGGGGXLXPXGG 430 GGG G GGGG P GG GGGG P GG Sbjct: 407 GGGGGGPPGSGGGGGGGGGPPEGGGGSDGAPGRGGGGGGGGGPPGG 452 Score = 34.3 bits (75), Expect = 3.5 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -2 Query: 535 GXGGGGGXPPPXXGGGGXXFXXXXGGGGGXXPXGG 431 G GG P GGGG GGGGG P GG Sbjct: 334 GPAGGRVPPASGGGGGGPPGRGGGGGGGGGPPEGG 368 Score = 33.5 bits (73), Expect = 6.1 Identities = 27/101 (26%), Positives = 27/101 (26%) Frame = -3 Query: 567 GGGXXXXXXXKGXGGGGXXXPXXXGGGXXXFXXXXGGGGXLXPXGGXXXXXXKXXXXXXX 388 GGG G GGGG P GG GGGG P GG Sbjct: 345 GGGGGGPPGRGGGGGGGGGPPEGGGGSDGAPGRGGGGGG---PPGGGGGGGGPPGGGGGG 401 Query: 387 XXXXXXXXGGXPPPXXGXKXXXXXXPPXKKXPPPPPXGGXG 265 GG PP G P P G G Sbjct: 402 GGGPPGGGGGGPPGSGGGGGGGGGPPEGGGGSDGAPGRGGG 442 Score = 33.1 bits (72), Expect = 8.1 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +2 Query: 260 GXPXPPXGGGGGXFXFGGXXXXXFFXPXXGGGXPP 364 G PP GGGGG GG P GGG PP Sbjct: 380 GGGGPPGGGGGGGGPPGGGGGGGGGPPGGGGGGPP 414 >UniRef50_P48608 Cluster: Protein diaphanous; n=5; Endopterygota|Rep: Protein diaphanous - Drosophila melanogaster (Fruit fly) Length = 1091 Score = 49.2 bits (112), Expect = 1e-04 Identities = 26/67 (38%), Positives = 26/67 (38%), Gaps = 5/67 (7%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXXPPPPPXXXXXXS-----PPPPXXGGGXPPPPPXPXXX 545 PP GGGG G PPPPP PPPP G G PPPPP P Sbjct: 516 PPPGGGGAPPPPPPPMPGRAGGGPPPPPPPPMPGRAGGPPPPPPPPGMGGPPPPPMPGMM 575 Query: 546 AXXXXPP 566 PP Sbjct: 576 RPGGGPP 582 Score = 45.2 bits (102), Expect = 0.002 Identities = 21/49 (42%), Positives = 21/49 (42%), Gaps = 4/49 (8%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXX----GGGXPPPPPXPXXXAXXXXPPXXXXXG 584 PPPPP PPPP GGG PPPPP P PP G Sbjct: 514 PPPPPGGGGAPPPPPPPMPGRAGGGPPPPPPPPMPGRAGGPPPPPPPPG 562 Score = 42.7 bits (96), Expect = 0.010 Identities = 23/70 (32%), Positives = 24/70 (34%), Gaps = 3/70 (4%) Frame = +1 Query: 337 PXXGGGXPPXGVXSXXXXXXXXXXFXXXXXXPPXGXXXPPPPPXXXKXXXPPPPXXGXXX 516 P GGG PP P PPPPP PPPP G Sbjct: 517 PPGGGGAPPPPPPPMPGRAGGGPPPPPPPPMPGRAGGPPPPPPPPGMGGPPPPPMPGMMR 576 Query: 517 P---PPPPPL 537 P PPPPP+ Sbjct: 577 PGGGPPPPPM 586 Score = 40.3 bits (90), Expect = 0.053 Identities = 19/51 (37%), Positives = 20/51 (39%), Gaps = 5/51 (9%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPP-----XXGXXXPPPPPPLXXXXXAXXPP 567 P PPPPP PPPP G PPPPPP+ PP Sbjct: 507 PKVNIPMPPPPPGGGGAPPPPPPPMPGRAGGGPPPPPPPPMPGRAGGPPPP 557 Score = 39.1 bits (87), Expect = 0.12 Identities = 18/45 (40%), Positives = 19/45 (42%), Gaps = 2/45 (4%) Frame = +1 Query: 439 GXXXPPPPPXXXKXXXPPPPXX--GXXXPPPPPPLXXXXXAXXPP 567 G PPPPP + PPPP G PPPPP PP Sbjct: 538 GPPPPPPPPMPGRAGGPPPPPPPPGMGGPPPPPMPGMMRPGGGPP 582 Score = 36.7 bits (81), Expect = 0.65 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 P P PPPP GG PPPPP A PP Sbjct: 503 PNKLPKVNIPMPPPPPGGGGAPPPPPPPMPGRAGGGPPP 541 Score = 35.9 bits (79), Expect = 1.1 Identities = 20/40 (50%), Positives = 20/40 (50%), Gaps = 4/40 (10%) Frame = +3 Query: 423 GXXPPXGXXPPPPPXXXXXXSPPPPXXG----GGXPPPPP 530 G PP PPPPP PPPP G GG PPPPP Sbjct: 552 GGPPP----PPPPPG--MGGPPPPPMPGMMRPGGGPPPPP 585 >UniRef50_UPI0000F205BB Cluster: PREDICTED: similar to formin 2; n=2; Danio rerio|Rep: PREDICTED: similar to formin 2 - Danio rerio Length = 1465 Score = 48.8 bits (111), Expect = 2e-04 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 P G PPPPP PPPP G PPPPP P PP Sbjct: 947 PVVGKAPPPPPLPGMVPPPPPPLPGMAPPPPPPFPGMTPPPPPPP 991 Score = 45.2 bits (102), Expect = 0.002 Identities = 20/46 (43%), Positives = 20/46 (43%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPPP PPPP G PPPPPP PP Sbjct: 946 PPVVGKAPPPPPLPGMVPPPPPPLPGMA-PPPPPPFPGMTPPPPPP 990 Score = 45.2 bits (102), Expect = 0.002 Identities = 18/35 (51%), Positives = 18/35 (51%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 P G PPPPP PPPP G PPPPP P Sbjct: 968 PLPGMAPPPPPPFPGMTPPPPPPPPGCGPPPPPLP 1002 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/51 (37%), Positives = 20/51 (39%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPPXXXXXG 584 PP PPPP +PPPP G PPPP P PP G Sbjct: 956 PPLPGMVPPPPPPLPGMAPPPPPPFPGMTPPPPPPPPGCGPPPPPLPPGIG 1006 Score = 41.5 bits (93), Expect = 0.023 Identities = 20/46 (43%), Positives = 20/46 (43%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPP K PPPP PPPPPPL PP Sbjct: 936 PPPLPGFVPPPPVVGKA--PPPPPLPGMVPPPPPPLPGMAPPPPPP 979 Score = 40.3 bits (90), Expect = 0.053 Identities = 25/77 (32%), Positives = 25/77 (32%) Frame = +1 Query: 337 PXXGGGXPPXGVXSXXXXXXXXXXFXXXXXXPPXGXXXPPPPPXXXKXXXPPPPXXGXXX 516 P G PP V P G PPPPP PPPP G Sbjct: 937 PPLPGFVPPPPVVGKAPPPPPLPGMVPPPPPPLPGMAPPPPPPFPGMTPPPPPPPPGCG- 995 Query: 517 PPPPPPLXXXXXAXXPP 567 PPPPPL PP Sbjct: 996 -PPPPPL-PPGIGPPPP 1010 Score = 39.1 bits (87), Expect = 0.12 Identities = 18/34 (52%), Positives = 18/34 (52%) Frame = +3 Query: 435 PXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 P G PPPPP PPPP G PPPPP P Sbjct: 929 PTGVIPPPPPLPGFV--PPPPVVGKA-PPPPPLP 959 Score = 39.1 bits (87), Expect = 0.12 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPP 527 P G PPPPP PPPP G PPPP Sbjct: 979 PFPGMTPPPPPPPPGCGPPPPPLPPGIGPPPP 1010 Score = 38.7 bits (86), Expect = 0.16 Identities = 21/50 (42%), Positives = 21/50 (42%), Gaps = 2/50 (4%) Frame = +3 Query: 423 GXXPPXGXXPP--PPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 G PP P PPP PPPP G PPPPP P A PP Sbjct: 931 GVIPPPPPLPGFVPPPPVVGKAPPPPPLPGMVPPPPPPLP-GMAPPPPPP 979 Score = 36.7 bits (81), Expect = 0.65 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = +2 Query: 416 KXXXXPPXGXXXPPPPXXXXKXXXPPPXXXGXXXPPPPXPXXXXXXXXPP 565 K PP PPPP PPP PPPP P PP Sbjct: 951 KAPPPPPLPGMVPPPPPPLPGMAPPPPPPFPGMTPPPPPPPPGCGPPPPP 1000 Score = 35.5 bits (78), Expect = 1.5 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPP PPPP G PPPPPL PP Sbjct: 926 PPKPTGVIPPPP-PLPGFVPPPPVVG--KAPPPPPLPGMVPPPPPP 968 Score = 35.1 bits (77), Expect = 2.0 Identities = 17/35 (48%), Positives = 18/35 (51%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 PP PPPPP +PP P G PPPPP P Sbjct: 910 PPPPQLPPPPPLSGM--TPPKPT--GVIPPPPPLP 940 Score = 35.1 bits (77), Expect = 2.0 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXP 518 PP G PPPPP PPPP G G P Sbjct: 990 PPPGCGPPPPPLPPGI-GPPPPFMGMGPP 1017 >UniRef50_UPI0000E80701 Cluster: PREDICTED: similar to formin, inverted; n=1; Gallus gallus|Rep: PREDICTED: similar to formin, inverted - Gallus gallus Length = 1208 Score = 48.8 bits (111), Expect = 2e-04 Identities = 27/70 (38%), Positives = 27/70 (38%), Gaps = 2/70 (2%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXXPPPPPXXXXXXSPPPPXXGG--GXPPPPPXPXXXAXX 554 PP G GG P G PPPPP PPPP G G PPPPP P Sbjct: 397 PPLPGMGG--IPPPPPLPGMGGIPPPPPLPGLGGIPPPPPLPGLAGIPPPPPLPGMGGIP 454 Query: 555 XXPPXXXXXG 584 PP G Sbjct: 455 PPPPLSGMGG 464 Score = 45.2 bits (102), Expect = 0.002 Identities = 25/64 (39%), Positives = 25/64 (39%), Gaps = 2/64 (3%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXXPPPPPXXXXXXSPPPPXXG--GGXPPPPPXPXXXAXX 554 PP G GG P G PPPPP PPPP GG PPPPP Sbjct: 409 PPLPGMGG--IPPPPPLPGLGGIPPPPPLPGLAGIPPPPPLPGMGGIPPPPPLSGMGGIP 466 Query: 555 XXPP 566 PP Sbjct: 467 PPPP 470 Score = 44.0 bits (99), Expect = 0.004 Identities = 20/46 (43%), Positives = 20/46 (43%), Gaps = 1/46 (2%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXG-GGXPPPPPXPXXXAXXXXPPXXXXXG 584 PPP P PPPP G GG PPPPP P PP G Sbjct: 383 PPPLPGMAVIPPPPPPLPGMGGIPPPPPLPGMGGIPPPPPLPGLGG 428 Score = 44.0 bits (99), Expect = 0.004 Identities = 20/46 (43%), Positives = 20/46 (43%), Gaps = 1/46 (2%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXG-GGXPPPPPXPXXXAXXXXPPXXXXXG 584 PPPP PPPP G GG PPPPP P PP G Sbjct: 395 PPPPLPGMGGIPPPPPLPGMGGIPPPPPLPGLGGIPPPPPLPGLAG 440 Score = 42.7 bits (96), Expect = 0.010 Identities = 20/48 (41%), Positives = 20/48 (41%), Gaps = 2/48 (4%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXG--XXXPPPPPPLXXXXXAXXPP 567 PP PPPPP PPPP PPPPPPL PP Sbjct: 362 PPLPGIPPPPPPLPGMAVIPPPPPLPGMAVIPPPPPPLPGMGGIPPPP 409 Score = 42.7 bits (96), Expect = 0.010 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 P G PPPP PPPP G PPPPPL PP Sbjct: 424 PGLGGIPPPPPLPGLAGIPPPPPLPGMGGIPPPPPLSGMGGIPPPP 469 Score = 42.3 bits (95), Expect = 0.013 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 P G PPPP PPPP G PPPPPL PP Sbjct: 412 PGMGGIPPPPPLPGLGGIPPPPPLPGLAGIPPPPPLPGMGGIPPPP 457 Score = 41.9 bits (94), Expect = 0.017 Identities = 21/54 (38%), Positives = 21/54 (38%), Gaps = 3/54 (5%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGG---XPPPPPXPXXXAXXXXPPXXXXXG 584 P G PPPPP PPPP G PPPPP P PP G Sbjct: 363 PLPGIPPPPPPLPGMAVIPPPPPLPGMAVIPPPPPPLPGMGGIPPPPPLPGMGG 416 Score = 41.1 bits (92), Expect = 0.030 Identities = 23/55 (41%), Positives = 23/55 (41%), Gaps = 3/55 (5%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXXPPPPPXXXXXXSPPPPXX---GGGXPPPPPXP 536 PP G GG P PPPPP PPPP GG PPPPP P Sbjct: 421 PPLPGLGG--IPPPPPLPGLAGIPPPPPLPGMGGIPPPPPLSGMGGIPPPPPPLP 473 Score = 39.5 bits (88), Expect = 0.093 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PPP P PPPP G PPPPPL PP Sbjct: 383 PPPLPGMAVIPPPPPPLPGMGGIPPPPPLPGMGGIPPPP 421 Score = 37.9 bits (84), Expect = 0.28 Identities = 16/31 (51%), Positives = 16/31 (51%), Gaps = 2/31 (6%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXX--PPPPPPL 537 PPPPP PPPP PPPPPPL Sbjct: 442 PPPPPLPGMGGIPPPPPLSGMGGIPPPPPPL 472 Score = 34.7 bits (76), Expect = 2.6 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 1/52 (1%) Frame = +2 Query: 416 KXXXXPPXGXX-XPPPPXXXXKXXXPPPXXXGXXXPPPPXPXXXXXXXXPPP 568 K PP PPPP PPP G PPP P PPP Sbjct: 357 KRLSAPPLPGIPPPPPPLPGMAVIPPPPPLPGMAVIPPPPPPLPGMGGIPPP 408 >UniRef50_UPI000023E328 Cluster: hypothetical protein FG01070.1; n=1; Gibberella zeae PH-1|Rep: hypothetical protein FG01070.1 - Gibberella zeae PH-1 Length = 217 Score = 48.8 bits (111), Expect = 2e-04 Identities = 19/46 (41%), Positives = 22/46 (47%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPPP + PPPP PPPPPP+ + PP Sbjct: 34 PPREPSPPPPPPVIYRPPLPPPPPPQFYPPPPPPPVIEVPCSPPPP 79 Score = 37.1 bits (82), Expect = 0.50 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPP 534 PPPPP PPPP PPPPP Sbjct: 53 PPPPPPQFYPPPPPPPVIEVPCSPPPPP 80 Score = 36.7 bits (81), Expect = 0.65 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPP 534 PPPPP PPP PPPPPP Sbjct: 54 PPPPPQFYPPPPPPPVIEVPCSPPPPPP 81 Score = 35.1 bits (77), Expect = 2.0 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 PPPPP PPP PPPPP P Sbjct: 54 PPPPPQFYPPPPPPPVIEVPCSPPPPPPP 82 Score = 34.7 bits (76), Expect = 2.6 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 454 PPPPXXXKXXXPPPPXXGXXXPPPPPP 534 PPPP PPP PPPPPP Sbjct: 32 PPPPREPSPPPPPPVIYRPPLPPPPPP 58 Score = 33.9 bits (74), Expect = 4.6 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPL 537 PP PPPPP PPPP P P P+ Sbjct: 57 PPQFYPPPPPPPVIEVPCSPPPPPPPPVEKPKPKPV 92 Score = 33.1 bits (72), Expect = 8.1 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPP 531 PP PPPPP + PPP PPPPP Sbjct: 56 PPPQFYPPPPPPPVIEVPCSPPP------PPPPP 83 >UniRef50_A0R2X6 Cluster: Putative uncharacterized protein; n=2; Mycobacterium|Rep: Putative uncharacterized protein - Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) Length = 377 Score = 48.8 bits (111), Expect = 2e-04 Identities = 24/62 (38%), Positives = 24/62 (38%) Frame = -1 Query: 521 GGXSXPXXGGGGXXXXXXXGGGGGXXXPXGGXXXXXKXXPPPPPPGGXXXTPXGGXPPPX 342 GG P GG GG P G PPPPPPGG P GG PPP Sbjct: 15 GGYPPPPPPDGGYPPPPPPDGGYPPAQPGGFGPPPQGGYPPPPPPGGYPPPPQGGFPPPP 74 Query: 341 XG 336 G Sbjct: 75 PG 76 Score = 45.6 bits (103), Expect = 0.001 Identities = 22/50 (44%), Positives = 23/50 (46%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPP 530 PP+GG PP G PPPPP PPPP G PPPPP Sbjct: 48 PPQGGYPPPPPPGGYPPPPQGGFPPPPPGGYPP--PPPPQGGSYPPPPPP 95 Score = 44.8 bits (101), Expect = 0.002 Identities = 25/65 (38%), Positives = 26/65 (40%), Gaps = 3/65 (4%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXXPPPPPXXXXXXSPP---PPXXGGGXPPPPPXPXXXAX 551 PP GG PP G PPPPP P PP GG PPPPP P + Sbjct: 31 PPPDGGYPPAQPGGFGPPPQGGYPPPPPPGGYPPPPQGGFPPPPPGGYPPPPP-PQGGSY 89 Query: 552 XXXPP 566 PP Sbjct: 90 PPPPP 94 Score = 44.4 bits (100), Expect = 0.003 Identities = 20/48 (41%), Positives = 20/48 (41%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPPP 524 PP GG PP G PPPPP PPPP G PPP Sbjct: 56 PPPPGGYPPPPQGGFPPPPPGGYPPPPPPQGGSYPPPPPPGAAGYPPP 103 Score = 41.5 bits (93), Expect = 0.023 Identities = 21/50 (42%), Positives = 22/50 (44%), Gaps = 4/50 (8%) Frame = +1 Query: 430 PPXGXXXPPPPPXXX----KXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP G PPPPP + PPPP G PPPPPP PP Sbjct: 48 PPQGGYPPPPPPGGYPPPPQGGFPPPPPGGY--PPPPPPQGGSYPPPPPP 95 Score = 40.7 bits (91), Expect = 0.040 Identities = 20/52 (38%), Positives = 20/52 (38%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 PP GG G PP PPPP PPPP G PPP P Sbjct: 55 PPPPPGGYPPPPQGGFPPPPPGGYPPPPPPQGGSYPPPPPPGAAGYPPPGYP 106 Score = 39.9 bits (89), Expect = 0.070 Identities = 17/33 (51%), Positives = 17/33 (51%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPP 530 PP G PPPPP PPPP GG PP P Sbjct: 12 PPDGGYPPPPPPDGGYPPPPPP--DGGYPPAQP 42 Score = 39.5 bits (88), Expect = 0.093 Identities = 17/32 (53%), Positives = 17/32 (53%) Frame = +3 Query: 435 PXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPP 530 P G PPPP PPPP GG PPPPP Sbjct: 5 PPGNNPPPPDGGY----PPPPPPDGGYPPPPP 32 Score = 37.5 bits (83), Expect = 0.37 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP G PPPPP PPPP PPP A PP Sbjct: 73 PPPGGYPPPPPPQGGSYPPPPPPGAAGY---PPPGYPGGPGAGYPP 115 Score = 37.1 bits (82), Expect = 0.50 Identities = 17/37 (45%), Positives = 17/37 (45%), Gaps = 4/37 (10%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPP----PXXGGGXPPPPP 530 PP G PPPPP P P GG PPPPP Sbjct: 22 PPDGGYPPPPPPDGGYPPAQPGGFGPPPQGGYPPPPP 58 Score = 34.7 bits (76), Expect = 2.6 Identities = 21/62 (33%), Positives = 22/62 (35%), Gaps = 1/62 (1%) Frame = -1 Query: 518 GXSXPXXGGGGXXXXXXXGGGGGXXXPXGGXXXXXKXXPPPPPPGG-XXXTPXGGXPPPX 342 G + P GG GG P GG PPP GG P GG PPP Sbjct: 7 GNNPPPPDGGYPPPPPPDGGYPPPPPPDGGYPPAQPGGFGPPPQGGYPPPPPPGGYPPPP 66 Query: 341 XG 336 G Sbjct: 67 QG 68 Score = 33.9 bits (74), Expect = 4.6 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = +1 Query: 454 PPPPXXXKXXXPPPPXXGXXXPPPPP 531 PPPP PPPP G PPPPP Sbjct: 10 PPPPDGG--YPPPPPPDGGYPPPPPP 33 Score = 33.9 bits (74), Expect = 4.6 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 4/39 (10%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPP----PPP 534 PP PPPPP PPPP G P PPP Sbjct: 11 PPPDGGYPPPPPPDGGYPPPPPPDGGYPPAQPGGFGPPP 49 Score = 33.9 bits (74), Expect = 4.6 Identities = 24/88 (27%), Positives = 24/88 (27%) Frame = -3 Query: 522 GGXXXPXXXGGGXXXFXXXXGGGGXLXPXGGXXXXXXKXXXXXXXXXXXXXXXGGXPPPX 343 GG P GG GG P G GG PPP Sbjct: 15 GGYPPPPPPDGGYPPPPPPDGGYPPAQPGGFGPPPQGGYPPPPPPGGYPPPPQGGFPPPP 74 Query: 342 XGXKXXXXXXPPXKKXPPPPPXGGXGXP 259 G P PPPPP G G P Sbjct: 75 PGG-YPPPPPPQGGSYPPPPPPGAAGYP 101 Score = 33.5 bits (73), Expect = 6.1 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = +1 Query: 457 PPPXXXKXXXPPPPXXGXXXPPPPPP 534 PPP PPPP G PPPPPP Sbjct: 10 PPPPDGGYPPPPPPDGGY--PPPPPP 33 Score = 33.5 bits (73), Expect = 6.1 Identities = 23/58 (39%), Positives = 23/58 (39%), Gaps = 8/58 (13%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPX--GXXPPPPPXXXXXXSPPPPXXG------GGXPPPPP 530 PP GG G PP G PPP PPPP G GG PPPPP Sbjct: 21 PPPDGGYPPPPPPDGGYPPAQPGGFGPPPQGGYP---PPPPPGGYPPPPQGGFPPPPP 75 Score = 33.5 bits (73), Expect = 6.1 Identities = 23/68 (33%), Positives = 24/68 (35%), Gaps = 9/68 (13%) Frame = -1 Query: 521 GGXSXPXXGGGGXXXXXXXG------GGGGXXXPXGGXXXXXKXXPPPPPPGGXXXTP-- 366 GG P GG G GG P GG + PPPPPGG P Sbjct: 25 GGYPPPPPPDGGYPPAQPGGFGPPPQGGYPPPPPPGGYPPPPQGGFPPPPPGGYPPPPPP 84 Query: 365 -XGGXPPP 345 G PPP Sbjct: 85 QGGSYPPP 92 >UniRef50_Q9NZ56 Cluster: Formin-2; n=13; Eumetazoa|Rep: Formin-2 - Homo sapiens (Human) Length = 1865 Score = 48.8 bits (111), Expect = 2e-04 Identities = 22/50 (44%), Positives = 22/50 (44%) Frame = +3 Query: 435 PXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPPXXXXXG 584 P PPPPP PPPP G G PPPPP P A PP G Sbjct: 1114 PGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLP--GAGIPPPPPLPGAG 1161 Score = 48.8 bits (111), Expect = 2e-04 Identities = 22/50 (44%), Positives = 22/50 (44%) Frame = +3 Query: 435 PXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPPXXXXXG 584 P PPPPP PPPP G G PPPPP P A PP G Sbjct: 1136 PGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLP--GAGIPPPPPLPGAG 1183 Score = 48.8 bits (111), Expect = 2e-04 Identities = 22/50 (44%), Positives = 22/50 (44%) Frame = +3 Query: 435 PXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPPXXXXXG 584 P PPPPP PPPP G G PPPPP P A PP G Sbjct: 1158 PGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLP--GAGIPPPPPLPGAG 1205 Score = 48.8 bits (111), Expect = 2e-04 Identities = 22/50 (44%), Positives = 22/50 (44%) Frame = +3 Query: 435 PXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPPXXXXXG 584 P PPPPP PPPP G G PPPPP P A PP G Sbjct: 1180 PGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLP--GAGIPPPPPLPGAG 1227 Score = 48.8 bits (111), Expect = 2e-04 Identities = 22/50 (44%), Positives = 22/50 (44%) Frame = +3 Query: 435 PXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPPXXXXXG 584 P PPPPP PPPP G G PPPPP P A PP G Sbjct: 1202 PGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLP--GAGIPPPPPLPGVG 1249 Score = 48.8 bits (111), Expect = 2e-04 Identities = 22/50 (44%), Positives = 22/50 (44%) Frame = +3 Query: 435 PXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPPXXXXXG 584 P PPPPP PPPP G G PPPPP P A PP G Sbjct: 1235 PGAGIPPPPPLPGVGIPPPPPLPGAGIPPPPPLP--GAGIPPPPPLPGAG 1282 Score = 48.8 bits (111), Expect = 2e-04 Identities = 22/50 (44%), Positives = 22/50 (44%) Frame = +3 Query: 435 PXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPPXXXXXG 584 P PPPPP PPPP G G PPPPP P A PP G Sbjct: 1279 PGAGIPPPPPLPRVGIPPPPPLPGAGIPPPPPLP--GAGIPPPPPLPGVG 1326 Score = 48.4 bits (110), Expect = 2e-04 Identities = 18/34 (52%), Positives = 18/34 (52%) Frame = +3 Query: 435 PXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 P PPPPP PPPP G G PPPPP P Sbjct: 1257 PGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLP 1290 Score = 47.6 bits (108), Expect = 4e-04 Identities = 22/50 (44%), Positives = 22/50 (44%) Frame = +3 Query: 435 PXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPPXXXXXG 584 P PPPPP PPPP G G PPPPP P A PP G Sbjct: 1224 PGAGIPPPPPLPGAGIPPPPPLPGVGIPPPPPLP--GAGIPPPPPLPGAG 1271 Score = 47.6 bits (108), Expect = 4e-04 Identities = 22/50 (44%), Positives = 22/50 (44%) Frame = +3 Query: 435 PXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPPXXXXXG 584 P PPPPP PPPP G G PPPPP P A PP G Sbjct: 1312 PGAGIPPPPPLPGVGIPPPPPLPGVGIPPPPPLP--GAGIPPPPPLPGMG 1359 Score = 47.2 bits (107), Expect = 5e-04 Identities = 18/34 (52%), Positives = 18/34 (52%) Frame = +3 Query: 435 PXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 P PPPPP PPPP G G PPPPP P Sbjct: 1301 PGAGIPPPPPLPGAGIPPPPPLPGVGIPPPPPLP 1334 Score = 45.6 bits (103), Expect = 0.001 Identities = 21/50 (42%), Positives = 21/50 (42%) Frame = +3 Query: 435 PXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPPXXXXXG 584 P PPPPP PPPP G G PPPPP A PP G Sbjct: 1125 PGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPL--PGAGIPPPPPLPGAG 1172 Score = 45.6 bits (103), Expect = 0.001 Identities = 21/50 (42%), Positives = 21/50 (42%) Frame = +3 Query: 435 PXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPPXXXXXG 584 P PPPPP PPPP G G PPPPP A PP G Sbjct: 1147 PGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPL--PGAGIPPPPPLPGAG 1194 Score = 45.6 bits (103), Expect = 0.001 Identities = 21/50 (42%), Positives = 21/50 (42%) Frame = +3 Query: 435 PXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPPXXXXXG 584 P PPPPP PPPP G G PPPPP A PP G Sbjct: 1169 PGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPL--PGAGIPPPPPLPGAG 1216 Score = 45.6 bits (103), Expect = 0.001 Identities = 21/50 (42%), Positives = 21/50 (42%) Frame = +3 Query: 435 PXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPPXXXXXG 584 P PPPPP PPPP G G PPPPP A PP G Sbjct: 1191 PGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPL--PGAGIPPPPPLPGAG 1238 Score = 45.2 bits (102), Expect = 0.002 Identities = 19/37 (51%), Positives = 19/37 (51%), Gaps = 2/37 (5%) Frame = +3 Query: 432 PPXGXX--PPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 PP PPPPP PPPP G G PPPPP P Sbjct: 1210 PPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLP 1246 Score = 45.2 bits (102), Expect = 0.002 Identities = 19/37 (51%), Positives = 19/37 (51%), Gaps = 2/37 (5%) Frame = +3 Query: 432 PPXGXX--PPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 PP PPPPP PPPP G G PPPPP P Sbjct: 1287 PPLPRVGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLP 1323 Score = 44.8 bits (101), Expect = 0.002 Identities = 21/50 (42%), Positives = 21/50 (42%) Frame = +3 Query: 435 PXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPPXXXXXG 584 P PPPPP PPPP G G P PPP P A PP G Sbjct: 1081 PGAGIPPPPPLPGAAIPPPPPLPGAGIPLPPPLP--GAGIPPPPPLPGAG 1128 Score = 44.8 bits (101), Expect = 0.002 Identities = 21/50 (42%), Positives = 21/50 (42%) Frame = +3 Query: 435 PXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPPXXXXXG 584 P P PPP PPPP G G PPPPP P A PP G Sbjct: 1103 PGAGIPLPPPLPGAGIPPPPPLPGAGIPPPPPLP--GAGIPPPPPLPGAG 1150 Score = 44.4 bits (100), Expect = 0.003 Identities = 20/44 (45%), Positives = 20/44 (45%) Frame = +3 Query: 435 PXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 P PPPPP P PP G G PPPPP P A PP Sbjct: 1059 PGAGIPPPPPLPGAGILPLPPLPGAGIPPPPPLP-GAAIPPPPP 1101 Score = 44.4 bits (100), Expect = 0.003 Identities = 21/50 (42%), Positives = 21/50 (42%) Frame = +3 Query: 435 PXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPPXXXXXG 584 P PPPPP PPPP G G PPPPP A PP G Sbjct: 1246 PGVGIPPPPPLPGAGIPPPPPLPGAGIPPPPPL--PGAGIPPPPPLPRVG 1293 Score = 44.4 bits (100), Expect = 0.003 Identities = 21/50 (42%), Positives = 21/50 (42%) Frame = +3 Query: 435 PXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPPXXXXXG 584 P PPPPP PPPP G PPPPP P A PP G Sbjct: 1268 PGAGIPPPPPLPGAGIPPPPPLPRVGIPPPPPLP--GAGIPPPPPLPGAG 1315 Score = 44.4 bits (100), Expect = 0.003 Identities = 21/47 (44%), Positives = 21/47 (44%), Gaps = 1/47 (2%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPP-PLXXXXXAXXPP 567 P G PPPPP PPPP G PPPPP P A PP Sbjct: 1321 PLPGVGIPPPPPLPGVGIPPPPPLPGAGIPPPPPLPGMGIPPAPAPP 1367 Score = 43.6 bits (98), Expect = 0.006 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPP 531 P G PPPPP PPPP G PPPPP Sbjct: 1112 PLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPP 1145 Score = 43.6 bits (98), Expect = 0.006 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPP 531 P G PPPPP PPPP G PPPPP Sbjct: 1123 PLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPP 1156 Score = 43.6 bits (98), Expect = 0.006 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPP 531 P G PPPPP PPPP G PPPPP Sbjct: 1134 PLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPP 1167 Score = 43.6 bits (98), Expect = 0.006 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPP 531 P G PPPPP PPPP G PPPPP Sbjct: 1145 PLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPP 1178 Score = 43.6 bits (98), Expect = 0.006 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPP 531 P G PPPPP PPPP G PPPPP Sbjct: 1156 PLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPP 1189 Score = 43.6 bits (98), Expect = 0.006 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPP 531 P G PPPPP PPPP G PPPPP Sbjct: 1167 PLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPP 1200 Score = 43.6 bits (98), Expect = 0.006 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPP 531 P G PPPPP PPPP G PPPPP Sbjct: 1178 PLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPP 1211 Score = 43.6 bits (98), Expect = 0.006 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPP 531 P G PPPPP PPPP G PPPPP Sbjct: 1189 PLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPP 1222 Score = 43.6 bits (98), Expect = 0.006 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPP 531 P G PPPPP PPPP G PPPPP Sbjct: 1200 PLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPP 1233 Score = 43.6 bits (98), Expect = 0.006 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPP 531 P G PPPPP PPPP G PPPPP Sbjct: 1211 PLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPP 1244 Score = 43.6 bits (98), Expect = 0.006 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPP 531 P G PPPPP PPPP G PPPPP Sbjct: 1222 PLPGAGIPPPPPLPGAGIPPPPPLPGVGIPPPPP 1255 Score = 43.6 bits (98), Expect = 0.006 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPP 531 P G PPPPP PPPP G PPPPP Sbjct: 1244 PLPGVGIPPPPPLPGAGIPPPPPLPGAGIPPPPP 1277 Score = 43.6 bits (98), Expect = 0.006 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPP 531 P G PPPPP PPPP G PPPPP Sbjct: 1255 PLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPP 1288 Score = 43.6 bits (98), Expect = 0.006 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPP 531 P G PPPPP PPPP G PPPPP Sbjct: 1299 PLPGAGIPPPPPLPGAGIPPPPPLPGVGIPPPPP 1332 Score = 43.2 bits (97), Expect = 0.008 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPP 531 P G PPPPP PPPP G PPPPP Sbjct: 1233 PLPGAGIPPPPPLPGVGIPPPPPLPGAGIPPPPP 1266 Score = 43.2 bits (97), Expect = 0.008 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPP 531 P G PPPPP PPPP G PPPPP Sbjct: 1277 PLPGAGIPPPPPLPRVGIPPPPPLPGAGIPPPPP 1310 Score = 43.2 bits (97), Expect = 0.008 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPP 531 P G PPPPP PPPP G PPPPP Sbjct: 1310 PLPGAGIPPPPPLPGVGIPPPPPLPGVGIPPPPP 1343 Score = 43.2 bits (97), Expect = 0.008 Identities = 20/47 (42%), Positives = 20/47 (42%), Gaps = 1/47 (2%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPP-PPPPLXXXXXAXXPP 567 P G PPPPP PPPP G PP P PPL PP Sbjct: 1332 PLPGVGIPPPPPLPGAGIPPPPPLPGMGIPPAPAPPLPPPGTGIPPP 1378 Score = 41.9 bits (94), Expect = 0.017 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = +3 Query: 435 PXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 P PPPPP PPPP G G PP P P PP Sbjct: 1334 PGVGIPPPPPLPGAGIPPPPPLPGMGIPPAPAPPLPPPGTGIPP 1377 Score = 41.5 bits (93), Expect = 0.023 Identities = 22/53 (41%), Positives = 22/53 (41%), Gaps = 2/53 (3%) Frame = +3 Query: 432 PPXGXX--PPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPPXXXXXG 584 PP PPPPP PPP G G PPPPP P A PP G Sbjct: 1089 PPLPGAAIPPPPPLPGAGIPLPPPLPGAGIPPPPPLP--GAGIPPPPPLPGAG 1139 Score = 40.7 bits (91), Expect = 0.040 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PPPPP PPPP G PPPPP L PP Sbjct: 1295 PPPPPLPGAGIPPPPPLPGAGIPPPPP-LPGVGIPPPPP 1332 Score = 40.3 bits (90), Expect = 0.053 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPP 531 P G PPPPP PPPP PPPPP Sbjct: 1266 PLPGAGIPPPPPLPGAGIPPPPPLPRVGIPPPPP 1299 Score = 39.5 bits (88), Expect = 0.093 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 PPP PPPP G G PPPPP P Sbjct: 1042 PPPLQGTEMLPPPPPPLPGAGIPPPPPLP 1070 Score = 39.5 bits (88), Expect = 0.093 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPP 531 P G PPPPP P PP G PPPPP Sbjct: 1057 PLPGAGIPPPPPLPGAGILPLPPLPGAGIPPPPP 1090 Score = 39.5 bits (88), Expect = 0.093 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPP 531 P G PPPPP PPP G PPPPP Sbjct: 1090 PLPGAAIPPPPPLPGAGIPLPPPLPGAGIPPPPP 1123 Score = 39.5 bits (88), Expect = 0.093 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPP 531 P G P PPP PPPP G PPPPP Sbjct: 1101 PLPGAGIPLPPPLPGAGIPPPPPLPGAGIPPPPP 1134 Score = 38.7 bits (86), Expect = 0.16 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 PPPPP PPPP G G P PP P Sbjct: 1053 PPPPPLPGAGIPPPPPLPGAGILPLPPLP 1081 Score = 38.3 bits (85), Expect = 0.21 Identities = 19/50 (38%), Positives = 19/50 (38%) Frame = +3 Query: 435 PXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPPXXXXXG 584 P P PP PPPP G PPPPP P A PP G Sbjct: 1070 PGAGILPLPPLPGAGIPPPPPLPGAAIPPPPPLP--GAGIPLPPPLPGAG 1117 Score = 35.5 bits (78), Expect = 1.5 Identities = 21/60 (35%), Positives = 21/60 (35%), Gaps = 9/60 (15%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSP---------PPPXXGGGXPPPPPXPXXXAXXXXPPXXXXXG 584 P G PPPPP P PPP G PPPP P A PP G Sbjct: 1014 PGLGMVPPPPPPLPGMTVPTLPSTAIPQPPPLQGTEMLPPPPPPLPGAGIPPPPPLPGAG 1073 Score = 35.5 bits (78), Expect = 1.5 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPP 531 P G P PP PPPP G PPPPP Sbjct: 1068 PLPGAGILPLPPLPGAGIPPPPPLPGAAIPPPPP 1101 Score = 34.7 bits (76), Expect = 2.6 Identities = 15/38 (39%), Positives = 16/38 (42%) Frame = +1 Query: 454 PPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PPP + PPPP PPPPPL PP Sbjct: 1042 PPPLQGTEMLPPPPPPLPGAGIPPPPPLPGAGILPLPP 1079 Score = 34.3 bits (75), Expect = 3.5 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 1/47 (2%) Frame = +2 Query: 431 PPXGXX-XPPPPXXXXKXXXPPPXXXGXXXPPPPXPXXXXXXXXPPP 568 PP PPPP PPP G PPPP P PPP Sbjct: 1111 PPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPP-PLPGAGIPPPPP 1156 Score = 34.3 bits (75), Expect = 3.5 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 1/47 (2%) Frame = +2 Query: 431 PPXGXX-XPPPPXXXXKXXXPPPXXXGXXXPPPPXPXXXXXXXXPPP 568 PP PPPP PPP G PPPP P PPP Sbjct: 1122 PPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPP-PLPGAGIPPPPP 1167 Score = 34.3 bits (75), Expect = 3.5 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 1/47 (2%) Frame = +2 Query: 431 PPXGXX-XPPPPXXXXKXXXPPPXXXGXXXPPPPXPXXXXXXXXPPP 568 PP PPPP PPP G PPPP P PPP Sbjct: 1133 PPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPP-PLPGAGIPPPPP 1178 Score = 34.3 bits (75), Expect = 3.5 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 1/47 (2%) Frame = +2 Query: 431 PPXGXX-XPPPPXXXXKXXXPPPXXXGXXXPPPPXPXXXXXXXXPPP 568 PP PPPP PPP G PPPP P PPP Sbjct: 1144 PPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPP-PLPGAGIPPPPP 1189 Score = 34.3 bits (75), Expect = 3.5 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 1/47 (2%) Frame = +2 Query: 431 PPXGXX-XPPPPXXXXKXXXPPPXXXGXXXPPPPXPXXXXXXXXPPP 568 PP PPPP PPP G PPPP P PPP Sbjct: 1155 PPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPP-PLPGAGIPPPPP 1200 Score = 34.3 bits (75), Expect = 3.5 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 1/47 (2%) Frame = +2 Query: 431 PPXGXX-XPPPPXXXXKXXXPPPXXXGXXXPPPPXPXXXXXXXXPPP 568 PP PPPP PPP G PPPP P PPP Sbjct: 1166 PPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPP-PLPGAGIPPPPP 1211 Score = 34.3 bits (75), Expect = 3.5 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 1/47 (2%) Frame = +2 Query: 431 PPXGXX-XPPPPXXXXKXXXPPPXXXGXXXPPPPXPXXXXXXXXPPP 568 PP PPPP PPP G PPPP P PPP Sbjct: 1177 PPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPP-PLPGAGIPPPPP 1222 Score = 34.3 bits (75), Expect = 3.5 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 1/47 (2%) Frame = +2 Query: 431 PPXGXX-XPPPPXXXXKXXXPPPXXXGXXXPPPPXPXXXXXXXXPPP 568 PP PPPP PPP G PPPP P PPP Sbjct: 1188 PPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPP-PLPGAGIPPPPP 1233 Score = 34.3 bits (75), Expect = 3.5 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 1/47 (2%) Frame = +2 Query: 431 PPXGXX-XPPPPXXXXKXXXPPPXXXGXXXPPPPXPXXXXXXXXPPP 568 PP PPPP PPP G PPPP P PPP Sbjct: 1199 PPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPP-PLPGAGIPPPPP 1244 Score = 34.3 bits (75), Expect = 3.5 Identities = 23/80 (28%), Positives = 23/80 (28%), Gaps = 3/80 (3%) Frame = +2 Query: 338 PXXGGGXPPXXXXXXXXXXXXXXXFXKXXXXPPX--GXXXPPPPXXXXKXXXPPPXXXGX 511 P G G PP PP G PPPP PPP G Sbjct: 1211 PLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGVGIPPPPPLPGAGIPPPPPLPGA 1270 Query: 512 XXP-PPPXPXXXXXXXXPPP 568 P PPP P P P Sbjct: 1271 GIPPPPPLPGAGIPPPPPLP 1290 Score = 33.9 bits (74), Expect = 4.6 Identities = 15/45 (33%), Positives = 15/45 (33%) Frame = +2 Query: 434 PXGXXXPPPPXXXXKXXXPPPXXXGXXXPPPPXPXXXXXXXXPPP 568 P PPPP PPP PPPP P P P Sbjct: 1092 PGAAIPPPPPLPGAGIPLPPPLPGAGIPPPPPLPGAGIPPPPPLP 1136 Score = 33.9 bits (74), Expect = 4.6 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 1/47 (2%) Frame = +2 Query: 431 PPXGXX-XPPPPXXXXKXXXPPPXXXGXXXPPPPXPXXXXXXXXPPP 568 PP PPPP PPP G PPPP P PPP Sbjct: 1276 PPLPGAGIPPPPPLPRVGIPPPPPLPGAGIPPPP-PLPGAGIPPPPP 1321 Score = 33.9 bits (74), Expect = 4.6 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 1/47 (2%) Frame = +2 Query: 431 PPXGXX-XPPPPXXXXKXXXPPPXXXGXXXPPPPXPXXXXXXXXPPP 568 PP PPPP PPP G PPPP P PPP Sbjct: 1309 PPLPGAGIPPPPPLPGVGIPPPPPLPGVGIPPPP-PLPGAGIPPPPP 1354 >UniRef50_A6UHC7 Cluster: Outer membrane autotransporter barrel domain; n=1; Sinorhizobium medicae WSM419|Rep: Outer membrane autotransporter barrel domain - Sinorhizobium medicae WSM419 Length = 864 Score = 48.4 bits (110), Expect = 2e-04 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP SPPPP PPPPP P PP Sbjct: 487 PPPPPPPPPPPPPPPPPSPPPPPPPSPPPPPPPPPPPPPPPPPPP 531 Score = 46.4 bits (105), Expect = 8e-04 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 488 PPPPPPPPPPPPPPPPSPPPPPPPSPPPPPPPPPPPPPPPPPPPP 532 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPPP PPPP PPPPPP PP Sbjct: 489 PPPPPPPPPPPPPPPSPPPPPPPSPPPPPPPPPPPPPPPPPPPPPP 534 Score = 45.2 bits (102), Expect = 0.002 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPPP PPPP PPPPPP PP Sbjct: 486 PPPPPPPPPPPPPPPPPPSPPPPPPPSPPPPPPPPPPPPPPPPPPP 531 Score = 40.7 bits (91), Expect = 0.040 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = +1 Query: 439 GXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 G PPPPP PPPP PPPP P PP Sbjct: 482 GGVSPPPPPPPPPPPPPPPPPPSPPPPPPPSPPPPPPPPPPPP 524 Score = 39.9 bits (89), Expect = 0.070 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = +1 Query: 439 GXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 G PPPPP PPPP PPP PP PP Sbjct: 483 GVSPPPPPPPPPPPPPPPPPPSPPPPPPPSPPPPPPPPPPPPP 525 Score = 39.9 bits (89), Expect = 0.070 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 PP PPPP PPPP PPPPP P Sbjct: 502 PPSPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPGP 536 Score = 34.7 bits (76), Expect = 2.6 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 PP PPPPP PPPP PPP P P Sbjct: 510 PPSPPPPPPPPPPPPPPPPPPP------PPPGPSP 538 >UniRef50_Q4QE97 Cluster: Formin, putative; n=3; Leishmania|Rep: Formin, putative - Leishmania major Length = 1300 Score = 48.4 bits (110), Expect = 2e-04 Identities = 24/68 (35%), Positives = 24/68 (35%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXX 560 PP GG G G PP PPP PPPP PPPPP P Sbjct: 630 PPPPGGSGVSSPPAGLPPPHPPGLPPPTGGPKQPPPPPPPPPPPPPPPPPPPRMGNGPPP 689 Query: 561 PPXXXXXG 584 PP G Sbjct: 690 PPGKGASG 697 Score = 34.3 bits (75), Expect = 3.5 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 3/42 (7%) Frame = +3 Query: 450 PPPPPXXXXXXSPP---PPXXGGGXPPPPPXPXXXAXXXXPP 566 PPPPP SPP PP G PPP P PP Sbjct: 629 PPPPPGGSGVSSPPAGLPPPHPPGLPPPTGGPKQPPPPPPPP 670 Score = 33.9 bits (74), Expect = 4.6 Identities = 23/66 (34%), Positives = 23/66 (34%), Gaps = 14/66 (21%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXXPPPPPXXXXXXS--------PPPPXXGG---GXPP-- 521 PP G PP G PPPPP PPPP GG PP Sbjct: 585 PPPPASSATAPTAVGPAPPPGLPPPPPPPGYKAGGSASSAPLPPPPPPPGGSGVSSPPAG 644 Query: 522 -PPPXP 536 PPP P Sbjct: 645 LPPPHP 650 Score = 33.5 bits (73), Expect = 6.1 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -3 Query: 360 GXPPPXXGXKXXXXXXPPXKKXPPPPP 280 G PPP G K PP PPPPP Sbjct: 652 GLPPPTGGPKQPPPPPPPPPPPPPPPP 678 Score = 33.1 bits (72), Expect = 8.1 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPP 527 PP PPPPP PPPP G P Sbjct: 670 PPPPPPPPPPPPRMGNGPPPPPGKGASGAAAP 701 >UniRef50_A6R957 Cluster: Cytokinesis protein sepA; n=1; Ajellomyces capsulatus NAm1|Rep: Cytokinesis protein sepA - Ajellomyces capsulatus NAm1 Length = 1670 Score = 48.4 bits (110), Expect = 2e-04 Identities = 19/39 (48%), Positives = 19/39 (48%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PPPPP PPPP G G PPPPP P PP Sbjct: 956 PPPPPPGVGGPPPPPPPPGMGGPPPPPPPPGAGPGGPPP 994 Score = 48.0 bits (109), Expect = 3e-04 Identities = 19/39 (48%), Positives = 19/39 (48%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PPPPP PPPP GG PPPPP P PP Sbjct: 957 PPPPPGVGGPPPPPPPPGMGGPPPPPPPPGAGPGGPPPP 995 Score = 45.2 bits (102), Expect = 0.002 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PPPPP PPPP G PPPPPP PP Sbjct: 956 PPPPPPGVGGPPPPPPPPGMGGPPPPPPPPGAGPGGPPP 994 Score = 43.6 bits (98), Expect = 0.006 Identities = 19/39 (48%), Positives = 19/39 (48%), Gaps = 4/39 (10%) Frame = +1 Query: 430 PPXGXXXPPPPP----XXXKXXXPPPPXXGXXXPPPPPP 534 PP G PPPPP PPPP G PPPPPP Sbjct: 959 PPPGVGGPPPPPPPPGMGGPPPPPPPPGAGPGGPPPPPP 997 Score = 42.7 bits (96), Expect = 0.010 Identities = 19/50 (38%), Positives = 19/50 (38%) Frame = +3 Query: 435 PXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPPXXXXXG 584 P PPPP PPPP GG PPPPP PP G Sbjct: 953 PPPPPPPPPGVGGPPPPPPPPGMGGPPPPPPPPGAGPGGPPPPPPGASMG 1002 Score = 39.1 bits (87), Expect = 0.12 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 P PPPPP PPPP G PPPPPP PP Sbjct: 946 PEQAPLFPPPPP-------PPPPGVGGPPPPPPPPGMGGPPPPPPP 984 >UniRef50_A4R3R8 Cluster: Predicted protein; n=1; Magnaporthe grisea|Rep: Predicted protein - Magnaporthe grisea (Rice blast fungus) (Pyricularia grisea) Length = 464 Score = 48.4 bits (110), Expect = 2e-04 Identities = 27/64 (42%), Positives = 27/64 (42%), Gaps = 2/64 (3%) Frame = -1 Query: 530 GGGGGXSXPXXGGGGXXXXXXXGGGGGXXXPXGGXXXXXKXXPPPPPPGGXXXTP--XGG 357 GGG G S GGGG GGGGG GG PPPP GG P G Sbjct: 227 GGGSGGSADAGGGGGAGGSADAGGGGGGA---GGAAGGGAAAPPPPADGGAPPPPPADGA 283 Query: 356 XPPP 345 PPP Sbjct: 284 APPP 287 Score = 42.7 bits (96), Expect = 0.010 Identities = 23/63 (36%), Positives = 24/63 (38%) Frame = -1 Query: 533 GGGGGGXSXPXXGGGGXXXXXXXGGGGGXXXPXGGXXXXXKXXPPPPPPGGXXXTPXGGX 354 GGG GG + GGG GGGGG GG PPP G P G Sbjct: 227 GGGSGGSADAGGGGGAGGSADAGGGGGGAGGAAGGGAAAP---PPPADGGAPPPPPADGA 283 Query: 353 PPP 345 PP Sbjct: 284 APP 286 Score = 41.1 bits (92), Expect = 0.030 Identities = 26/74 (35%), Positives = 26/74 (35%) Frame = -1 Query: 566 GGXXAXXXXXRGGGGGGXSXPXXGGGGXXXXXXXGGGGGXXXPXGGXXXXXKXXPPPPPP 387 GG GGGG G S GGGG GG P G PPPPP Sbjct: 227 GGGSGGSADAGGGGGAGGSADAGGGGGGAGGAAGGGAAAPPPPADG------GAPPPPPA 280 Query: 386 GGXXXTPXGGXPPP 345 G P PPP Sbjct: 281 DGAAPPP----PPP 290 Score = 40.7 bits (91), Expect = 0.040 Identities = 21/47 (44%), Positives = 22/47 (46%) Frame = +3 Query: 390 GGGGGXXFXXXGXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPP 530 GGGGG G G PPPP +PPPP G PPPPP Sbjct: 249 GGGGGGA----GGAAGGGAAAPPPPADGG--APPPPPADGAAPPPPP 289 Score = 35.5 bits (78), Expect = 1.5 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +1 Query: 439 GXXXPPPPPXXXKXXXPPPPXXGXXXPPPPP 531 G PPP PPPP G PPPPP Sbjct: 260 GGGAAAPPPPADGGAPPPPPADGAAPPPPPP 290 Score = 34.7 bits (76), Expect = 2.6 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +1 Query: 439 GXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPP 534 G PPPP PPPP PPPPPP Sbjct: 261 GGAAAPPPPADG--GAPPPPPADGAAPPPPPP 290 Score = 33.1 bits (72), Expect = 8.1 Identities = 22/62 (35%), Positives = 22/62 (35%) Frame = -2 Query: 565 GGXXXXAXXXGXGGGGGXPPPXXGGGGXXFXXXXGGGGGXXPXGGXXPXFXKXXPPPPPR 386 GG A GGG GGGG GGGG GG PPPP Sbjct: 214 GGAANNADSGNNAGGGSGGSADAGGGGGAGGSADAGGGG-GGAGGAAGG-GAAAPPPPAD 271 Query: 385 GG 380 GG Sbjct: 272 GG 273 >UniRef50_P21997 Cluster: Sulfated surface glycoprotein 185 precursor; n=1; Volvox carteri|Rep: Sulfated surface glycoprotein 185 precursor - Volvox carteri Length = 485 Score = 48.4 bits (110), Expect = 2e-04 Identities = 20/45 (44%), Positives = 21/45 (46%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP SPPPP PPPPP P + PP Sbjct: 260 PPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPSPSPPRKPP 304 Score = 44.8 bits (101), Expect = 0.002 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPP 534 PP PPPPP PPPP PPPPPP Sbjct: 254 PPPSPSPPPPPPPPPPPPPPPPPSPPPPPPPPPPP 288 Score = 44.0 bits (99), Expect = 0.004 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPP 534 PP PPPPP PPPP PPPPPP Sbjct: 253 PPPPSPSPPPPPPPPPPPPPPPPPSPPPPPPPPPP 287 Score = 43.2 bits (97), Expect = 0.008 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PP PP PPPP PPPPP P PP Sbjct: 244 PPPSPRPPSPPPPSPSPPPPPPPPPPPPPPPPPSPPPPPPPPPPP 288 Score = 43.2 bits (97), Expect = 0.008 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 PP PPPPP PPPP PPPPP P Sbjct: 255 PPSPSPPPPPPPPPPPPPPPPPSPPPPPPPPPPPP 289 Score = 42.7 bits (96), Expect = 0.010 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 P PP PP SPPPP PPPPP P PP Sbjct: 235 PTASSRPPSPPPSPRPPSPPPPSPSPPPPPPPPPPPPPPPPPSPP 279 Score = 42.3 bits (95), Expect = 0.013 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +1 Query: 433 PXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 P PPPPP PPPP PPPPPP PP Sbjct: 260 PPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPSPSPPRKPP 304 Score = 41.9 bits (94), Expect = 0.017 Identities = 17/45 (37%), Positives = 18/45 (40%) Frame = +1 Query: 433 PXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 P PP PP + PPPP PPPPPP PP Sbjct: 235 PTASSRPPSPPPSPRPPSPPPPSPSPPPPPPPPPPPPPPPPPSPP 279 Score = 38.7 bits (86), Expect = 0.16 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPP PPPP PPP PP PP Sbjct: 245 PPSPRPPSPPPPSPSPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPP 290 Score = 38.3 bits (85), Expect = 0.21 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 PP PPPPP PPPP PP P P Sbjct: 274 PPPSPPPPPPPPPPPPPPPPPPSPSPPRKPPSPSP 308 Score = 37.9 bits (84), Expect = 0.28 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 PP PPPPP PPPP P PP P Sbjct: 272 PPPPPSPPPPPPPPPPPPPPPPPPSPSPPRKPPSP 306 Score = 36.3 bits (80), Expect = 0.86 Identities = 18/48 (37%), Positives = 18/48 (37%), Gaps = 3/48 (6%) Frame = +1 Query: 433 PXGXXXPPP---PPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 P PPP PP PPPP PPPPPP PP Sbjct: 248 PRPPSPPPPSPSPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPP 295 Score = 36.3 bits (80), Expect = 0.86 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +2 Query: 431 PPXGXXXPPPPXXXXKXXXPPPXXXGXXXPPPPXPXXXXXXXXPPP 568 PP PPPP PPP PPPP P P P Sbjct: 261 PPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPSPSPPRKPPSP 306 Score = 36.3 bits (80), Expect = 0.86 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +2 Query: 431 PPXGXXXPPPPXXXXKXXXPPPXXXGXXXPPPPXPXXXXXXXXPPP 568 PP PPPP PPP PPPP P P P Sbjct: 263 PPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPSPSPPRKPPSPSP 308 Score = 36.3 bits (80), Expect = 0.86 Identities = 16/45 (35%), Positives = 17/45 (37%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PP PP PPPP P PP P + PP Sbjct: 269 PPPPPPPPSPPPPPPPPPPPPPPPPPPSPSPPRKPPSPSPPVPPP 313 Score = 35.9 bits (79), Expect = 1.1 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +2 Query: 431 PPXGXXXPPPPXXXXKXXXPPPXXXGXXXPPPPXPXXXXXXXXPPP 568 PP P PP PPP PPPP P PPP Sbjct: 241 PPSPPPSPRPPSPPPPSPSPPPPPPPPPPPPPPPPPSPPPPPPPPP 286 Score = 35.1 bits (77), Expect = 2.0 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPP 534 PP PPP P PPPP PPPPPP Sbjct: 267 PPPPPPPPPPSPPPPPPPPPPPP------PPPPPP 295 >UniRef50_UPI0001552F36 Cluster: PREDICTED: similar to SH3 domain binding protein; n=2; Mus musculus|Rep: PREDICTED: similar to SH3 domain binding protein - Mus musculus Length = 455 Score = 48.0 bits (109), Expect = 3e-04 Identities = 18/35 (51%), Positives = 19/35 (54%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 PP PPPPP +PPPP G PPPPP P Sbjct: 6 PPPPPPPPPPPPPPPLGAPPPPPLGAPPPPPPPGP 40 Score = 44.4 bits (100), Expect = 0.003 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPP 531 PP PPPPP PPPP G PPPPP Sbjct: 5 PPPPPPPPPPPPPPPPLGAPPPPPLGAPPPPPPP 38 Score = 37.5 bits (83), Expect = 0.37 Identities = 16/29 (55%), Positives = 16/29 (55%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPPL 537 PPPPP PPPP G PPPPPL Sbjct: 4 PPPPPPPPPPPPPPPPPLGA---PPPPPL 29 Score = 35.9 bits (79), Expect = 1.1 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPPP 530 P PPP PPPP G PPPPP Sbjct: 2 PVPPPPPPPPPPPPPPPPPLGAPPPPP 28 Score = 34.3 bits (75), Expect = 3.5 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPP 531 P PPP PPPP PPPPP Sbjct: 2 PVPPPPPPPPPPPPPPPPPLGAPPPPP 28 >UniRef50_Q8L685 Cluster: Pherophorin-dz1 protein precursor; n=1; Volvox carteri f. nagariensis|Rep: Pherophorin-dz1 protein precursor - Volvox carteri f. nagariensis Length = 1009 Score = 48.0 bits (109), Expect = 3e-04 Identities = 20/46 (43%), Positives = 20/46 (43%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPPP PPPP PPPPPPL PP Sbjct: 640 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPP 685 Score = 47.6 bits (108), Expect = 4e-04 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP SPPPP PPPPP P PP Sbjct: 661 PPPPPPPPPPPPPPLPPSPPPPPPPPPPPPPPPPPPPPPPPPHPP 705 Score = 46.4 bits (105), Expect = 8e-04 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 652 PPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPPPPPPPPPPPPP 696 Score = 46.4 bits (105), Expect = 8e-04 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 653 PPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPPPPPPPPPPPPPP 697 Score = 46.0 bits (104), Expect = 0.001 Identities = 19/46 (41%), Positives = 20/46 (43%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPPP PPPP PPPPPP + PP Sbjct: 637 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPP 682 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 224 PPPPSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPP 268 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 236 PPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 280 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 238 PPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 282 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 241 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 285 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 242 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 286 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 243 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 287 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 244 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 288 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 245 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 289 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 246 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 290 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 247 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 291 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 248 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 292 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 249 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 293 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 250 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 294 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 251 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 295 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 252 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 296 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 253 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 297 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 254 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 298 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 255 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 299 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 256 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 300 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 257 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 301 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 258 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 302 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 259 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 303 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 260 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 304 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 261 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 305 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 262 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 306 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 263 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 307 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 264 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 308 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 265 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 309 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 266 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 310 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 267 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 311 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 268 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 312 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 269 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 313 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 270 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 314 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 271 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 315 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 272 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 316 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 273 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 317 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 274 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 318 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 275 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 319 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 276 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 320 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 277 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 321 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 278 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 322 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 279 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 323 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 280 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 324 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 281 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 325 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 282 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 326 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 283 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 327 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 284 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 328 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 285 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 329 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 286 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 330 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 287 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 331 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 288 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 332 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 289 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 333 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 290 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 334 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 291 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 335 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 292 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 336 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 293 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 337 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 294 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 338 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 295 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 339 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 296 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 340 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 297 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 341 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 298 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 342 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 299 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 343 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 300 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 344 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 301 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 345 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 302 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 346 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 303 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 347 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 304 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 348 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 305 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 349 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 306 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 350 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 307 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 351 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 308 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 352 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 309 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 353 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 310 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 354 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 311 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 355 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 312 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 356 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 313 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 357 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 314 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 358 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 315 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 359 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 316 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 360 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 317 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 361 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 318 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 362 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 319 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 363 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 320 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 364 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 321 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 365 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 322 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 366 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 323 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 367 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 324 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 368 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 325 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 369 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 326 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 370 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 327 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 371 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 328 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 372 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 329 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 373 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 330 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 374 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 331 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 375 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 332 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 376 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 333 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 377 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 334 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 378 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 335 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 379 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 336 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 380 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 337 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 381 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 338 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 382 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 339 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 383 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 340 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 384 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 341 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 385 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 342 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 386 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 343 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 387 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 344 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 388 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 345 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 389 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 346 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 390 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 347 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 391 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 348 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 392 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 349 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 393 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 350 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 394 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 351 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 395 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 352 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 396 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 353 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 397 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 354 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 398 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 355 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 399 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 356 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 400 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 357 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 401 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 358 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 402 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 359 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 403 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 360 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 404 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 361 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 405 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 362 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 406 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 363 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 407 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 364 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 408 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 365 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 409 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 366 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 410 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 367 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 411 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 368 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 412 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 369 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 413 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 370 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 414 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 371 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 415 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 372 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 416 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 373 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 417 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 374 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 418 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 375 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 419 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 376 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 420 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 377 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 421 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 378 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 422 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 379 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 423 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 380 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 424 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 381 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 425 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 382 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 426 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 383 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 427 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 384 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 428 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 385 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 429 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 386 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 430 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 387 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 431 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 388 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 432 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 389 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 433 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 390 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 434 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 391 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 435 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 392 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 436 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 393 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 437 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 394 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 438 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 395 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 439 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 396 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 440 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 397 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 441 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 398 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 442 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 399 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 443 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 400 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 444 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 401 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 445 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 402 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 446 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 403 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 447 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 404 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 448 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 405 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 449 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 406 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 450 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 407 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 451 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 408 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 452 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 409 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 453 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 410 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 454 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 411 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 455 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 412 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 456 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 413 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 457 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 414 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 458 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 415 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 459 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 416 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 460 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 417 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 461 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 418 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 462 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 419 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 463 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 420 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 464 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 421 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 465 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 422 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 466 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 423 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 467 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 424 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 468 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 425 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 469 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 426 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 470 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 427 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 471 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 428 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 472 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 429 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 473 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 430 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 474 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 431 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 475 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 432 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 476 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 433 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 477 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 434 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 478 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 435 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 479 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 436 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 480 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 437 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 481 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 438 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 482 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 439 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 483 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 440 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 484 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 441 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 485 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 442 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 486 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 443 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 487 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 444 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 488 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 445 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 489 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 446 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 490 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 447 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 491 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 448 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 492 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 449 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 493 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 450 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 494 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 451 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 495 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 452 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 496 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 453 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 497 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 454 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 498 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 455 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 499 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 456 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 500 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 457 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 501 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 458 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 502 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 459 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 503 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 460 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 504 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 461 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 505 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 462 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 506 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 463 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 507 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 508 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 465 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 509 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 466 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 510 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 467 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 511 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 468 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 512 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 469 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 513 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 470 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 514 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 471 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 515 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 472 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 516 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 473 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 517 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 474 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 518 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 475 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 519 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 476 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 520 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 477 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 521 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 478 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 522 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 479 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 523 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 480 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 524 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 481 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 525 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 482 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 526 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 483 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 527 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 484 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 528 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 485 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 529 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 486 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 530 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 487 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 531 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 488 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 532 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 489 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 533 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 490 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 534 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 491 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 535 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 492 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 536 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 493 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 537 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 494 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 538 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 495 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 539 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 496 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 540 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 497 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 541 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 498 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 542 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 499 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 543 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 500 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 544 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 501 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 545 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 502 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 546 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 503 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 547 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 504 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 548 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 505 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 549 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 506 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 550 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 507 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 551 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 508 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 552 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 509 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 553 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 510 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 554 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 511 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 555 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 512 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 556 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 513 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 557 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 514 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 558 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 515 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 559 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 516 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 560 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 517 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 561 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 518 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 562 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 519 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 563 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 520 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 564 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 521 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 565 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 522 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 566 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 523 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 567 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 524 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 568 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 525 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 569 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 526 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 570 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 527 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 571 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 528 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 572 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 529 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 573 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 530 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 574 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 531 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 575 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 532 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 576 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 533 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 577 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 534 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 578 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 535 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 579 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 536 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 580 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 537 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 581 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 538 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 582 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 539 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 583 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 540 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 584 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 541 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 585 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 542 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 586 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 543 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 587 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 544 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 588 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 545 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 589 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 546 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 590 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 547 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 591 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 548 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 592 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 549 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 593 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 550 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 594 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 551 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 595 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 552 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 596 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 553 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 597 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 554 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 598 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 555 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 599 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 556 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 600 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 557 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 601 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 558 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 602 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 559 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 603 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 560 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 604 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 561 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 605 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 562 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 606 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 563 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 607 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 564 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 608 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 565 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 609 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 566 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 610 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 567 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 611 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 568 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 612 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 569 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 613 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 570 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 614 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 571 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 615 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 572 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 616 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 573 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 617 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 574 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 618 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 575 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 619 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 576 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 620 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 577 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 621 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 578 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 622 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 579 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 623 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 580 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 624 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 581 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 625 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 582 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 626 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 583 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 627 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 584 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 628 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 585 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 629 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 586 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 630 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 587 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 631 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 588 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 632 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 589 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 633 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 590 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 634 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 591 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 635 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 592 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 636 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 593 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 637 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 594 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 638 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 595 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 639 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 596 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 640 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 597 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 641 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 598 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 642 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 599 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 643 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 600 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 644 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 601 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 645 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 602 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 646 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 603 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 647 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 604 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 648 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 605 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 649 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 606 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 650 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 607 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 651 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 608 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 652 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 609 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 653 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 610 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 654 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 611 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 655 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 612 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 656 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 613 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 657 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 614 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 658 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 615 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 659 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 616 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 660 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 617 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 661 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 618 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 662 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 619 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 663 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 620 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 664 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 621 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 665 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 622 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 666 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 623 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 667 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 624 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 668 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 625 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 669 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 626 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 670 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 627 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 671 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 628 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 672 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 629 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 673 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 630 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 674 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 633 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPP 677 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 636 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPP 680 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 639 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPP 683 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 642 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPPP 686 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 662 PPPPPPPPPPPPPLPPSPPPPPPPPPPPPPPPPPPPPPPPPHPPP 706 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 663 PPPPPPPPPPPPLPPSPPPPPPPPPPPPPPPPPPPPPPPPHPPPP 707 Score = 45.2 bits (102), Expect = 0.002 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPPP PPPP PPPPPP PP Sbjct: 632 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPP 677 Score = 45.2 bits (102), Expect = 0.002 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPPP PPPP PPPPPP PP Sbjct: 635 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPP 680 Score = 45.2 bits (102), Expect = 0.002 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPPP PPPP PPPPPP PP Sbjct: 638 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPP 683 Score = 45.2 bits (102), Expect = 0.002 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPPP PPPP PPPPPP PP Sbjct: 651 PPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPPPPPPPPPPPPP 696 Score = 44.8 bits (101), Expect = 0.002 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPPP PPPP PPPPPP PP Sbjct: 660 PPPPPPPPPPPPPPPLPPSPPPPPPPPPPPPPPPPPPPPPPPPHPP 705 Score = 44.4 bits (100), Expect = 0.003 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPP SPPPP PPPPP P PP Sbjct: 218 PPLPPSPPPPSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPP 262 Score = 44.4 bits (100), Expect = 0.003 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPPP PPPP PPPPPP PP Sbjct: 237 PPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 282 Score = 44.4 bits (100), Expect = 0.003 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPPP PPPP PPPPPP PP Sbjct: 650 PPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPPPPPPPPPPPP 695 Score = 43.2 bits (97), Expect = 0.008 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPP PPPP PPPPP P PP Sbjct: 225 PPPSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 269 Score = 42.3 bits (95), Expect = 0.013 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +1 Query: 433 PXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 P PPPPP PPPP PPPPPP PP Sbjct: 224 PPPPSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPP 268 Score = 42.3 bits (95), Expect = 0.013 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPP PPPP PPPPP P PP Sbjct: 229 PPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 273 Score = 42.3 bits (95), Expect = 0.013 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PP PP PPPP PPPPP P PP Sbjct: 232 PPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 276 Score = 42.3 bits (95), Expect = 0.013 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PP PP P PP Sbjct: 648 PPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPPPPPPPPP 692 Score = 41.9 bits (94), Expect = 0.017 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PP PP PPPP PPPPPP PP Sbjct: 226 PPSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 271 Score = 41.9 bits (94), Expect = 0.017 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPPP PPPP PP PPP PP Sbjct: 647 PPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPPPPPPPPP 692 Score = 41.9 bits (94), Expect = 0.017 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPPP PPPP PPPPP PP Sbjct: 649 PPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPPPPPPPPPPP 694 Score = 41.9 bits (94), Expect = 0.017 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPPP PP P PPPPPP PP Sbjct: 657 PPPPPPPPPPPPPPPPPPLPPSPPPPPPPPPPPPPPPPPPPPPPPP 702 Score = 41.9 bits (94), Expect = 0.017 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPPP PPPP P PPPP PP Sbjct: 673 PPLPPSPPPPPPPPPPPPPPPPPPPPPPPPHPPPPSPPPLVPALPP 718 Score = 41.5 bits (93), Expect = 0.023 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPP PPPP PPPPP P PP Sbjct: 230 PPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 274 Score = 41.5 bits (93), Expect = 0.023 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPP P PPPP PPPPP P PP Sbjct: 231 PPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 275 Score = 41.5 bits (93), Expect = 0.023 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPP P PPPP PPPPP P PP Sbjct: 666 PPPPPPPPPLPPSPPPPPPPPPPPPPPPPPPPPPPPPHPPPPSPP 710 Score = 41.5 bits (93), Expect = 0.023 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PP PP PPPP PPPPP P PP Sbjct: 667 PPPPPPPPLPPSPPPPPPPPPPPPPPPPPPPPPPPPHPPPPSPPP 711 Score = 41.1 bits (92), Expect = 0.030 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPP PPPP PPPPPP PP Sbjct: 217 PPPLPPSPPPPSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPP 262 Score = 41.1 bits (92), Expect = 0.030 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPP P PPPP PPPPPP PP Sbjct: 665 PPPPPPPPPPLPPSPPPPPPPPPPPPPPPPPPPPPPPPHPPPPSPP 710 Score = 40.7 bits (91), Expect = 0.040 Identities = 21/48 (43%), Positives = 21/48 (43%) Frame = +3 Query: 423 GXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 G PP PPPPP SPPPP PPPPP P PP Sbjct: 206 GYNPPPPSPPPPPP---LPPSPPPP----SPPPPPPSPPPPLPPPPPP 246 Score = 40.3 bits (90), Expect = 0.053 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPP P SPPPP P PPP P PP Sbjct: 211 PPSPPPPPPLPPSPPPPSPPPPPPSPPPPLPPPPPPPPPPPPPPP 255 Score = 38.7 bits (86), Expect = 0.16 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPP P PPPP P PPPP PP Sbjct: 210 PPPSPPPPPPLPPSPPPPSPPPPPPSPPPPLPPPPPPPPPPPPPPP 255 Score = 38.7 bits (86), Expect = 0.16 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PP PP PP P PPPPPP PP Sbjct: 214 PPPPPPLPPSPPPPSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPP 259 Score = 38.7 bits (86), Expect = 0.16 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPP PPP PPPPPP PP Sbjct: 216 PPPPLPPSPPPPSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPP 261 Score = 37.9 bits (84), Expect = 0.28 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP P PPP P PP PPPPPP PP Sbjct: 215 PPPPPLPPSPPPPSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPP 260 Score = 37.5 bits (83), Expect = 0.37 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +1 Query: 433 PXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 P PPPPP PPPP P PPPPL PP Sbjct: 209 PPPPSPPPPPPLPPS---PPPPSPPPPPPSPPPPLPPPPPPPPPP 250 Score = 36.3 bits (80), Expect = 0.86 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +2 Query: 431 PPXGXXXPPPPXXXXKXXXPPPXXXGXXXPPPPXPXXXXXXXXPPP 568 PP PPPP PPP PPPP P P P Sbjct: 634 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSP 679 Score = 36.3 bits (80), Expect = 0.86 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +2 Query: 431 PPXGXXXPPPPXXXXKXXXPPPXXXGXXXPPPPXPXXXXXXXXPPP 568 PP PPPP PPP PPPP P P P Sbjct: 664 PPPPPPPPPPPLPPSPPPPPPPPPPPPPPPPPPPPPPPPHPPPPSP 709 Score = 35.5 bits (78), Expect = 1.5 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +2 Query: 431 PPXGXXXPPPPXXXXKXXXPPPXXXGXXXPPPPXPXXXXXXXXPPP 568 PP PPPP PPP PPPP P PPP Sbjct: 631 PPPPPPPPPPPPPPPPPPPPPPPP--PPPPPPPPPPPPPPPPPPPP 674 Score = 34.3 bits (75), Expect = 3.5 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +2 Query: 431 PPXGXXXPPPPXXXXKXXXPPPXXXGXXXPPPPXPXXXXXXXXPPP 568 PP PPPP PPP PPPP P PPP Sbjct: 659 PPPPPPPPPPP------PPPPPLPPSPPPPPPPPPPPPPPPPPPPP 698 >UniRef50_Q9VY31 Cluster: CG9411-PA; n=2; Sophophora|Rep: CG9411-PA - Drosophila melanogaster (Fruit fly) Length = 993 Score = 48.0 bits (109), Expect = 3e-04 Identities = 18/34 (52%), Positives = 18/34 (52%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPP 531 PP G PPPPP PPPP G PPPPP Sbjct: 439 PPSGNYGPPPPPPSGNYGPPPPPPSGNYGPPPPP 472 Score = 45.6 bits (103), Expect = 0.001 Identities = 17/32 (53%), Positives = 17/32 (53%) Frame = +1 Query: 439 GXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPP 534 G PPPPP PPPP G PPPPPP Sbjct: 431 GHSGPPPPPPSGNYGPPPPPPSGNYGPPPPPP 462 Score = 44.4 bits (100), Expect = 0.003 Identities = 17/33 (51%), Positives = 17/33 (51%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPP 530 PP G PPPP PPPP G PPPPP Sbjct: 450 PPSGNYGPPPPPPSGNYGPPPPPSGNYGPPPPP 482 Score = 43.2 bits (97), Expect = 0.008 Identities = 18/34 (52%), Positives = 18/34 (52%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPP 531 PP G PPPPP PPPP G PPPPP Sbjct: 461 PPSGNYGPPPPPSGN--YGPPPPPSGNYGPPPPP 492 Score = 40.3 bits (90), Expect = 0.053 Identities = 17/33 (51%), Positives = 17/33 (51%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPP 528 PP G PPPPP PPPP G PPPP Sbjct: 471 PPSGNYGPPPPPSGN--YGPPPPPSGNYGPPPP 501 Score = 34.7 bits (76), Expect = 2.6 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPPXXXXXG 584 PPPPP PPPP G P PP P PP G Sbjct: 435 PPPPPPSGNYGPPPPPPSGNYGP--PPPPPSGNYGPPPPPSGNYG 477 Score = 33.5 bits (73), Expect = 6.1 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 439 GXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPP 534 G PPPPP PPP PPPPP Sbjct: 641 GPPGPPPPPEPQYLPPPPPLANVRPLGPPPPP 672 Score = 33.1 bits (72), Expect = 8.1 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 P PPPP PP P G PPP P P Sbjct: 123 PAQQYGPPPPKPAPQYGPPPQPAPQYGPPPPKPAP 157 Score = 33.1 bits (72), Expect = 8.1 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -3 Query: 363 GGXPPPXXGXKXXXXXXPPXKKXPPPPPXGGXGXP 259 G PPP G P PPPPP G G P Sbjct: 445 GPPPPPPSGNYGPPPPPPSGNYGPPPPPSGNYGPP 479 >UniRef50_Q6C9I8 Cluster: Similar to sp|P41832 Saccharomyces cerevisiae YNL271c BNI1 regulator of budding; n=1; Yarrowia lipolytica|Rep: Similar to sp|P41832 Saccharomyces cerevisiae YNL271c BNI1 regulator of budding - Yarrowia lipolytica (Candida lipolytica) Length = 1851 Score = 48.0 bits (109), Expect = 3e-04 Identities = 25/67 (37%), Positives = 25/67 (37%), Gaps = 5/67 (7%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXXPP-----PPPXXXXXXSPPPPXXGGGXPPPPPXPXXX 545 PP GG G PP PP PPP PPP GG PPPPP P Sbjct: 1052 PPMFTGGPPPMFTGGPPPPPPPPPPGFTGGPPPPGFTGGPPPPGFTGGPPPPPPPPPLPP 1111 Query: 546 AXXXXPP 566 PP Sbjct: 1112 GFTGGPP 1118 Score = 46.4 bits (105), Expect = 8e-04 Identities = 21/48 (43%), Positives = 21/48 (43%) Frame = +3 Query: 423 GXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 G PP PPPPP PPP GG PPPPP P PP Sbjct: 1041 GGPPPP---PPPPPPPMFTGGPPPMFTGGPPPPPPPPPPGFTGGPPPP 1085 Score = 42.7 bits (96), Expect = 0.010 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP G PPPP PP G PPPPPPL PP Sbjct: 1074 PPPGFTGGPPPPGFTGGPPPPGFTGGPPPPPPPPPLPPGFTGGPPP 1119 Score = 35.1 bits (77), Expect = 2.0 Identities = 20/62 (32%), Positives = 21/62 (33%), Gaps = 1/62 (1%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXXPPPPPXXXXXXSPP-PPXXGGGXPPPPPXPXXXAXXX 557 PP GG G PP PP PP PP P G P P P P + Sbjct: 1084 PPGFTGGPPPPGFTGGPPPPPPPPPLPPGFTGGPPPPAPAFVAGATPSPSPSPQLPSGFE 1143 Query: 558 XP 563 P Sbjct: 1144 TP 1145 Score = 34.3 bits (75), Expect = 3.5 Identities = 24/64 (37%), Positives = 24/64 (37%), Gaps = 2/64 (3%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXX--PPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXX 554 PP GG G PP G PPPPP PP GG PPPP P A Sbjct: 1075 PPGFTGGPPPPGFTGGPPPPGFTGGPPPPPPPPPL---PPGFTGG---PPPPAPAFVAGA 1128 Query: 555 XXPP 566 P Sbjct: 1129 TPSP 1132 >UniRef50_Q0CQD0 Cluster: Predicted protein; n=1; Aspergillus terreus NIH2624|Rep: Predicted protein - Aspergillus terreus (strain NIH 2624) Length = 313 Score = 48.0 bits (109), Expect = 3e-04 Identities = 21/46 (45%), Positives = 21/46 (45%), Gaps = 1/46 (2%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPP-PXPXXXAXXXXPP 566 PP G PPPPP PPPP G PPPP P P PP Sbjct: 135 PPVGPPPPPPPPPPPPPPPPPPPPMAGPPPPPGPPPPHPPPPAGPP 180 Score = 44.4 bits (100), Expect = 0.003 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPP P A PP Sbjct: 145 PPPPPPPPPPPPPPMAGPPPPPGPPPPHPPPPAGPPPVAGPPVPP 189 Score = 41.1 bits (92), Expect = 0.030 Identities = 20/46 (43%), Positives = 20/46 (43%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPPP PPPP G PP PPP A PP Sbjct: 141 PPPPPPPPPPPP-----PPPPPPMAGPPPPPGPPPPHPPPPAGPPP 181 Score = 41.1 bits (92), Expect = 0.030 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXP 564 PP PPPPP PPP G P PPPP A P Sbjct: 142 PPPPPPPPPPPPPPPPPMAGPPPPPGPPPPHPPPPAGPPPVAGPP 186 Score = 39.9 bits (89), Expect = 0.070 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = +1 Query: 439 GXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 G PPPP PPPP PPPPPP PP Sbjct: 123 GRFMPPPPVLPGPPVGPPPPPPPPPPPPPPPPPPPPMAGPPPP 165 Score = 39.9 bits (89), Expect = 0.070 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 2/47 (4%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPP--PXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPP P G P PPP P PP Sbjct: 156 PPPMAGPPPPPGPPPPHPPPPAGPPPVAGPPVPPPHPPPAEPAPPPP 202 Score = 37.5 bits (83), Expect = 0.37 Identities = 19/47 (40%), Positives = 20/47 (42%) Frame = +3 Query: 423 GXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXP 563 G PP G PP PP + PPP G PPP P P A P Sbjct: 161 GPPPPPGPPPPHPP----PPAGPPPVAGPPVPPPHPPPAEPAPPPPP 203 Score = 37.5 bits (83), Expect = 0.37 Identities = 20/62 (32%), Positives = 21/62 (33%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXX 560 PP G G P G PPP +PPPP G P PPP Sbjct: 164 PPPGPPPPHPPPPAGPPPVAGPPVPPPHPPPAEPAPPPPPAPQGPPAPPPVEGPPPPKGP 223 Query: 561 PP 566 PP Sbjct: 224 PP 225 Score = 37.1 bits (82), Expect = 0.50 Identities = 16/46 (34%), Positives = 17/46 (36%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP P PPP PPP PP PPP+ PP Sbjct: 179 PPPVAGPPVPPPHPPPAEPAPPPPPAPQGPPAPPPVEGPPPPKGPP 224 Score = 37.1 bits (82), Expect = 0.50 Identities = 23/62 (37%), Positives = 23/62 (37%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXX 560 PP G G PP G PPPPP SPP P G PPP P Sbjct: 202 PPAPQGPPAPPPVEGPPPPKG--PPPPPH-----SPPGPPPAEGPPPPAKVPPPAPPVEG 254 Query: 561 PP 566 PP Sbjct: 255 PP 256 Score = 36.7 bits (81), Expect = 0.65 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 4/39 (10%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXP----PPPXXGXXXPPPPPP 534 PP PPPPP P PPP G PPP PP Sbjct: 155 PPPPMAGPPPPPGPPPPHPPPPAGPPPVAGPPVPPPHPP 193 Score = 36.3 bits (80), Expect = 0.86 Identities = 19/49 (38%), Positives = 20/49 (40%), Gaps = 4/49 (8%) Frame = +3 Query: 432 PPXGXX-PPPPPXXXXXXSPPP---PXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP +PPP P G PPPP P PP Sbjct: 192 PPPAEPAPPPPPAPQGPPAPPPVEGPPPPKGPPPPPHSPPGPPPAEGPP 240 Score = 35.9 bits (79), Expect = 1.1 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP P PP PPPP PPPPP P A PP Sbjct: 127 PPPPVLPGPPVGPPPPPPPPPP-----PPPPPPPPPPMAGPPPPP 166 Score = 35.1 bits (77), Expect = 2.0 Identities = 17/47 (36%), Positives = 17/47 (36%), Gaps = 1/47 (2%) Frame = +2 Query: 431 PPXGXXXPPPPXXXXKXXXPPPXXXGXXXPPPP-XPXXXXXXXXPPP 568 PP PPPP PPP PPPP P PPP Sbjct: 144 PPPPPPPPPPPPPPPMAGPPPPPGPPPPHPPPPAGPPPVAGPPVPPP 190 Score = 34.3 bits (75), Expect = 3.5 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 3/38 (7%) Frame = +1 Query: 430 PPXGXXXPPP---PPXXXKXXXPPPPXXGXXXPPPPPP 534 PP PPP PP K P PP G P PPP Sbjct: 226 PPHSPPGPPPAEGPPPPAKVPPPAPPVEGPPPPHSPPP 263 Score = 33.1 bits (72), Expect = 8.1 Identities = 18/49 (36%), Positives = 19/49 (38%), Gaps = 3/49 (6%) Frame = +1 Query: 430 PPXGXXXPPP---PPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPP PP PPPP PPP PP+ PP Sbjct: 217 PPPPKGPPPPPHSPPGPPPAEGPPPP---AKVPPPAPPVEGPPPPHSPP 262 >UniRef50_UPI0000D56EFA Cluster: PREDICTED: similar to Protein cappuccino; n=1; Tribolium castaneum|Rep: PREDICTED: similar to Protein cappuccino - Tribolium castaneum Length = 1011 Score = 47.6 bits (108), Expect = 4e-04 Identities = 20/43 (46%), Positives = 20/43 (46%) Frame = +3 Query: 435 PXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXP 563 P PPPPP PPPP G G PPPPP P A P Sbjct: 456 PTPPPPPPPPMPGIGAPPPPPMPGIGAPPPPPMPGIGAHPPPP 498 Score = 46.8 bits (106), Expect = 6e-04 Identities = 18/36 (50%), Positives = 19/36 (52%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPL 537 P G PPPPP PPPP G PPPPPP+ Sbjct: 498 PMPGIVGPPPPPMPGIGGPPPPPMPGTGPPPPPPPM 533 Score = 46.0 bits (104), Expect = 0.001 Identities = 20/46 (43%), Positives = 21/46 (45%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 P G PPPPP PPPP G PPPPPP+ PP Sbjct: 509 PMPGIGGPPPPPMPGTGPPPPPPPMGGV-PPPPPPMGGPVPLPPPP 553 Score = 44.8 bits (101), Expect = 0.002 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = +3 Query: 453 PPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PPPP PPPP G G PPPPP P PP Sbjct: 495 PPPPMPGIVGPPPPPMPGIGGPPPPPMPGTGPPPPPPP 532 Score = 43.2 bits (97), Expect = 0.008 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPP 531 P G PPPPP PPPP G PPPPP Sbjct: 476 PMPGIGAPPPPPMPGIGAHPPPPMPGIVGPPPPP 509 Score = 41.5 bits (93), Expect = 0.023 Identities = 16/29 (55%), Positives = 16/29 (55%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 PPPPP PPPP G G PPPP P Sbjct: 472 PPPPPMPGIGAPPPPPMPGIGAHPPPPMP 500 Score = 41.5 bits (93), Expect = 0.023 Identities = 16/29 (55%), Positives = 16/29 (55%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 PPPPP PPPP G PPPPP P Sbjct: 483 PPPPPMPGIGAHPPPPMPGIVGPPPPPMP 511 Score = 40.7 bits (91), Expect = 0.040 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PPPPP PPPP GG PPPP P PP Sbjct: 516 PPPPPMPGTGPPPPPPPMGG--VPPPPPPMGGPVPLPPP 552 Score = 39.9 bits (89), Expect = 0.070 Identities = 16/39 (41%), Positives = 17/39 (43%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PPPPP PPPP PPPPP+ PP Sbjct: 460 PPPPPPMPGIGAPPPPPMPGIGAPPPPPMPGIGAHPPPP 498 Score = 39.9 bits (89), Expect = 0.070 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 P G PPPP PPPP G PPPPP PP Sbjct: 487 PMPGIGAHPPPPMPGIVGPPPPPMPGIGGPPPPPMPGTGPPPPPPP 532 Score = 39.1 bits (87), Expect = 0.12 Identities = 18/38 (47%), Positives = 18/38 (47%), Gaps = 2/38 (5%) Frame = +3 Query: 423 GXXPPXGXX--PPPPPXXXXXXSPPPPXXGGGXPPPPP 530 G PP PPPPP PPPP GG P PPP Sbjct: 515 GPPPPPMPGTGPPPPPPPMGGVPPPPPPMGGPVPLPPP 552 Score = 37.9 bits (84), Expect = 0.28 Identities = 22/77 (28%), Positives = 22/77 (28%) Frame = +2 Query: 338 PXXGGGXPPXXXXXXXXXXXXXXXFXKXXXXPPXGXXXPPPPXXXXKXXXPPPXXXGXXX 517 P G PP P G PPPP PPP G Sbjct: 467 PGIGAPPPPPMPGIGAPPPPPMPGIGAHPPPPMPGIVGPPPPPMPGIGGPPPPPMPGTG- 525 Query: 518 PPPPXPXXXXXXXXPPP 568 PPPP P PPP Sbjct: 526 PPPPPPPMGGVPPPPPP 542 Score = 35.9 bits (79), Expect = 1.1 Identities = 15/29 (51%), Positives = 15/29 (51%), Gaps = 2/29 (6%) Frame = +1 Query: 451 PPPPPXXXK--XXXPPPPXXGXXXPPPPP 531 PPPPP PPPP G PPPPP Sbjct: 459 PPPPPPPMPGIGAPPPPPMPGIGAPPPPP 487 Score = 34.7 bits (76), Expect = 2.6 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXG 507 PP G PPPPP PPPP G Sbjct: 531 PPMGGVPPPPPPMGGPVPLPPPPAGG 556 Score = 34.3 bits (75), Expect = 3.5 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 2/36 (5%) Frame = +1 Query: 430 PPXGXX--XPPPPPXXXKXXXPPPPXXGXXXPPPPP 531 PP PPPPP PPPP G PPPP Sbjct: 463 PPPMPGIGAPPPPPMPGIGAPPPPPMPGIGAHPPPP 498 >UniRef50_Q2N5D9 Cluster: Autotransporter; n=1; Erythrobacter litoralis HTCC2594|Rep: Autotransporter - Erythrobacter litoralis (strain HTCC2594) Length = 1819 Score = 47.6 bits (108), Expect = 4e-04 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = +1 Query: 433 PXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 P G PPPPP PPPP PPPPPP A PP Sbjct: 1404 PTGTAPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPTPPPAPPPP 1448 Score = 45.2 bits (102), Expect = 0.002 Identities = 21/59 (35%), Positives = 21/59 (35%) Frame = +3 Query: 390 GGGGGXXFXXXGXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 G G G PP PPPPP PPPP PPP P P PP Sbjct: 1395 GNDVGLTLTPTGTAPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPTPPPAPPPPPPPPP 1453 Score = 42.7 bits (96), Expect = 0.010 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPPP PPPP PP PPP PP Sbjct: 1409 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPTPPPAPPPPPPPPPP 1454 Score = 41.5 bits (93), Expect = 0.023 Identities = 16/36 (44%), Positives = 17/36 (47%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPL 537 PP PPPPP P PP PPPPPP+ Sbjct: 1420 PPPPPPPPPPPPPPPPPPPPTPPPAPPPPPPPPPPI 1455 >UniRef50_P93797 Cluster: Pherophorin-S precursor; n=1; Volvox carteri|Rep: Pherophorin-S precursor - Volvox carteri Length = 599 Score = 47.6 bits (108), Expect = 4e-04 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP SPPPP PPPPP P PP Sbjct: 235 PPSPPPPPPPPPPSPPPSPPPPPPPPPPPPPPPPPPPPPPPSPPP 279 Score = 46.4 bits (105), Expect = 8e-04 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 249 PPPSPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPP 293 Score = 46.4 bits (105), Expect = 8e-04 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 250 PPSPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPP 294 Score = 46.0 bits (104), Expect = 0.001 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPPP PPPP PPPPPP PP Sbjct: 234 PPPSPPPPPPPPPPSPPPSPPPPPPPPPPPPPPPPPPPPPPPSPPP 279 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 253 PPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPP 297 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 254 PPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPPP 298 Score = 43.2 bits (97), Expect = 0.008 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP P PPP PPPP PPPPP P PP Sbjct: 226 PPPPPPPSPPPSPPPPPPPPPPSPPPSPPPPPPPPPPPPPPPPPP 270 Score = 43.2 bits (97), Expect = 0.008 Identities = 18/45 (40%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPP PPPP PPPPP P + PP Sbjct: 238 PPPPPPPPPPSPPPSPPPPPPPPPPPPPPPPPPPPPPPSPPPPPP 282 Score = 43.2 bits (97), Expect = 0.008 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 PP PPPPP PPPP PPPPP P Sbjct: 265 PPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPP 299 Score = 42.3 bits (95), Expect = 0.013 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPP P PPPP PPPPP P PP Sbjct: 239 PPPPPPPPPSPPPSPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPP 283 Score = 42.3 bits (95), Expect = 0.013 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PP PP PPPP PPPPP P PP Sbjct: 240 PPPPPPPPSPPPSPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPP 284 Score = 42.3 bits (95), Expect = 0.013 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP P PPP PPPP PPPPP P PP Sbjct: 241 PPPPPPPSPPPSPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPP 285 Score = 42.3 bits (95), Expect = 0.013 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPP P PPPP PPPPP P PP Sbjct: 243 PPPPPSPPPSPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPP 287 Score = 42.3 bits (95), Expect = 0.013 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPP PPPPP P PP Sbjct: 255 PPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPP 299 Score = 42.3 bits (95), Expect = 0.013 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PP P PPPPP P PP Sbjct: 256 PPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPP 300 Score = 42.3 bits (95), Expect = 0.013 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP P PP PPPPP P PP Sbjct: 257 PPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPPP 301 Score = 42.3 bits (95), Expect = 0.013 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPP PPPPP P PP Sbjct: 258 PPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPPPP 302 Score = 41.9 bits (94), Expect = 0.017 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPPP PPPP P PPPP PP Sbjct: 246 PPSPPPSPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPP 291 Score = 41.1 bits (92), Expect = 0.030 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = +3 Query: 435 PXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 P PPPPP PPPP PP PP P PP Sbjct: 223 PPSPPPPPPPSPPPSPPPPPPPPPPSPPPSPPPPPPPPPPPPPP 266 Score = 41.1 bits (92), Expect = 0.030 Identities = 16/36 (44%), Positives = 17/36 (47%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPL 537 PP P PPP PPPP PPPPPP+ Sbjct: 268 PPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPPPPV 303 Score = 40.7 bits (91), Expect = 0.040 Identities = 19/46 (41%), Positives = 19/46 (41%), Gaps = 1/46 (2%) Frame = +3 Query: 432 PPXGXXP-PPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP P PPPP SPPP PPPPP P PP Sbjct: 230 PPPSPPPSPPPPPPPPPPSPPPSPPPPPPPPPPPPPPPPPPPPPPP 275 Score = 40.3 bits (90), Expect = 0.053 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 2/47 (4%) Frame = +3 Query: 432 PPXGXXPPP--PPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPP PP PPPP PPPPP P PP Sbjct: 223 PPSPPPPPPPSPPPSPPPPPPPPPPSPPPSPPPPPPPPPPPPPPPPP 269 Score = 39.9 bits (89), Expect = 0.070 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPP P PP P PPPPP P PP Sbjct: 228 PPPPPSPPPSPPPPPPPPPPSPPPSPPPPPPPPPPPPPPPPPPPP 272 Score = 39.9 bits (89), Expect = 0.070 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP P PPP PPPP PPP P P PP Sbjct: 245 PPPSPPPSPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPP 289 Score = 39.5 bits (88), Expect = 0.093 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPP P PP P PPPPPP PP Sbjct: 227 PPPPPPSPPPSPPPPPPPPPPSPPPSPPPPPPPPPPPPPPPPPPPP 272 Score = 39.1 bits (87), Expect = 0.12 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +1 Query: 433 PXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 P PPPPP PPPP PPP PP PP Sbjct: 221 PLPPSPPPPPPPSPPPSPPPPPPPPPPSPPPSPPPPPPPPPPPPP 265 Score = 39.1 bits (87), Expect = 0.12 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PP PP PPPP PPPP P PP Sbjct: 244 PPPPSPPPSPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPP 288 Score = 38.7 bits (86), Expect = 0.16 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPP P PPPP PPPPPP PP Sbjct: 242 PPPPPPSPPPSPPPPPPPPPPPPPP-PPPPPPPPPSPPPPPPPPPP 286 Score = 36.7 bits (81), Expect = 0.65 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +3 Query: 453 PPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP P PPPP PPPPP P PP Sbjct: 218 PPSPLPPSPPPPPPPSPPPSPPPPPPPPPPSPPPSPPP 255 Score = 36.3 bits (80), Expect = 0.86 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 454 PPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP P PPPP PPPPPP PP Sbjct: 218 PPSPLPPSPPPPPPPSPPPSPPPPPPPPPPSPPPSPPP 255 Score = 33.9 bits (74), Expect = 4.6 Identities = 15/45 (33%), Positives = 15/45 (33%) Frame = +1 Query: 433 PXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 P P PPP P PP PP PPP PP Sbjct: 218 PPSPLPPSPPPPPPPSPPPSPPPPPPPPPPSPPPSPPPPPPPPPP 262 >UniRef50_Q55DK4 Cluster: Actin-binding protein; n=2; Dictyostelium discoideum|Rep: Actin-binding protein - Dictyostelium discoideum AX4 Length = 1561 Score = 47.6 bits (108), Expect = 4e-04 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP GG PPPPP P PP Sbjct: 1040 PPISGAPPPPPP------PPPPMKGGAGPPPPPPPPGKLGAKKPP 1078 Score = 41.1 bits (92), Expect = 0.030 Identities = 19/42 (45%), Positives = 19/42 (45%), Gaps = 3/42 (7%) Frame = +1 Query: 451 PPPPPX---XXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PPPPP PPPP G PPPPPP A PP Sbjct: 1037 PPPPPISGAPPPPPPPPPPMKGGAGPPPPPPPPGKLGAKKPP 1078 Score = 35.5 bits (78), Expect = 1.5 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +3 Query: 486 PPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PPPP G PPPPP P PP Sbjct: 1037 PPPPPISGAPPPPPPPPPPMKGGAGPP 1063 Score = 35.5 bits (78), Expect = 1.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +3 Query: 486 PPPPXXGGGXPPPPPXPXXXAXXXXPPXXXXXG 584 PPPP G PPPPP P PP G Sbjct: 1038 PPPPISGAPPPPPPPPPPMKGGAGPPPPPPPPG 1070 Score = 33.9 bits (74), Expect = 4.6 Identities = 20/54 (37%), Positives = 20/54 (37%), Gaps = 15/54 (27%) Frame = +1 Query: 451 PPPPPXXXK---------------XXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PPPPP K PPPP G PPPPPP A PP Sbjct: 1011 PPPPPISVKSPDDPNNAAPIVVAPIPPPPPPISGAPPPPPPPPPPMKGGAGPPP 1064 Score = 33.9 bits (74), Expect = 4.6 Identities = 17/50 (34%), Positives = 17/50 (34%), Gaps = 4/50 (8%) Frame = +1 Query: 430 PPXGXXXPPPP----PXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP P P P PPPP PPPPPP PP Sbjct: 1014 PPISVKSPDDPNNAAPIVVAPIPPPPPPISGAPPPPPPPPPPMKGGAGPP 1063 >UniRef50_Q1ZXK2 Cluster: Actin-binding protein; n=2; Dictyostelium discoideum|Rep: Actin-binding protein - Dictyostelium discoideum AX4 Length = 1074 Score = 47.6 bits (108), Expect = 4e-04 Identities = 24/49 (48%), Positives = 24/49 (48%), Gaps = 2/49 (4%) Frame = +3 Query: 396 GGGXXFXXXGXXPPX--GXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 GGG PP G PPPPP PPPP GGG PPPPP P Sbjct: 565 GGGAPPPSPSPPPPISGGGAPPPPPP------PPPPPSGGGAPPPPPPP 607 Score = 38.3 bits (85), Expect = 0.21 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXP 564 P G PPPPP PPP G PPPPPP A P Sbjct: 578 PISGGGAPPPPPPPP----PPPSGGGAPPPPPPPPPSGGKKAGAP 618 Score = 37.5 bits (83), Expect = 0.37 Identities = 22/53 (41%), Positives = 22/53 (41%), Gaps = 3/53 (5%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXXPPPPPXXXXXXSPPPPXXGG---GXPPPPP 530 PP GGG PP G PPPP PPPP GG G P PP Sbjct: 577 PPISGGGAPPPPPPPPPPPSGGGAPPPP-------PPPPPSGGKKAGAPGAPP 622 Score = 35.5 bits (78), Expect = 1.5 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = -1 Query: 440 PXGGXXXXXKXXPPPPPPGGXXXTPXGGXPPPXXGXK 330 P G PPPPPP G P PPP G K Sbjct: 578 PISGGGAPPPPPPPPPPPSGGGAPPPPPPPPPSGGKK 614 Score = 35.1 bits (77), Expect = 2.0 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 P G PPP P PPP G PPPPPP PP Sbjct: 562 PISGGGAPPPSPSP-----PPPISGGGAPPPPPPPPPPPSGGGAPP 602 Score = 33.5 bits (73), Expect = 6.1 Identities = 16/50 (32%), Positives = 16/50 (32%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPP 530 PP G PP PPPP PPPP GG P Sbjct: 569 PPPSPSPPPPISGGGAPPPPPPPPPPPSGGGAPPPPPPPPPSGGKKAGAP 618 >UniRef50_A2DC30 Cluster: Formin Homology 2 Domain containing protein; n=1; Trichomonas vaginalis G3|Rep: Formin Homology 2 Domain containing protein - Trichomonas vaginalis G3 Length = 1128 Score = 47.6 bits (108), Expect = 4e-04 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP G PPPPP PPPP PPPPP P A PP Sbjct: 600 PPVGAPPPPPPPP-----PPPPGVAAAAPPPPPPPPGLAGLVPPP 639 Score = 45.2 bits (102), Expect = 0.002 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PPPPP PPPP G PPPPP P PP Sbjct: 625 PPPPPPGLAGLVPPPPVGAGILPPPPPPPGAPGMPPPPP 663 Score = 42.7 bits (96), Expect = 0.010 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PPPPP PPPP PPPPPP PP Sbjct: 625 PPPPPPGLAGLVPPPPVGAGILPPPPPPPGAPGMPPPPP 663 Score = 41.1 bits (92), Expect = 0.030 Identities = 20/50 (40%), Positives = 20/50 (40%), Gaps = 2/50 (4%) Frame = +3 Query: 423 GXXPPXGXXPPPPPXXXXXXSPPPPXXGG--GXPPPPPXPXXXAXXXXPP 566 G PP PPPPP PPPP G G PPPP PP Sbjct: 603 GAPPPPPPPPPPPPGVAAAAPPPPPPPPGLAGLVPPPPVGAGILPPPPPP 652 Score = 41.1 bits (92), Expect = 0.030 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PPPPP PPP G G PPPP P PP Sbjct: 624 PPPPPPPGLAGLVPPPPVGAGILPPPPPPPGAPGMPPPP 662 Score = 39.1 bits (87), Expect = 0.12 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +3 Query: 441 GXXPPPPPXXXXXXSPPPPXXGGGXPPPPP 530 G PPPP PPPP G PPPPP Sbjct: 634 GLVPPPPVGAGILPPPPPPPGAPGMPPPPP 663 Score = 38.7 bits (86), Expect = 0.16 Identities = 17/46 (36%), Positives = 18/46 (39%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPP PPPP G PPPP+ PP Sbjct: 606 PPPPPPPPPPPGVAAAAPPPPPPPPGLAGLVPPPPVGAGILPPPPP 651 Score = 38.7 bits (86), Expect = 0.16 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPP 534 PP PPPP PPPP G PPPPP Sbjct: 629 PPGLAGLVPPPPVGAGILPPPPPPPGAPGMPPPPP 663 Score = 37.5 bits (83), Expect = 0.37 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 3/49 (6%) Frame = +1 Query: 430 PPXGXXX---PPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP G PPPPP PPP G PPPPP PP Sbjct: 614 PPPGVAAAAPPPPPPPPGLAGLVPPPPVGAGILPPPPPPPGAPGMPPPP 662 Score = 35.1 bits (77), Expect = 2.0 Identities = 19/45 (42%), Positives = 20/45 (44%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPPXXXXXG 584 PPPPP +PPPP PPPPP P A PP G Sbjct: 597 PPPPPVG----APPPP------PPPPPPPPGVAAAAPPPPPPPPG 631 Score = 33.9 bits (74), Expect = 4.6 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 PP +PPPP G PPPPP P Sbjct: 585 PPTDLAGAPPVAPPPPPVGAPPPPPPPPP 613 Score = 33.5 bits (73), Expect = 6.1 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 487 PPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PPPP PPPPPP A PP Sbjct: 598 PPPPVGAPPPPPPPPPPPPGVAAAAPP 624 Score = 33.1 bits (72), Expect = 8.1 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 PPP PPP G PPPPP P Sbjct: 584 PPPTDLAGAPPVAPPPPPVGAPPPPPPPP 612 Score = 33.1 bits (72), Expect = 8.1 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = +3 Query: 453 PPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPPXXXXXG 584 PPPP PPPP PPPPP A PP G Sbjct: 597 PPPPPVGAPPPPPPP------PPPPPGVAAAAPPPPPPPPGLAG 634 >UniRef50_UPI0000E48C31 Cluster: PREDICTED: hypothetical protein; n=1; Strongylocentrotus purpuratus|Rep: PREDICTED: hypothetical protein - Strongylocentrotus purpuratus Length = 191 Score = 47.2 bits (107), Expect = 5e-04 Identities = 18/33 (54%), Positives = 18/33 (54%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPP 530 P G PPPPP SPPPP G PPPPP Sbjct: 110 PRDGSSPPPPPPSKRAASPPPPGDGSSPPPPPP 142 Score = 46.4 bits (105), Expect = 8e-04 Identities = 20/46 (43%), Positives = 21/46 (45%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPPP + PPPP G PPPPPP PP Sbjct: 109 PPRDGSSPPPPPPSKRAASPPPPGDG-SSPPPPPPRDGSSPRPPPP 153 Score = 44.8 bits (101), Expect = 0.002 Identities = 20/46 (43%), Positives = 20/46 (43%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 P G PPPPP PPPP G PPPPPP PP Sbjct: 131 PGDGSSPPPPPPRDGSSPRPPPPRDG-SSPPPPPPRDGSSPPPPPP 175 Score = 44.8 bits (101), Expect = 0.002 Identities = 17/33 (51%), Positives = 17/33 (51%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPP 530 P G PPPPP PPPP G PPPPP Sbjct: 153 PRDGSSPPPPPPRDGSSPPPPPPRDGSAPPPPP 185 Score = 44.0 bits (99), Expect = 0.004 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PP P SPPPP G PPPP P A PP Sbjct: 87 PPRDGASPPAPPPRDGSSPPPPPPRDGSSPPPPPPSKRAASPPPP 131 Score = 43.6 bits (98), Expect = 0.006 Identities = 18/45 (40%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 P G PPPPP P PP G PPPPP + PP Sbjct: 77 PRDGSSPPPPPPRDGASPPAPPPRDGSSPPPPPPRDGSSPPPPPP 121 Score = 42.7 bits (96), Expect = 0.010 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPPP P PP PPPPPP PP Sbjct: 76 PPRDGSSPPPPPPRDGASPPAPPPRDGSSPPPPPPRDGSSPPPPPP 121 Score = 42.3 bits (95), Expect = 0.013 Identities = 18/45 (40%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP P PP SPPPP G PPPP P + PP Sbjct: 141 PPRDGSSPRPPPPRDGSSPPPPPPRDGSSPPPPPPRDGSAPPPPP 185 Score = 41.1 bits (92), Expect = 0.030 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 PPPPP PPPP G PPPP P Sbjct: 160 PPPPPRDGSSPPPPPPRDGSAPPPPPSGP 188 Score = 38.3 bits (85), Expect = 0.21 Identities = 18/46 (39%), Positives = 19/46 (41%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 P G P PPP PPPP G PPPPP + PP Sbjct: 88 PRDGASPPAPPPRDGSSPPPPPPRDGSS--PPPPPPSKRAASPPPP 131 Score = 37.5 bits (83), Expect = 0.37 Identities = 20/55 (36%), Positives = 21/55 (38%), Gaps = 10/55 (18%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPP----------PPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPP SPP PP G G PPPP P + PP Sbjct: 98 PPRDGSSPPPPPPRDGSSPPPPPPSKRAASPPPPGDGSSPPPPPPRDGSSPRPPP 152 Score = 37.1 bits (82), Expect = 0.50 Identities = 16/45 (35%), Positives = 17/45 (37%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPP PPPP G P PPP + PP Sbjct: 120 PPSKRAASPPPPGDGSSPPPPPPRDGSSPRPPPPRDGSSPPPPPP 164 Score = 36.3 bits (80), Expect = 0.86 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPP PPPP P PPPP PP Sbjct: 119 PPPSKRAASPPPPGDGSSPPPPPPRDGSSPRPPPPRDGSSPPPPPP 164 Score = 35.9 bits (79), Expect = 1.1 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 454 PPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PPPP PPPP G PP PPP PP Sbjct: 74 PPPPRDGSSPPPPPPRDG-ASPPAPPPRDGSSPPPPPP 110 Score = 35.9 bits (79), Expect = 1.1 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +3 Query: 453 PPPPXXXXXXSPPPPXXGGGXPPPPP 530 PPPP PPPP G P PPP Sbjct: 74 PPPPRDGSSPPPPPPRDGASPPAPPP 99 Score = 35.9 bits (79), Expect = 1.1 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPP PPPP PPPP PP Sbjct: 97 PPPRDGSSPPPPPPRDGSSPPPPPPSKRAASPPPPGDGSSPPPPPP 142 Score = 35.5 bits (78), Expect = 1.5 Identities = 20/61 (32%), Positives = 20/61 (32%), Gaps = 2/61 (3%) Frame = +1 Query: 358 PPXGVXSXXXXXXXXXXFXXXXXXPPXGXXXPPPPPXXXKXXXPPPPXXGXXXP--PPPP 531 PP G S P G PPPPP PPPP G P P P Sbjct: 129 PPPGDGSSPPPPPPRDGSSPRPPPPRDGSSPPPPPPRDGSSPPPPPPRDGSAPPPPPSGP 188 Query: 532 P 534 P Sbjct: 189 P 189 Score = 34.7 bits (76), Expect = 2.6 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPP 530 PP P SPPPP G PPPPP Sbjct: 56 PPNNGSDPALQQNKRSASPPPPRDGSSPPPPPP 88 Score = 33.1 bits (72), Expect = 8.1 Identities = 16/46 (34%), Positives = 17/46 (36%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP P + PPPP G PPPPPP PP Sbjct: 55 PPPNNGSDPALQQNKRSASPPPPRDGSS-PPPPPPRDGASPPAPPP 99 >UniRef50_UPI000049834E Cluster: FH2 domain protein; n=1; Entamoeba histolytica HM-1:IMSS|Rep: FH2 domain protein - Entamoeba histolytica HM-1:IMSS Length = 1212 Score = 47.2 bits (107), Expect = 5e-04 Identities = 25/72 (34%), Positives = 25/72 (34%), Gaps = 2/72 (2%) Frame = +1 Query: 358 PPXGVXSXXXXXXXXXXFXXXXXXPPXGXXX--PPPPPXXXKXXXPPPPXXGXXXPPPPP 531 PP G S PP G PPPPP PPPP G PPPP Sbjct: 616 PPPGASSVPPPPPPPGASSVPPPPPPPGASSVPPPPPPPGMPGMPPPPPPPGMPGMPPPP 675 Query: 532 PLXXXXXAXXPP 567 PL PP Sbjct: 676 PLPGMPGMPPPP 687 Score = 45.6 bits (103), Expect = 0.001 Identities = 18/45 (40%), Positives = 19/45 (42%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPPXXXXXG 584 PPPPP PPPP PPPPP P + PP G Sbjct: 614 PPPPPGASSVPPPPPPPGASSVPPPPPPPGASSVPPPPPPPGMPG 658 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPPXXXXXG 584 PPPPP PPPP G PPPPP P PP G Sbjct: 638 PPPPPGASSVPPPPPPPGMPGMPPPPPPPGMPGMPPPPPLPGMPG 682 Score = 45.2 bits (102), Expect = 0.002 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPPXXXXXG 584 PPPPP PPPP PPPPP P PP G Sbjct: 626 PPPPPGASSVPPPPPPPGASSVPPPPPPPGMPGMPPPPPPPGMPG 670 Score = 45.2 bits (102), Expect = 0.002 Identities = 22/49 (44%), Positives = 22/49 (44%), Gaps = 4/49 (8%) Frame = +3 Query: 432 PPXGXX--PPPPPXXXXXXSPPPPXXGG--GXPPPPPXPXXXAXXXXPP 566 PP G PPPPP PPPP G G PPPPP P PP Sbjct: 640 PPPGASSVPPPPPPPGMPGMPPPPPPPGMPGMPPPPPLPGMPGMPPPPP 688 Score = 44.0 bits (99), Expect = 0.004 Identities = 17/39 (43%), Positives = 18/39 (46%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PPPPP PPPP G PPPP P + PP Sbjct: 613 PPPPPPGASSVPPPPPPPGASSVPPPPPPPGASSVPPPP 651 Score = 43.2 bits (97), Expect = 0.008 Identities = 22/61 (36%), Positives = 22/61 (36%), Gaps = 2/61 (3%) Frame = +1 Query: 358 PPXGVXSXXXXXXXXXXFXXXXXXPPXGXX--XPPPPPXXXKXXXPPPPXXGXXXPPPPP 531 PP G S PP G PPPPP PPPP G PPPP Sbjct: 628 PPPGASSVPPPPPPPGASSVPPPPPPPGMPGMPPPPPPPGMPGMPPPPPLPGMPGMPPPP 687 Query: 532 P 534 P Sbjct: 688 P 688 Score = 42.3 bits (95), Expect = 0.013 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PPPPP PPPP G PPPPP PP Sbjct: 613 PPPPPPGASSVPPPPPPPGASSVPPPPPPPGASSVPPPP 651 Score = 40.3 bits (90), Expect = 0.053 Identities = 21/59 (35%), Positives = 21/59 (35%), Gaps = 1/59 (1%) Frame = +1 Query: 358 PPXGVXSXXXXXXXXXXFXXXXXXPPXGXX-XPPPPPXXXKXXXPPPPXXGXXXPPPPP 531 PP G S PP G PPPPP PPPP PPPPP Sbjct: 640 PPPGASSVPPPPPPPGMPGMPPPPPPPGMPGMPPPPPLPGMPGMPPPPPGMPGMPPPPP 698 Score = 39.5 bits (88), Expect = 0.093 Identities = 15/37 (40%), Positives = 16/37 (43%) Frame = +3 Query: 456 PPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PPP PPPP PPPPP P + PP Sbjct: 604 PPPSNTATAPPPPPPGASSVPPPPPPPGASSVPPPPP 640 Score = 37.1 bits (82), Expect = 0.50 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +1 Query: 457 PPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PPP PPPP PPPPPP PP Sbjct: 604 PPPSNTATAPPPPPPGASSVPPPPPPPGASSVPPPPP 640 Score = 36.7 bits (81), Expect = 0.65 Identities = 18/53 (33%), Positives = 18/53 (33%), Gaps = 2/53 (3%) Frame = +2 Query: 416 KXXXXPPXGXX--XPPPPXXXXKXXXPPPXXXGXXXPPPPXPXXXXXXXXPPP 568 K PP PPPP PPP PPPP P PPP Sbjct: 600 KGVVPPPSNTATAPPPPPPGASSVPPPPPPPGASSVPPPPPPPGASSVPPPPP 652 >UniRef50_Q07PB7 Cluster: Peptidase C14, caspase catalytic subunit p20 precursor; n=3; Bradyrhizobiaceae|Rep: Peptidase C14, caspase catalytic subunit p20 precursor - Rhodopseudomonas palustris (strain BisA53) Length = 1067 Score = 47.2 bits (107), Expect = 5e-04 Identities = 20/45 (44%), Positives = 21/45 (46%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP +PPPP PPPPP P A PP Sbjct: 1007 PPPVVRPPPPPPPAARPAPPPPPPVVRPPPPPPPPPPPAARPAPP 1051 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPPP PPPP PPPPPP PP Sbjct: 985 PPPPVVRPPPPPPPAARPAPPPPPPVVRPPPPPPPAARPAPPPPPP 1030 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/46 (41%), Positives = 21/46 (45%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPPP + PPPP PPPPPP+ PP Sbjct: 997 PPAARPAPPPPPPVVRPPPPPPPA-ARPAPPPPPPVVRPPPPPPPP 1041 Score = 44.8 bits (101), Expect = 0.002 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPPP PPPP PPPPPP PP Sbjct: 1006 PPPPVVRPPPPPPPAARPAPPPPPPVVRPPPPPPPPPPPAARPAPP 1051 Score = 43.2 bits (97), Expect = 0.008 Identities = 16/34 (47%), Positives = 17/34 (50%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPP 531 PP PPPPP + PPPP PPPPP Sbjct: 976 PPAARPAPPPPPPVVRPPPPPPPAARPAPPPPPP 1009 Score = 41.5 bits (93), Expect = 0.023 Identities = 16/36 (44%), Positives = 17/36 (47%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPL 537 PP P PPP PPPP PPPPPP+ Sbjct: 954 PPPPVVRPAPPPPPVVRQAPPPPPAARPAPPPPPPV 989 Score = 41.5 bits (93), Expect = 0.023 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPPP PPPP PPPPPP PP Sbjct: 966 PPVVRQAPPPPPAARPAPPPPPPVV--RPPPPPPPAARPAPPPPPP 1009 Score = 41.5 bits (93), Expect = 0.023 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP P PPP PPPP PPPP P PP Sbjct: 975 PPPAARPAPPPPPPVVRPPPPPPPAARPAPPPPPPVVRPPPPPPP 1019 Score = 41.5 bits (93), Expect = 0.023 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP P PPP PPPP PPPP P PP Sbjct: 996 PPPAARPAPPPPPPVVRPPPPPPPAARPAPPPPPPVVRPPPPPPP 1040 Score = 41.1 bits (92), Expect = 0.030 Identities = 20/50 (40%), Positives = 21/50 (42%), Gaps = 5/50 (10%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPP-----PXPXXXAXXXXPP 566 PP PPPPP +PPPP PPPP P P A PP Sbjct: 936 PPVVRPPPPPPPPAAHPAPPPPVVRPAPPPPPVVRQAPPPPPAARPAPPP 985 Score = 39.5 bits (88), Expect = 0.093 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 P PPPPP PPPP PPPPP PP Sbjct: 998 PAARPAPPPPPPVVRPPPPPPPAARPAPPPPPPVVRPPPPPPPPP 1042 Score = 38.3 bits (85), Expect = 0.21 Identities = 19/52 (36%), Positives = 20/52 (38%), Gaps = 6/52 (11%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPP------PPPLXXXXXAXXPP 567 PP PPPP + PPPP PPP PPP A PP Sbjct: 925 PPPAARPAPPPPPVVRPPPPPPPPAAHPAPPPPVVRPAPPPPPVVRQAPPPP 976 Score = 38.3 bits (85), Expect = 0.21 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PPPPP PPPP PPPPP P PP Sbjct: 973 PPPPPAARPAPPPPPPVV---RPPPPPPPAARPAPPPPP 1008 Score = 37.1 bits (82), Expect = 0.50 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPPP PPPP P PPPP PP Sbjct: 935 PPPVVRPPPPPPPPAAHPAPPPPVV---RPAPPPPPVVRQAPPPPP 977 Score = 37.1 bits (82), Expect = 0.50 Identities = 17/45 (37%), Positives = 18/45 (40%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP P PPP +PPPP PPPP P PP Sbjct: 955 PPPVVRPAPPPPPVVRQAPPPPP-AARPAPPPPPPVVRPPPPPPP 998 Score = 36.7 bits (81), Expect = 0.65 Identities = 17/46 (36%), Positives = 18/46 (39%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP P PPP + PPPP PPPPP PP Sbjct: 945 PPPPAAHPAPPPPVVRPAPPPPPVV--RQAPPPPPAARPAPPPPPP 988 Score = 35.9 bits (79), Expect = 1.1 Identities = 19/52 (36%), Positives = 19/52 (36%), Gaps = 7/52 (13%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPX-------PXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 987 PPVVRPPPPPPPAARPAPPPPPPVVRPPPPPPPAARPAPPPPPPVVRPPPPP 1038 Score = 35.1 bits (77), Expect = 2.0 Identities = 19/54 (35%), Positives = 19/54 (35%), Gaps = 3/54 (5%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXX---GGGXPPPPPXPXXXAXXXXPPXXXXXG 584 PP PPPPP PPPP PPPPP A P G Sbjct: 1008 PPVVRPPPPPPPAARPAPPPPPPVVRPPPPPPPPPPPAARPAPPAAKPCTLPNG 1061 Score = 34.7 bits (76), Expect = 2.6 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP P PP PPPP PPPPP P PP Sbjct: 916 PPAVTRPAAPPPAARPAPPPPPVV---RPPPPPPPPAAHPAPPPP 957 Score = 34.3 bits (75), Expect = 3.5 Identities = 20/65 (30%), Positives = 20/65 (30%), Gaps = 4/65 (6%) Frame = +3 Query: 384 PRGGGGGXXFXXXGXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPP----PXPXXXAX 551 P G G PP P P PPPP PPPP P P A Sbjct: 853 PLPGANGQPLPPVPASPPSPAAPAKSPSPTAPPPPPPPAAAREAPPPPAAERPKPAPAAE 912 Query: 552 XXXPP 566 PP Sbjct: 913 RQTPP 917 Score = 33.5 bits (73), Expect = 6.1 Identities = 15/46 (32%), Positives = 15/46 (32%) Frame = +2 Query: 431 PPXGXXXPPPPXXXXKXXXPPPXXXGXXXPPPPXPXXXXXXXXPPP 568 PP P PP PPP PPP P PPP Sbjct: 974 PPPPAARPAPPPPPPVVRPPPPPPPAARPAPPPPPPVVRPPPPPPP 1019 >UniRef50_Q852P0 Cluster: Pherophorin; n=2; Eukaryota|Rep: Pherophorin - Volvox carteri f. nagariensis Length = 606 Score = 47.2 bits (107), Expect = 5e-04 Identities = 19/45 (42%), Positives = 20/45 (44%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P + PP Sbjct: 214 PPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPP 258 Score = 47.2 bits (107), Expect = 5e-04 Identities = 19/45 (42%), Positives = 20/45 (44%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P + PP Sbjct: 225 PPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPSPSPPPPPP 269 Score = 46.4 bits (105), Expect = 8e-04 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPPP PPPP PPPPPP PP Sbjct: 213 PPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPP 258 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 205 PPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPP 249 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPPP PPPP PPPPPP PP Sbjct: 235 PPPPPSPPPPPPPPPPPSPPPPPPPPSPSPPPPPPSPSPPPPPPPP 280 Score = 45.2 bits (102), Expect = 0.002 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPPP PPPP PPPPPP PP Sbjct: 212 PPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPP 257 Score = 45.2 bits (102), Expect = 0.002 Identities = 19/45 (42%), Positives = 20/45 (44%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP SPPPP P PPP P + PP Sbjct: 223 PPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPSPSPPPP 267 Score = 45.2 bits (102), Expect = 0.002 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPPP PPPP PPPPPP PP Sbjct: 224 PPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPSPSPPPPPP 269 Score = 44.4 bits (100), Expect = 0.003 Identities = 18/44 (40%), Positives = 19/44 (43%) Frame = +3 Query: 435 PXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 P PPPPP PPPP PPPPP P + PP Sbjct: 203 PQPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPP 246 Score = 44.4 bits (100), Expect = 0.003 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP SPPPP P PPP P PP Sbjct: 211 PPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPP 255 Score = 44.0 bits (99), Expect = 0.004 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 PP PPPPP PPPP PPPPP P Sbjct: 248 PPPPSPPPPPPPPSPSPPPPPPSPSPPPPPPPPSP 282 Score = 43.6 bits (98), Expect = 0.006 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = +3 Query: 435 PXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 P PPPPP PPPP PPPPP P PP Sbjct: 217 PPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPP 260 Score = 43.2 bits (97), Expect = 0.008 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 P PPPPP PPPP PPPPP P PP Sbjct: 203 PQPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPP 247 Score = 42.7 bits (96), Expect = 0.010 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PPPPP PPPP PPPPPP PP Sbjct: 210 PPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPP 248 Score = 42.7 bits (96), Expect = 0.010 Identities = 18/46 (39%), Positives = 19/46 (41%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPPP PPPP P PPPP + PP Sbjct: 222 PPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPSPSPPPP 267 Score = 41.9 bits (94), Expect = 0.017 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPPP PPPP P PPPP PP Sbjct: 210 PPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPP 255 Score = 41.9 bits (94), Expect = 0.017 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPPP PPPP PPPPP PP Sbjct: 234 PPPPPPSPPPPPPPPPPPSPPPPPPPPSPSPPPPPPSPSPPPPPPP 279 Score = 41.5 bits (93), Expect = 0.023 Identities = 18/37 (48%), Positives = 18/37 (48%), Gaps = 2/37 (5%) Frame = +3 Query: 432 PPXGXXP--PPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 PP P PPPP SPPPP PPPPP P Sbjct: 244 PPPPPPPPSPPPPPPPPSPSPPPPPPSPSPPPPPPPP 280 Score = 40.7 bits (91), Expect = 0.040 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXP 564 PP PPPPP PPPP PPPPPP A P Sbjct: 246 PPPPPPSPPPPPPPPSPSPPPPPPS--PSPPPPPPPPSPPPAPPP 288 Score = 39.9 bits (89), Expect = 0.070 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 P PPPPP PPPP PPP P P PP Sbjct: 239 PSPPPPPPPPPPPSPPPPPPPPSPSPPPPPPSPSPPPPPPPPSPP 283 Score = 39.1 bits (87), Expect = 0.12 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPP PPPP PPP P P PP Sbjct: 230 PPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPSPSPPPPPPSPSPP 274 Score = 38.3 bits (85), Expect = 0.21 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPP PPPP PPPPPP PP Sbjct: 206 PPPPPP-PPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPPP 250 Score = 37.5 bits (83), Expect = 0.37 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +2 Query: 431 PPXGXXXPPPPXXXXKXXXPPPXXXGXXXPPPPXPXXXXXXXXPPP 568 PP PPPP PPP PPPP P P P Sbjct: 237 PPPSPPPPPPPPPPPSPPPPPPPPSPSPPPPPPSPSPPPPPPPPSP 282 Score = 36.3 bits (80), Expect = 0.86 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +2 Query: 431 PPXGXXXPPPPXXXXKXXXPPPXXXGXXXPPPPXPXXXXXXXXPPP 568 PP PPPP PPP PPPP P P P Sbjct: 217 PPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPSP 262 Score = 36.3 bits (80), Expect = 0.86 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +2 Query: 431 PPXGXXXPPPPXXXXKXXXPPPXXXGXXXPPPPXPXXXXXXXXPPP 568 PP PPPP PPP PPPP P P P Sbjct: 226 PPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPSPSPPPPPPSP 271 Score = 33.1 bits (72), Expect = 8.1 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPP 534 PPPPP PPPP PPPP P Sbjct: 205 PPPPPPPPPPPSPPPPPP---PPPPPSP 229 Score = 33.1 bits (72), Expect = 8.1 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +2 Query: 452 PPPPXXXXKXXXPPPXXXGXXXPPPPXPXXXXXXXXPPP 568 PPPP PPP PP P P PPP Sbjct: 246 PPPPPPSPPPPPPPPSPSPPPPPPSPSPPPPPPPPSPPP 284 >UniRef50_Q3HTL0 Cluster: Pherophorin-V1 protein precursor; n=1; Volvox carteri f. nagariensis|Rep: Pherophorin-V1 protein precursor - Volvox carteri f. nagariensis Length = 590 Score = 47.2 bits (107), Expect = 5e-04 Identities = 19/45 (42%), Positives = 20/45 (44%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P + PP Sbjct: 223 PPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPSPPPPSPPLPPP 267 Score = 44.0 bits (99), Expect = 0.004 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PPPPP SPPPP PPPPP P PP Sbjct: 209 PPPPPSPSPPPSPPPPPSPPPPPPPPPPPSPPPPPPPPP 247 Score = 43.2 bits (97), Expect = 0.008 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPP P PPPP PPPPP P PP Sbjct: 211 PPPSPSPPPSPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPP 255 Score = 42.7 bits (96), Expect = 0.010 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP SPPPP PPPPP P PP Sbjct: 221 PPPPPSPPPPPPPPPPPSPPPP------PPPPPPPSPPPPPSPPP 259 Score = 42.3 bits (95), Expect = 0.013 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +1 Query: 433 PXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 P PPPPP PPPP PPPPPP PP Sbjct: 215 PSPPPSPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPSPPP 259 Score = 41.9 bits (94), Expect = 0.017 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PPPPP PPPP PPPPPP PP Sbjct: 209 PPPPPSPSPPPSPPPPPSPPPPPPPPPPPSPPPPPPPPP 247 Score = 41.9 bits (94), Expect = 0.017 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPP P PPPP PPPPPP PP Sbjct: 210 PPPPSPSPPPSPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPP 255 Score = 41.9 bits (94), Expect = 0.017 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPPP PPPP PPPPP PP Sbjct: 222 PPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPSPPPPSPPLPPP 267 Score = 41.5 bits (93), Expect = 0.023 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 1/47 (2%) Frame = +1 Query: 430 PPXGXXXP-PPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP P PPPP PPPP PPPPPP PP Sbjct: 212 PPSPSPPPSPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPSPP 258 Score = 41.1 bits (92), Expect = 0.030 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP P PPP SPPPP P PPP P PP Sbjct: 209 PPPPPSPSPPPSPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPP 253 Score = 40.7 bits (91), Expect = 0.040 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PPPPP SPPP PPPPP P PP Sbjct: 205 PPPPPPPPPSPSPPPSPPPPPSPPPPPPPPPPPSPPPPP 243 Score = 39.9 bits (89), Expect = 0.070 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PPPPP PPP PPPPPP PP Sbjct: 208 PPPPPPSPSPPPSPPPPPSPPPPPPPPPPPSPPPPPPPP 246 Score = 39.1 bits (87), Expect = 0.12 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PPPPP PP P PPPPPP PP Sbjct: 206 PPPPPPPPSPSPPPSPPPPPSPPPPPPPPPPPSPPPPPP 244 Score = 38.7 bits (86), Expect = 0.16 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PPPPP PPP PPPPPP PP Sbjct: 205 PPPPPPPPPSPSPPPSPPPPPSPPPPPPPPPPPSPPPPP 243 Score = 38.7 bits (86), Expect = 0.16 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PPPPP P PP PPPPPP PP Sbjct: 207 PPPPPPPSPSPPPSPPPPPSPPPPPPPPPPPSPPPPPPP 245 Score = 38.7 bits (86), Expect = 0.16 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP P PPP PPPP P PPPP PP Sbjct: 208 PPPPPPSPSPPPSPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPP 253 Score = 38.3 bits (85), Expect = 0.21 Identities = 18/46 (39%), Positives = 19/46 (41%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP P PPP PPPP PPPPPP + PP Sbjct: 218 PPSPPPPPSPPP---PPPPPPPPSPPPPPPPPPPPSPPPPPSPPPP 260 Score = 35.5 bits (78), Expect = 1.5 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPP P PPP PPPP P PP Sbjct: 228 PPPPPPPPPPSPPPPPPPPPPPSPPPPPSPPPPSPPLPPPSIPSPP 273 >UniRef50_Q86C16 Cluster: Ah1644 protein; n=7; cellular organisms|Rep: Ah1644 protein - Drosophila melanogaster (Fruit fly) Length = 1644 Score = 47.2 bits (107), Expect = 5e-04 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PPPPP PPPP G PPPPP P PP Sbjct: 273 PPPPPMAPAAPPPPPPPINGAAPPPPPPPMINGGALPPP 311 Score = 44.8 bits (101), Expect = 0.002 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PPPPP PPPP PPPPPP A PP Sbjct: 273 PPPPPMAPAAPPPPPPPINGAAPPPPPPPMINGGALPPP 311 Score = 43.6 bits (98), Expect = 0.006 Identities = 17/39 (43%), Positives = 18/39 (46%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PPPP PPPP G PPPPPP+ PP Sbjct: 274 PPPPMAPAAPPPPPPPINGAAPPPPPPPMINGGALPPPP 312 Score = 43.2 bits (97), Expect = 0.008 Identities = 18/36 (50%), Positives = 18/36 (50%), Gaps = 2/36 (5%) Frame = +3 Query: 435 PXGXXPPPPPXXXXXXSPPPPXX--GGGXPPPPPXP 536 P PPPPP PPPP GG PPPPP P Sbjct: 280 PAAPPPPPPPINGAAPPPPPPPMINGGALPPPPPPP 315 Score = 41.5 bits (93), Expect = 0.023 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PPPPP PPPP G PPPP P PP Sbjct: 272 PPPPPPMAPAAPPPPPPPINGAAPPPPPPPMINGGALPP 310 Score = 41.5 bits (93), Expect = 0.023 Identities = 18/39 (46%), Positives = 18/39 (46%), Gaps = 4/39 (10%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPP----XXGXXXPPPPPP 534 PP PPPPP PPPP G PPPPPP Sbjct: 276 PPMAPAAPPPPPPPINGAAPPPPPPPMINGGALPPPPPP 314 Score = 39.9 bits (89), Expect = 0.070 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PPPP PPPP G PPPPP PP Sbjct: 274 PPPPMAPAAPPPPPPPINGAAPPPPPPPMINGGALPPPP 312 Score = 34.7 bits (76), Expect = 2.6 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +3 Query: 486 PPPPXXGGGXPPPPPXPXXXAXXXXPPXXXXXG 584 PPPP PPPPP P A PP G Sbjct: 273 PPPPPMAPAAPPPPPPPINGAAPPPPPPPMING 305 >UniRef50_Q7QDL5 Cluster: ENSANGP00000000741; n=1; Anopheles gambiae str. PEST|Rep: ENSANGP00000000741 - Anopheles gambiae str. PEST Length = 421 Score = 47.2 bits (107), Expect = 5e-04 Identities = 30/82 (36%), Positives = 30/82 (36%), Gaps = 5/82 (6%) Frame = -1 Query: 566 GGXXAXXXXXRGGGGGGXSXPXXGGGGXXXXXXXGGGGGXXXPXGGXXXXXKXXPPPP-- 393 GG GGGGGG GGGG GGGGG GG PP Sbjct: 162 GGRGRGGGGGYGGGGGGGGGGGYGGGGMSGGGGYGGGGGGGMGGGGGGGGYGNAPPSSYN 221 Query: 392 PPGGXXXT---PXGGXPPPXXG 336 P GG P GG P P G Sbjct: 222 PMGGYGQNNGGPGGGPPGPKRG 243 >UniRef50_Q16F81 Cluster: Diaphanous; n=3; Endopterygota|Rep: Diaphanous - Aedes aegypti (Yellowfever mosquito) Length = 1014 Score = 47.2 bits (107), Expect = 5e-04 Identities = 21/47 (44%), Positives = 21/47 (44%), Gaps = 2/47 (4%) Frame = +3 Query: 450 PPPP--PXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPPXXXXXG 584 PPPP P PPPP GGG PPPPP P PP G Sbjct: 432 PPPPQMPGMGPPPPPPPPGSGGGMPPPPPPPMMPGVPMPPPMPGMGG 478 Score = 42.3 bits (95), Expect = 0.013 Identities = 21/52 (40%), Positives = 22/52 (42%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 PP G GGG P P PPP +P PP G PPPPP P Sbjct: 447 PPPGSGGG--MPPPPPPPMMPGVPMPPPMPGMGGAPRPPPMPGMGPPPPPMP 496 Score = 40.7 bits (91), Expect = 0.040 Identities = 18/46 (39%), Positives = 19/46 (41%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 P G PPPPP PPPP P PPP+ A PP Sbjct: 438 PGMGPPPPPPPPGSGGGMPPPPPPPMMPGVPMPPPMPGMGGAPRPP 483 Score = 39.9 bits (89), Expect = 0.070 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 2/41 (4%) Frame = +1 Query: 451 PPPP--PXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PPPP P PPPP G PPPPPP PP Sbjct: 432 PPPPQMPGMGPPPPPPPPGSGGGMPPPPPPPMMPGVPMPPP 472 Score = 37.9 bits (84), Expect = 0.28 Identities = 20/49 (40%), Positives = 20/49 (40%), Gaps = 1/49 (2%) Frame = +3 Query: 423 GXXPPXGXXPPPPPX-XXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 G PP PPPPP PPPP G P PPP P PP Sbjct: 439 GMGPPP---PPPPPGSGGGMPPPPPPPMMPGVPMPPPMPGMGGAPRPPP 484 Score = 36.3 bits (80), Expect = 0.86 Identities = 16/37 (43%), Positives = 17/37 (45%), Gaps = 1/37 (2%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXP-PPPXXGXXXPPPPPPL 537 P G PPPPP P PPP G P PPP+ Sbjct: 449 PGSGGGMPPPPPPPMMPGVPMPPPMPGMGGAPRPPPM 485 >UniRef50_A2DFC2 Cluster: Formin Homology 2 Domain containing protein; n=2; Eukaryota|Rep: Formin Homology 2 Domain containing protein - Trichomonas vaginalis G3 Length = 1189 Score = 47.2 bits (107), Expect = 5e-04 Identities = 21/44 (47%), Positives = 21/44 (47%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXP 563 PP G PPPPP PPPP GG PPPP P A P Sbjct: 673 PPPGGVPPPPPPPGGVPPPPPPP--GGVPPPPAPPGVPAPPGVP 714 Score = 46.4 bits (105), Expect = 8e-04 Identities = 21/48 (43%), Positives = 21/48 (43%) Frame = +3 Query: 423 GXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 G G PPPPP PPPP GG PPPPP P PP Sbjct: 660 GAPAAPGLVPPPPPPPGGVPPPPPPP--GGVPPPPPPPGGVPPPPAPP 705 Score = 43.2 bits (97), Expect = 0.008 Identities = 18/46 (39%), Positives = 19/46 (41%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPPP PPPP G PP PP + PP Sbjct: 672 PPPPGGVPPPPPPPGGVPPPPPPPGGVPPPPAPPGVPAPPGVPAPP 717 Score = 40.3 bits (90), Expect = 0.053 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PPPPP PPPP G PPPPPP PP Sbjct: 669 PPPPPPPGGVPPPPPPPGGV--PPPPPPPGGVPPPPAPP 705 Score = 34.3 bits (75), Expect = 3.5 Identities = 14/22 (63%), Positives = 14/22 (63%), Gaps = 2/22 (9%) Frame = -1 Query: 404 PPPPPPGG--XXXTPXGGXPPP 345 PPPPPPGG P GG PPP Sbjct: 670 PPPPPPGGVPPPPPPPGGVPPP 691 Score = 34.3 bits (75), Expect = 3.5 Identities = 14/22 (63%), Positives = 14/22 (63%), Gaps = 2/22 (9%) Frame = -1 Query: 404 PPPPPPGG--XXXTPXGGXPPP 345 PPPPPPGG P GG PPP Sbjct: 680 PPPPPPGGVPPPPPPPGGVPPP 701 >UniRef50_A0BLV2 Cluster: Chromosome undetermined scaffold_115, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_115, whole genome shotgun sequence - Paramecium tetraurelia Length = 1084 Score = 47.2 bits (107), Expect = 5e-04 Identities = 21/49 (42%), Positives = 21/49 (42%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPP 527 PP GG PP G PPPPP PPPP G PPPP Sbjct: 576 PPPGGSLTAPPPPPPPPPPGGRLPPPPPPPPGGMPPPPPMPGRAPPPPP 624 Score = 46.0 bits (104), Expect = 0.001 Identities = 17/29 (58%), Positives = 17/29 (58%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 PPPPP PPPP GG PPPPP P Sbjct: 588 PPPPPPPGGRLPPPPPPPPGGMPPPPPMP 616 Score = 44.4 bits (100), Expect = 0.003 Identities = 17/33 (51%), Positives = 17/33 (51%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPP 528 PP G PPPPP PPPP G PPPP Sbjct: 592 PPPGGRLPPPPPPPPGGMPPPPPMPGRAPPPPP 624 Score = 43.6 bits (98), Expect = 0.006 Identities = 19/38 (50%), Positives = 19/38 (50%), Gaps = 3/38 (7%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXX---GGGXPPPPPXP 536 PP PPPPP PPPP GG PPPPP P Sbjct: 568 PPPPPPPPPPPGGSLTAPPPPPPPPPPGGRLPPPPPPP 605 Score = 42.7 bits (96), Expect = 0.010 Identities = 19/45 (42%), Positives = 21/45 (46%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP +PPPP PPPPP P + PP Sbjct: 548 PPPPPPPPPPPPGGLLTAPPPP-----PPPPPPPPPGGSLTAPPP 587 Score = 41.5 bits (93), Expect = 0.023 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP G PPPP PPPP PPPPPP PP Sbjct: 558 PPGGLLTAPPPPPPPPP--PPPPGGSLTAPPPPPPPPPPGGRLPPP 601 Score = 41.1 bits (92), Expect = 0.030 Identities = 18/38 (47%), Positives = 18/38 (47%), Gaps = 3/38 (7%) Frame = +1 Query: 430 PPXGXXXPPPPP---XXXKXXXPPPPXXGXXXPPPPPP 534 PP PPPPP PPPP G PPPPPP Sbjct: 567 PPPPPPPPPPPPGGSLTAPPPPPPPPPPGGRLPPPPPP 604 Score = 39.1 bits (87), Expect = 0.12 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +1 Query: 433 PXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 P PPPPP PPPP PPPPPP A PP Sbjct: 548 PPPPPPPPPPPPGGLLTAPPPP----PPPPPPPPPGGSLTAPPPP 588 Score = 38.3 bits (85), Expect = 0.21 Identities = 15/29 (51%), Positives = 17/29 (58%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPPL 537 PPPPP + PPPP G PPPPP+ Sbjct: 589 PPPPPPGGRLPPPPPPPPGGM--PPPPPM 615 Score = 36.7 bits (81), Expect = 0.65 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPP 534 PP PPPPP PPPP G PPPPP Sbjct: 543 PPQIAPPPPPPP-------PPPPPGGLLTAPPPPP 570 Score = 36.7 bits (81), Expect = 0.65 Identities = 17/36 (47%), Positives = 17/36 (47%), Gaps = 4/36 (11%) Frame = -1 Query: 440 PXGGXXXXXKXXPPPPPPGG----XXXTPXGGXPPP 345 P GG PPPPPPGG P GG PPP Sbjct: 577 PPGGSLTAPPPPPPPPPPGGRLPPPPPPPPGGMPPP 612 Score = 35.5 bits (78), Expect = 1.5 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +2 Query: 431 PPXGXXXPPPPXXXXKXXXPPPXXXGXXXPPPPXPXXXXXXXXPPP 568 PP G PP PPP PPPP P PPP Sbjct: 557 PPPGGLLTAPPPPPPPPPPPPPGGSLTAPPPPPPPPPPGGRLPPPP 602 Score = 35.5 bits (78), Expect = 1.5 Identities = 13/25 (52%), Positives = 14/25 (56%) Frame = -1 Query: 404 PPPPPPGGXXXTPXGGXPPPXXGXK 330 PPPPPPGG P PPP G + Sbjct: 573 PPPPPPGGSLTAPPPPPPPPPPGGR 597 Score = 34.3 bits (75), Expect = 3.5 Identities = 18/37 (48%), Positives = 18/37 (48%), Gaps = 3/37 (8%) Frame = +3 Query: 435 PXGXXPPPPPXXXXXXSPPPPXXGGG---XPPPPPXP 536 P PPPPP PPPP GG PPPPP P Sbjct: 543 PPQIAPPPPP-------PPPPPPPGGLLTAPPPPPPP 572 Score = 33.5 bits (73), Expect = 6.1 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -1 Query: 404 PPPPPPGGXXXTPXGGXPPP 345 PPPPPPGG P PPP Sbjct: 554 PPPPPPGGLLTAPPPPPPPP 573 >UniRef50_UPI0000E491BF Cluster: PREDICTED: similar to FHOS2L splicing variant; n=1; Strongylocentrotus purpuratus|Rep: PREDICTED: similar to FHOS2L splicing variant - Strongylocentrotus purpuratus Length = 1146 Score = 46.8 bits (106), Expect = 6e-04 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +3 Query: 435 PXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 P G PPPPP PPPP G PPPPP PP Sbjct: 578 PDGAPPPPPPLPGLGIPPPPPIPGAPPPPPPPAMKGPGAPPPPP 621 Score = 44.4 bits (100), Expect = 0.003 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PPPPP PPPP PPPPPP A PP Sbjct: 582 PPPPPPLPGLGIPPPPPIPGAPPPPPPPAMKGPGAPPPP 620 Score = 43.6 bits (98), Expect = 0.006 Identities = 17/39 (43%), Positives = 18/39 (46%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PPPPP PPPP G PPPPP + PP Sbjct: 583 PPPPPLPGLGIPPPPPIPGAPPPPPPPAMKGPGAPPPPP 621 Score = 40.7 bits (91), Expect = 0.040 Identities = 16/36 (44%), Positives = 17/36 (47%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPL 537 P G PPPPP PPPP PPPPP+ Sbjct: 587 PLPGLGIPPPPPIPGAPPPPPPPAMKGPGAPPPPPI 622 >UniRef50_Q1IA36 Cluster: Insecticidal toxin, SepC/Tcc class; n=1; Pseudomonas entomophila L48|Rep: Insecticidal toxin, SepC/Tcc class - Pseudomonas entomophila (strain L48) Length = 990 Score = 46.8 bits (106), Expect = 6e-04 Identities = 18/33 (54%), Positives = 19/33 (57%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPP 530 PP G PPPP +PPPP G G PPPPP Sbjct: 706 PPSGMRLPPPPPPPGMGTPPPPPPGMGLPPPPP 738 Score = 44.0 bits (99), Expect = 0.004 Identities = 16/28 (57%), Positives = 16/28 (57%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPP 534 PPPPP PPPP G PPPPPP Sbjct: 702 PPPPPPSGMRLPPPPPPPGMGTPPPPPP 729 Score = 43.6 bits (98), Expect = 0.006 Identities = 17/33 (51%), Positives = 17/33 (51%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPP 530 P PPPPP PPPP G G PPPPP Sbjct: 696 PSVPSAPPPPPPSGMRLPPPPPPPGMGTPPPPP 728 Score = 39.9 bits (89), Expect = 0.070 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPPP 530 PPPPP PPPP G PPPPP Sbjct: 703 PPPPPSGMRLPPPPPPPGMGTPPPPPP 729 Score = 38.3 bits (85), Expect = 0.21 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 PP G PPPP PPPP G PPPP P Sbjct: 717 PPPGMGTPPPPPPGMGLPPPPP----GLRPPPPGP 747 Score = 35.9 bits (79), Expect = 1.1 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +3 Query: 435 PXGXXPPPPPXXXXXXSPPPPXXGGGXPPPP 527 P PPPP PPPP G PPPP Sbjct: 699 PSAPPPPPPSGMRLPPPPPPPGMGTPPPPPP 729 Score = 33.9 bits (74), Expect = 4.6 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +3 Query: 486 PPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PPPP G PPPPP P PP Sbjct: 703 PPPPPSGMRLPPPPPPPGMGTPPPPPP 729 Score = 33.9 bits (74), Expect = 4.6 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 487 PPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PPPP G PPPPPP PP Sbjct: 703 PPPPPSGMRLPPPPPPPGMGTPPPPPP 729 Score = 33.1 bits (72), Expect = 8.1 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPP 531 PP PPPP PPPP G PPP P Sbjct: 716 PPPPGMGTPPPPPPGMGLPPPPP--GLRPPPPGP 747 >UniRef50_Q0D4Y8 Cluster: Os07g0596300 protein; n=7; Eukaryota|Rep: Os07g0596300 protein - Oryza sativa subsp. japonica (Rice) Length = 754 Score = 46.8 bits (106), Expect = 6e-04 Identities = 20/51 (39%), Positives = 20/51 (39%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPPXXXXXG 584 PP PPPPP PPPP G PPPP P PP G Sbjct: 176 PPSPPPPPPPPGARPGPPPPPPPPGARPGPPPPPPPPGGRPSAPPLPPPGG 226 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPPP PPPP G PPPPP PP Sbjct: 175 PPPSPPPPPPPPGARPGPPPPPPPPGARPGPPPPPPPPGGRPSAPP 220 Score = 44.8 bits (101), Expect = 0.002 Identities = 25/62 (40%), Positives = 25/62 (40%), Gaps = 6/62 (9%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPX----GXXPPPPPXXXXXXSPPPPXXGG--GXPPPPPXPXX 542 PP GG PP PPPPP PPPP GG G PPPPP P Sbjct: 219 PPLPPPGGRASAPPPPPPPSTRLGAPPPPPPPGAGGRAPPPPPAPGGRLGGPPPPPPPGG 278 Query: 543 XA 548 A Sbjct: 279 RA 280 Score = 44.4 bits (100), Expect = 0.003 Identities = 23/64 (35%), Positives = 23/64 (35%), Gaps = 2/64 (3%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXXPPPPPXXXXXXSPPPPXXGGG--XPPPPPXPXXXAXX 554 PP GG PPPPP PPPP G G PPPPP P Sbjct: 210 PPPGGRPSAPPLPPPGGRASAPPPPPPPSTRLGAPPPPPPPGAGGRAPPPPPAPGGRLGG 269 Query: 555 XXPP 566 PP Sbjct: 270 PPPP 273 Score = 44.0 bits (99), Expect = 0.004 Identities = 24/70 (34%), Positives = 25/70 (35%), Gaps = 2/70 (2%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXXPPPPPXXXXXXSPPPPXXGG--GXPPPPPXPXXXAXX 554 PP G G G PPPPP +PP P GG PPPPP P Sbjct: 184 PPPGARPGPPPPPPPPGARPGPPPPPPPPGGRPSAPPLPPPGGRASAPPPPPPPSTRLGA 243 Query: 555 XXPPXXXXXG 584 PP G Sbjct: 244 PPPPPPPGAG 253 Score = 43.6 bits (98), Expect = 0.006 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = +3 Query: 441 GXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 G P PPP PPPP G PPPPP P PP Sbjct: 168 GAPPSPPPPPSPPPPPPPPGARPGPPPPPPPPGARPGPPPPP 209 Score = 40.7 bits (91), Expect = 0.040 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = +1 Query: 439 GXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 G PPPPP PPPP G PPPP A PP Sbjct: 242 GAPPPPPPPGAGGRAPPPPPAPGGRLGGPPPPPPPGGRAPPPP 284 Score = 40.3 bits (90), Expect = 0.053 Identities = 16/39 (41%), Positives = 17/39 (43%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PPPPP +PP P PPPPP P PP Sbjct: 158 PPPPPPITRSGAPPSPPPPPSPPPPPPPPGARPGPPPPP 196 Score = 40.3 bits (90), Expect = 0.053 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PP PPPP PPPPPP PP Sbjct: 170 PPSPPPPPSPPPPPPPPGARPGPPPPPPPPGARPGPPPP 208 Score = 39.9 bits (89), Expect = 0.070 Identities = 16/39 (41%), Positives = 17/39 (43%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PPPPP + PP P PPPPPP PP Sbjct: 158 PPPPPPITRSGAPPSPPPPPSPPPPPPPPGARPGPPPPP 196 Score = 39.9 bits (89), Expect = 0.070 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPPXXXXXG 584 PP PP PPPP PPPPP P PP G Sbjct: 170 PPSPPPPPSPPPPPPPPGARPGPPPPPPPPGARPGPPPPPPPPGG 214 Score = 39.5 bits (88), Expect = 0.093 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = +3 Query: 423 GXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 G PP PPP P PPPP GG PPPP P Sbjct: 254 GRAPP----PPPAPGGRLGGPPPPPPPGGRAPPPPRGP 287 Score = 39.1 bits (87), Expect = 0.12 Identities = 18/42 (42%), Positives = 18/42 (42%), Gaps = 3/42 (7%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXX---PPPPPPLXXXXXAXXPP 567 PPPPP PPPP PPPPPP A PP Sbjct: 118 PPPPPISHSNAPPPPPLPAARFNAPPPPPPPPTTHFNAPPPP 159 Score = 39.1 bits (87), Expect = 0.12 Identities = 20/52 (38%), Positives = 21/52 (40%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 PP G GG G PPPPP +PPPP G PPP P Sbjct: 248 PPPGAGGRAPPPPPAPGGRLGGPPPPPPPGGR--APPPPRGPGAPPPPGGNP 297 Score = 38.7 bits (86), Expect = 0.16 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 2/41 (4%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGG--GXPPPPPXPXXXAXXXXPP 566 PPPPP PPPP PPPPP P PP Sbjct: 118 PPPPPISHSNAPPPPPLPAARFNAPPPPPPPPTTHFNAPPP 158 Score = 38.7 bits (86), Expect = 0.16 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PPPPP P PP PPPPPP PP Sbjct: 159 PPPPPITRSGAPPSPPPPPSPPPPPPPPGARPGPPPPPP 197 Score = 38.7 bits (86), Expect = 0.16 Identities = 20/50 (40%), Positives = 20/50 (40%), Gaps = 4/50 (8%) Frame = +1 Query: 430 PPXGXXX---PPPPPXXXKXXXPPPPXXG-XXXPPPPPPLXXXXXAXXPP 567 PP G PPPPP PPPP G PPPPP PP Sbjct: 223 PPGGRASAPPPPPPPSTRLGAPPPPPPPGAGGRAPPPPPAPGGRLGGPPP 272 Score = 38.3 bits (85), Expect = 0.21 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PP P PPPP G PPPPP PP Sbjct: 162 PPITRSGAPPSPPPPPSPPPPPPPPGARPGPPPPPPPPGARPGPPP 207 Score = 37.9 bits (84), Expect = 0.28 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 2/41 (4%) Frame = +3 Query: 450 PPPPPX--XXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PPPPP PPPP PPPPP P PP Sbjct: 105 PPPPPLLRSVPPPPPPPPISHSNAPPPPPLPAARFNAPPPP 145 Score = 37.9 bits (84), Expect = 0.28 Identities = 17/40 (42%), Positives = 17/40 (42%), Gaps = 1/40 (2%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXX-GXXXPPPPPPLXXXXXAXXPP 567 PPPPP PPPP PPPPPL PP Sbjct: 105 PPPPPLLRSVPPPPPPPPISHSNAPPPPPLPAARFNAPPP 144 Score = 37.9 bits (84), Expect = 0.28 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +1 Query: 433 PXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 P PPP PPPP PPPPPP A PP Sbjct: 216 PSAPPLPPPGGRASAPPPPPPPSTRLGAPPPPPPPGAGGRAPPPP 260 Score = 37.1 bits (82), Expect = 0.50 Identities = 17/40 (42%), Positives = 18/40 (45%), Gaps = 1/40 (2%) Frame = +3 Query: 450 PPPPPXXXXXXSP-PPPXXGGGXPPPPPXPXXXAXXXXPP 566 PPPPP +P PPP PPPP P A PP Sbjct: 64 PPPPPLKPSSGAPCPPPPPPPPPPPPPSAPSSRAFSSAPP 103 Score = 36.7 bits (81), Expect = 0.65 Identities = 15/44 (34%), Positives = 17/44 (38%) Frame = +3 Query: 435 PXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 P PPPPP +P PPPPP P + PP Sbjct: 76 PCPPPPPPPPPPPPPSAPSSRAFSSAPPPPPPPPLLRSVPPPPP 119 Score = 36.7 bits (81), Expect = 0.65 Identities = 19/52 (36%), Positives = 20/52 (38%), Gaps = 7/52 (13%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXS-------PPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP + PPPP PPPPP P PP Sbjct: 80 PPPPPPPPPPPSAPSSRAFSSAPPPPPPPPLLRSVPPPPPPPPISHSNAPPP 131 Score = 36.7 bits (81), Expect = 0.65 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 3/42 (7%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXG---GGXPPPPPXPXXXAXXXXPP 566 PPPPP PPPP G PP PP P PP Sbjct: 145 PPPPPTTHFNAPPPPPPPPITRSGAPPSPPPPPSPPPPPPPP 186 Score = 36.3 bits (80), Expect = 0.86 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPPXXXXXG 584 PPPPP S PP PPPP P A PP G Sbjct: 156 PPPPPPPPITRSGAPPSPPPPPSPPPPPPPPGARPGPPPPPPPPG 200 Score = 35.9 bits (79), Expect = 1.1 Identities = 28/118 (23%), Positives = 31/118 (26%), Gaps = 7/118 (5%) Frame = +3 Query: 450 PPPPPXXXXXXSP-PPPXXGGGXPPPPPXPXXXAXXXXPPXXXXXGXXXXXXXXXXKXGX 626 PPPPP P PPP PPPPP PP G + Sbjct: 159 PPPPPITRSGAPPSPPPPPSPPPPPPPPGARPGPPPPPPPPGARPGPPPPPPPPGGRPSA 218 Query: 627 XXXXXKXXKXXXXXXXXXXGSXXXXPPPXXXXXAXG------GAGGXXXXXXXXPPPP 782 + + PPP A G A G PPPP Sbjct: 219 PPLPPPGGRASAPPPPPPPSTRLGAPPPPPPPGAGGRAPPPPPAPGGRLGGPPPPPPP 276 Score = 35.9 bits (79), Expect = 1.1 Identities = 19/54 (35%), Positives = 19/54 (35%) Frame = +3 Query: 423 GXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPPXXXXXG 584 G P PPP PPPP G PPPPP P PP G Sbjct: 213 GGRPSAPPLPPPGGRASAPPPPPPPSTRLGAPPPPP-PPGAGGRAPPPPPAPGG 265 Score = 35.9 bits (79), Expect = 1.1 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 2/45 (4%) Frame = -1 Query: 464 GGGGGXXXPXGGXXXXXKXXPPPPPPGGXXXTP--XGGXPPPXXG 336 G GG P PPPPPPGG P G PPP G Sbjct: 251 GAGGRAPPPPPAPGGRLGGPPPPPPPGGRAPPPPRGPGAPPPPGG 295 Score = 35.5 bits (78), Expect = 1.5 Identities = 23/57 (40%), Positives = 23/57 (40%), Gaps = 5/57 (8%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXXP---PPPPXXXXXXSPPP--PXXGGGXPPPPPXP 536 PPR G GG P P PPPP PPP P G PPPPP P Sbjct: 33 PPRSGVGGNTPPAPPPPPLRSTVPAISPPPPPP-----PPPLKPSSGAPCPPPPPPP 84 Score = 35.5 bits (78), Expect = 1.5 Identities = 20/54 (37%), Positives = 20/54 (37%), Gaps = 3/54 (5%) Frame = +3 Query: 432 PPXGXX--PP-PPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPPXXXXXG 584 PP G PP PPP PPPP PPP P A PP G Sbjct: 211 PPGGRPSAPPLPPPGGRASAPPPPPPPSTRLGAPPPPPPPGAGGRAPPPPPAPG 264 Score = 35.1 bits (77), Expect = 2.0 Identities = 19/53 (35%), Positives = 19/53 (35%), Gaps = 7/53 (13%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXX-------PPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPPP PPPP PPPPPP PP Sbjct: 79 PPPPPPPPPPPPSAPSSRAFSSAPPPPPPPPLLRSVPPPPPPPPISHSNAPPP 131 Score = 34.3 bits (75), Expect = 3.5 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PPPPP PP PPPPPPL A PP Sbjct: 46 PPPPPLRSTVPAISPPP-----PPPPPPLKPSSGAPCPP 79 Score = 34.3 bits (75), Expect = 3.5 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPP 534 P PPPPP P P PPPPPP Sbjct: 56 PAISPPPPPPPPPLKPSSGAPCPPPPPPPPPPPPP 90 Score = 33.5 bits (73), Expect = 6.1 Identities = 17/49 (34%), Positives = 17/49 (34%), Gaps = 3/49 (6%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXX---GXXXPPPPPPLXXXXXAXXPP 567 P G PPPPP P P PPPPPP PP Sbjct: 71 PSSGAPCPPPPPPPPPPPPPSAPSSRAFSSAPPPPPPPPLLRSVPPPPP 119 Score = 33.1 bits (72), Expect = 8.1 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +2 Query: 431 PPXGXXXPPPPXXXXKXXXPPPXXXGXXXPPPPXPXXXXXXXXPPP 568 PP PPPP PPP PPPP P PPP Sbjct: 108 PPLLRSVPPPPP-------PPPISHSNAPPPPPLPAARFNAPPPPP 146 Score = 33.1 bits (72), Expect = 8.1 Identities = 19/50 (38%), Positives = 20/50 (40%) Frame = -2 Query: 529 GGGGGXPPPXXGGGGXXFXXXXGGGGGXXPXGGXXPXFXKXXPPPPPRGG 380 G GG PPP GG GG P GG P + PPP GG Sbjct: 251 GAGGRAPPPPPAPGG-----RLGGPPPPPPPGGRAPPPPRGPGAPPPPGG 295 >UniRef50_Q01I59 Cluster: H0315A08.9 protein; n=3; Oryza sativa|Rep: H0315A08.9 protein - Oryza sativa (Rice) Length = 168 Score = 46.8 bits (106), Expect = 6e-04 Identities = 22/60 (36%), Positives = 22/60 (36%) Frame = +3 Query: 387 RGGGGGXXFXXXGXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 RG F PP PPPPP PPPP PPPPP P PP Sbjct: 3 RGNSEFVSFWRVDPPPPHCPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 45.2 bits (102), Expect = 0.002 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPPP PPPP PPPPPP PP Sbjct: 16 PPPPHCPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 45.2 bits (102), Expect = 0.002 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPPP PPPP PPPPPP PP Sbjct: 17 PPPHCPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 44.8 bits (101), Expect = 0.002 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPPP PPPP PPPPPP PP Sbjct: 18 PPHCPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 42.3 bits (95), Expect = 0.013 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +1 Query: 433 PXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 P PPPPP PPPP PPPPPP PP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 >UniRef50_Q7RWH7 Cluster: Putative uncharacterized protein NCU01431.1; n=2; Sordariomycetes|Rep: Putative uncharacterized protein NCU01431.1 - Neurospora crassa Length = 1817 Score = 46.8 bits (106), Expect = 6e-04 Identities = 18/35 (51%), Positives = 19/35 (54%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 PP PPPPP +PP P GG PPPPP P Sbjct: 1064 PPPPPPPPPPPGGLPGAAPPMPGAGGPPPPPPPPP 1098 Score = 46.0 bits (104), Expect = 0.001 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = +3 Query: 423 GXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 G PP PPPPP P P G G PPPPP P Sbjct: 1029 GPPPPPPPPPPPPPPPGFLPGAPAPIPGAGGPPPPPPP 1066 Score = 46.0 bits (104), Expect = 0.001 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = +3 Query: 423 GXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 G PP PPPPP PP G G PPPPP P Sbjct: 1059 GPPPPPPPPPPPPPPPGGLPGAAPPMPGAGGPPPPPPP 1096 Score = 44.4 bits (100), Expect = 0.003 Identities = 17/35 (48%), Positives = 18/35 (51%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 PP PPPPP + PP GG PPPPP P Sbjct: 1063 PPPPPPPPPPPPGGLPGAAPPMPGAGGPPPPPPPP 1097 Score = 44.0 bits (99), Expect = 0.004 Identities = 17/35 (48%), Positives = 18/35 (51%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 PP PPPPP +P P GG PPPPP P Sbjct: 1033 PPPPPPPPPPPPGFLPGAPAPIPGAGGPPPPPPPP 1067 Score = 43.6 bits (98), Expect = 0.006 Identities = 24/62 (38%), Positives = 24/62 (38%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXX 560 PP GG G G P PPPPP PP P G PPPPP P Sbjct: 1072 PPPGGLPGAAPPMPGAGGPPPPPPPPPP-------PPMPGMAGMPPPPPPPPPMPGMPGM 1124 Query: 561 PP 566 PP Sbjct: 1125 PP 1126 Score = 37.9 bits (84), Expect = 0.28 Identities = 21/66 (31%), Positives = 21/66 (31%) Frame = +1 Query: 337 PXXGGGXPPXGVXSXXXXXXXXXXFXXXXXXPPXGXXXPPPPPXXXKXXXPPPPXXGXXX 516 P G G PP P PPPPP PPPP G Sbjct: 1053 PIPGAGGPPPPPPPPPPPPPPPGGLPGAAPPMPGAGGPPPPPP-----PPPPPPMPGMAG 1107 Query: 517 PPPPPP 534 PPPPP Sbjct: 1108 MPPPPP 1113 Score = 37.9 bits (84), Expect = 0.28 Identities = 23/57 (40%), Positives = 23/57 (40%), Gaps = 5/57 (8%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPX-----GXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 PP G GG PP G PPPPP PPP G PPPPP P Sbjct: 1082 PPMPGAGGPPPPPPPPPPPPMPGMAGMPPPPPP-------PPPMPGMPGMPPPPPPP 1131 Score = 37.9 bits (84), Expect = 0.28 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPP P P G PPPPPP PP Sbjct: 1082 PPMPGAGGPPPPPPPPPPPPMPGMAGMPPPPPPPPPMPGMPGMPPP 1127 Score = 37.9 bits (84), Expect = 0.28 Identities = 18/46 (39%), Positives = 19/46 (41%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPPP PPPP PPPPP+ PP Sbjct: 1090 PPPPPPPPPPPPMPGMAGMPPPP-------PPPPPMPGMPGMPPPP 1128 Score = 35.9 bits (79), Expect = 1.1 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 2/36 (5%) Frame = +1 Query: 433 PXGXXXPPPPPXXXKXXXP--PPPXXGXXXPPPPPP 534 P PPPPP P P P G PPPPPP Sbjct: 1030 PPPPPPPPPPPPPPPGFLPGAPAPIPGAGGPPPPPP 1065 Score = 34.7 bits (76), Expect = 2.6 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXP 563 PP G P P PPPP PPPPP A P Sbjct: 1042 PPPGFLPGAPAPIPGAGGPPPPPPPPPPPPPPPGGLPGAAPPMP 1085 Score = 33.5 bits (73), Expect = 6.1 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 8/43 (18%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXP--------PPPXXGXXXPPPPPP 534 PP PPPPP P PPP PPPPPP Sbjct: 1032 PPPPPPPPPPPPPGFLPGAPAPIPGAGGPPPPPPPPPPPPPPP 1074 Score = 33.5 bits (73), Expect = 6.1 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPP 534 P G PPPP PPPP G PPPPP Sbjct: 1101 PMPGMAGMPPPP------PPPPPMPGMPGMPPPPP 1129 >UniRef50_Q0V5Y9 Cluster: Predicted protein; n=1; Phaeosphaeria nodorum|Rep: Predicted protein - Phaeosphaeria nodorum (Septoria nodorum) Length = 305 Score = 46.8 bits (106), Expect = 6e-04 Identities = 18/35 (51%), Positives = 18/35 (51%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPP 534 PP G PPPPP PPPP G PPPPP Sbjct: 76 PPPGYGEPPPPPPPGYGEQPPPPPPGYAAEPPPPP 110 Score = 44.0 bits (99), Expect = 0.004 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPP 531 PP G PPPP PPPP G PPPPP Sbjct: 87 PPPGYGEQPPPPPPGYAAEPPPPPPGMQPPPPPP 120 Score = 43.6 bits (98), Expect = 0.006 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 PP PPPPP PPPP G PPPP P Sbjct: 77 PPGYGEPPPPPPPGYGEQPPPPPPGYAAEPPPPPP 111 Score = 43.2 bits (97), Expect = 0.008 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 P PPP PPPP G G PPPP P A PP Sbjct: 72 PRPPPPPGYGEPPPPPPPGYGEQPPPPPPGYAAEPPPPP 110 Score = 41.5 bits (93), Expect = 0.023 Identities = 18/39 (46%), Positives = 19/39 (48%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PPPPP + PPPP G PPPPPP PP Sbjct: 74 PPPPPGYGEPPPPPPPGYGEQ-PPPPPPGYAAEPPPPPP 111 Score = 39.1 bits (87), Expect = 0.12 Identities = 18/44 (40%), Positives = 19/44 (43%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXP 563 P G PPPPP PPPP G PPPP P + P Sbjct: 89 PGYGEQPPPPPPGYAAEPPPPPP---GMQPPPPPPGHDSRSHRP 129 Score = 33.5 bits (73), Expect = 6.1 Identities = 16/40 (40%), Positives = 16/40 (40%), Gaps = 1/40 (2%) Frame = +1 Query: 451 PPPPPXXXK-XXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PP PPPP G PPPPP PP Sbjct: 71 PPRPPPPPGYGEPPPPPPPGYGEQPPPPPPGYAAEPPPPP 110 >UniRef50_Q8T4F7 Cluster: Protein enabled; n=7; Eumetazoa|Rep: Protein enabled - Drosophila melanogaster (Fruit fly) Length = 829 Score = 46.8 bits (106), Expect = 6e-04 Identities = 23/56 (41%), Positives = 25/56 (44%), Gaps = 6/56 (10%) Frame = +3 Query: 387 RGGGGGXXFXXXGXXPPX------GXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 +GG GG PP G PPP P +PPPP GGG PP PP P Sbjct: 543 QGGPGGPPAPAPPPPPPSFGGAAGGGPPPPAPPQMFNGAPPPPAMGGGPPPAPPAP 598 Score = 40.7 bits (91), Expect = 0.040 Identities = 19/37 (51%), Positives = 19/37 (51%), Gaps = 2/37 (5%) Frame = +3 Query: 432 PPXGXXPPP-PPXXXXXXSPPPPXXGG-GXPPPPPXP 536 P G PPP PP PPP GG G PPPPP P Sbjct: 585 PAMGGGPPPAPPAPPAMGGGPPPAPGGPGAPPPPPPP 621 Score = 37.9 bits (84), Expect = 0.28 Identities = 22/66 (33%), Positives = 22/66 (33%), Gaps = 4/66 (6%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXXPPPPPXXXXXXSPP----PPXXGGGXPPPPPXPXXXA 548 PP GG PP PPP PP PP GGG PP P P Sbjct: 557 PPPSFGGAAGGGPPPPAPPQMFNGAPPPPAMGGGPPPAPPAPPAMGGGPPPAPGGPGAPP 616 Query: 549 XXXXPP 566 PP Sbjct: 617 PPPPPP 622 Score = 36.3 bits (80), Expect = 0.86 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = +1 Query: 439 GXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 G PPP P PPPP G PPP PP PP Sbjct: 566 GGGPPPPAPPQMFNGAPPPPAMGGG-PPPAPPAPPAMGGGPPP 607 Score = 35.5 bits (78), Expect = 1.5 Identities = 21/68 (30%), Positives = 22/68 (32%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXX 560 PP+ G G PP PP PP P P G PPPPP A Sbjct: 574 PPQMFNGAPPPPAMGGGPPPA--PPAPPAMGGGPPPAPGGPGAPPPPPPPPGLGGAPKKE 631 Query: 561 PPXXXXXG 584 P G Sbjct: 632 DPQADLMG 639 Score = 34.3 bits (75), Expect = 3.5 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = -2 Query: 520 GGXPPPXXGGGGXXFXXXXGGGGGXXPXGGXXPXFXKXXPPPPPRGG 380 G PPP GGG GG P P PPPP GG Sbjct: 580 GAPPPPAMGGGPPPAPPAPPAMGGGPPPAPGGPGAPPPPPPPPGLGG 626 Score = 33.9 bits (74), Expect = 4.6 Identities = 20/52 (38%), Positives = 20/52 (38%), Gaps = 2/52 (3%) Frame = +3 Query: 435 PXGXXPPPPPXXXXXXSPPPPXXGG--GXPPPPPXPXXXAXXXXPPXXXXXG 584 P G P PP PPPP GG G PPPP P PP G Sbjct: 546 PGGPPAPAPP-------PPPPSFGGAAGGGPPPPAPPQMFNGAPPPPAMGGG 590 >UniRef50_UPI00004D7E7F Cluster: CDNA FLJ45135 fis, clone BRAWH3038252, highly similar to Formin 1 isoform IV.; n=4; Xenopus tropicalis|Rep: CDNA FLJ45135 fis, clone BRAWH3038252, highly similar to Formin 1 isoform IV. - Xenopus tropicalis Length = 1182 Score = 46.4 bits (105), Expect = 8e-04 Identities = 18/35 (51%), Positives = 18/35 (51%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 P PPPPP PPPP GG PPPPP P Sbjct: 673 PGFSSVPPPPPLPDLSSVPPPPPFPGGGPPPPPPP 707 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/47 (40%), Positives = 21/47 (44%), Gaps = 2/47 (4%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGG--GXPPPPPXPXXXAXXXXPP 566 P PPPPP +PPPP G PPPPP P + PP Sbjct: 649 PGSSSVPPPPPLPGISSAPPPPPLPGFSSVPPPPPLPDLSSVPPPPP 695 Score = 41.9 bits (94), Expect = 0.017 Identities = 19/46 (41%), Positives = 19/46 (41%), Gaps = 1/46 (2%) Frame = +1 Query: 433 PXGXXXPPPPPXXX-KXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 P PPPPP PPPP G PPPPPL PP Sbjct: 649 PGSSSVPPPPPLPGISSAPPPPPLPGFSSVPPPPPLPDLSSVPPPP 694 Score = 41.5 bits (93), Expect = 0.023 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PPPP PPPP G PPPPPL PP Sbjct: 644 PPPPLPGSSSVPPPPPLPGISSAPPPPPLPGFSSVPPPP 682 Score = 41.1 bits (92), Expect = 0.030 Identities = 18/41 (43%), Positives = 19/41 (46%), Gaps = 2/41 (4%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGG--GXPPPPPXPXXXAXXXXPP 566 PPPPP PPPP G PPPPP P + PP Sbjct: 643 PPPPPLPGSSSVPPPPPLPGISSAPPPPPLPGFSSVPPPPP 683 Score = 38.7 bits (86), Expect = 0.16 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 2/47 (4%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXG--GGXPPPPPXPXXXAXXXXPP 566 P PPPPP PPPP PPPPP P PP Sbjct: 661 PGISSAPPPPPLPGFSSVPPPPPLPDLSSVPPPPPFPGGGPPPPPPP 707 Score = 38.3 bits (85), Expect = 0.21 Identities = 18/40 (45%), Positives = 18/40 (45%), Gaps = 2/40 (5%) Frame = +1 Query: 454 PPPPXXX--KXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PPPP PPPP G PPPPPL A PP Sbjct: 631 PPPPLLPGFPSVPPPPPLPGSSSVPPPPPLPGISSAPPPP 670 Score = 37.1 bits (82), Expect = 0.50 Identities = 17/41 (41%), Positives = 18/41 (43%), Gaps = 2/41 (4%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGG--GXPPPPPXPXXXAXXXXPP 566 PPPP PPPP G PPPPP P + PP Sbjct: 631 PPPPLLPGFPSVPPPPPLPGSSSVPPPPPLPGISSAPPPPP 671 Score = 37.1 bits (82), Expect = 0.50 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 2/41 (4%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXX--GXXXPPPPPPLXXXXXAXXPP 567 PPPPP PPPP G PPPPP A PP Sbjct: 679 PPPPPLPDLSSVPPPPPFPGGGPPPPPPPFPGYGSSAVPPP 719 Score = 34.3 bits (75), Expect = 3.5 Identities = 17/48 (35%), Positives = 17/48 (35%), Gaps = 2/48 (4%) Frame = +1 Query: 430 PPXGXXXPPPPP--XXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 P G PPPP PPPP PPPPP PP Sbjct: 659 PLPGISSAPPPPPLPGFSSVPPPPPLPDLSSVPPPPPFPGGGPPPPPP 706 >UniRef50_Q4RLQ7 Cluster: Chromosome 10 SCAF15019, whole genome shotgun sequence; n=2; Tetraodontidae|Rep: Chromosome 10 SCAF15019, whole genome shotgun sequence - Tetraodon nigroviridis (Green puffer) Length = 579 Score = 46.4 bits (105), Expect = 8e-04 Identities = 21/49 (42%), Positives = 21/49 (42%), Gaps = 1/49 (2%) Frame = +3 Query: 423 GXXPPXGXXPPPPPXXXXXXSPPPPXXGG-GXPPPPPXPXXXAXXXXPP 566 G PP PPPP PPPP G G PPPPP P PP Sbjct: 357 GAPPPPPPPPPPPGFLGPPPPPPPPLPGNTGAPPPPPPPPPLPGGGPPP 405 Score = 46.0 bits (104), Expect = 0.001 Identities = 20/48 (41%), Positives = 20/48 (41%) Frame = +3 Query: 423 GXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 G PP PPPP PPPP G G PPPPP PP Sbjct: 401 GGPPPPPPPPPPPGLPGAGPPPPPPPPGCGPPPPPPMGSFGQKPENPP 448 Score = 43.6 bits (98), Expect = 0.006 Identities = 23/52 (44%), Positives = 23/52 (44%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 PP G G P PPPPP PPPP GGG PPPPP P Sbjct: 366 PPPPGFLGPPPPPPPPLPGNTGAPPPPP-------PPPPLPGGGPPPPPPPP 410 Score = 43.6 bits (98), Expect = 0.006 Identities = 22/52 (42%), Positives = 22/52 (42%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 PP G G P G PPPPP PPP G G PPPPP P Sbjct: 380 PPLPGNTGAPPPPPPPPPLPGGGPPPPPPPP----PPPGLPGAGPPPPPPPP 427 Score = 41.9 bits (94), Expect = 0.017 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPP PPPP G PPPPP PP Sbjct: 359 PPPPPPPPPPPGFLGPPPPPPPPLPGNTGAPPPPPPPPPLPGGGPP 404 Score = 38.7 bits (86), Expect = 0.16 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 6/49 (12%) Frame = +1 Query: 439 GXXXPPPPPXXXKXXXPPPPXX------GXXXPPPPPPLXXXXXAXXPP 567 G PPPPP PPPP G PPPPPP PP Sbjct: 373 GPPPPPPPPLPGNTGAPPPPPPPPPLPGGGPPPPPPPPPPPGLPGAGPP 421 Score = 37.9 bits (84), Expect = 0.28 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = +1 Query: 439 GXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 G PPPPP PPPP PPPPPP PP Sbjct: 387 GAPPPPPPPPPLPGGGPPPP------PPPPPPPGLPGAGPPPP 423 Score = 36.7 bits (81), Expect = 0.65 Identities = 20/48 (41%), Positives = 20/48 (41%), Gaps = 2/48 (4%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXG--XXXPPPPPPLXXXXXAXXPP 567 PP PPPPP PPPP G PPPPPP PP Sbjct: 396 PPLPGGGPPPPP-------PPPPPPGLPGAGPPPPPPPPGCGPPPPPP 436 Score = 35.5 bits (78), Expect = 1.5 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +2 Query: 431 PPXGXXXPPPPXXXXKXXXPPPXXXGXXXPPPPXPXXXXXXXXPPP 568 PP PPPP PPP G PPPP PP Sbjct: 403 PPPPPPPPPPPGLPGAGPPPPPPPPGCGPPPPPPMGSFGQKPENPP 448 >UniRef50_Q9XIE0 Cluster: F23H11.22 protein; n=1; Arabidopsis thaliana|Rep: F23H11.22 protein - Arabidopsis thaliana (Mouse-ear cress) Length = 929 Score = 46.4 bits (105), Expect = 8e-04 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PPPPP PPPP G PPPPP P PP Sbjct: 386 PPPPPSAAAPPPPPPPKKGPAAPPPPPPPGKKGAGPPPP 424 Score = 45.6 bits (103), Expect = 0.001 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PPPPP PPPP G PPPPPP PP Sbjct: 386 PPPPPSAAAPPPPPPPKKGPAAPPPPPPPGKKGAGPPPP 424 Score = 41.9 bits (94), Expect = 0.017 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PPPPP PPPP G PPPP P PP Sbjct: 385 PPPPPPSAAAPPPPPPPKKGPAAPPPPPPPGKKGAGPPP 423 Score = 41.5 bits (93), Expect = 0.023 Identities = 19/47 (40%), Positives = 20/47 (42%), Gaps = 2/47 (4%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGG--GXPPPPPXPXXXAXXXXPP 566 P PPPPP +PPPP G G PPPP P PP Sbjct: 390 PSAAAPPPPPPPKKGPAAPPPPPPPGKKGAGPPPPPPMSKKGPPKPP 436 Score = 39.5 bits (88), Expect = 0.093 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PP SPPPP PPPP P PP Sbjct: 372 PPAPPGPANQTSPPPPPPPSAAAPPPPPPPKKGPAAPPP 410 Score = 38.7 bits (86), Expect = 0.16 Identities = 16/39 (41%), Positives = 17/39 (43%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 P PP + PPPP PPPPPP A PP Sbjct: 373 PAPPGPANQTSPPPPPPPSAAAPPPPPPPKKGPAAPPPP 411 Score = 38.7 bits (86), Expect = 0.16 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 3/49 (6%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXX---PPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPPP K PPPP PPPPP PP Sbjct: 388 PPPSAAAPPPPPPPKKGPAAPPPPPPPGKKGAGPPPPPPMSKKGPPKPP 436 Score = 37.9 bits (84), Expect = 0.28 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PP PPPP PPPPP A PP Sbjct: 372 PPAPPGPANQTSPPPPPPPSAAAPPPPPPPKKGPAAPPP 410 Score = 37.1 bits (82), Expect = 0.50 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = +3 Query: 453 PPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPPXXXXXG 584 PP P PPPP PPPPP A PP G Sbjct: 375 PPGPANQTSPPPPPPPSAAAPPPPPPPKKGPAAPPPPPPPGKKG 418 Score = 36.3 bits (80), Expect = 0.86 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +2 Query: 452 PPPPXXXXKXXXPPPXXXGXXXPPPPXPXXXXXXXXPPP 568 PPPP PPP PPPP P PPP Sbjct: 387 PPPPSAAAPPPPPPPKKGPAAPPPPPPPGKKGAGPPPPP 425 Score = 35.5 bits (78), Expect = 1.5 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP P PPPP PPPPP A PP Sbjct: 375 PPGPANQTSPPPPPPPSAAAPPPPPPPKKGPAAPPPPPP 413 Score = 33.1 bits (72), Expect = 8.1 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 1/35 (2%) Frame = +3 Query: 435 PXGXXPPPPPXXXXXXSPPPPXX-GGGXPPPPPXP 536 P PPPPP PPPP G P PP P Sbjct: 405 PAAPPPPPPPGKKGAGPPPPPPMSKKGPPKPPGNP 439 >UniRef50_Q9LUI1 Cluster: Extensin protein-like; n=10; Magnoliophyta|Rep: Extensin protein-like - Arabidopsis thaliana (Mouse-ear cress) Length = 470 Score = 46.4 bits (105), Expect = 8e-04 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 386 PPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPP 430 Score = 44.8 bits (101), Expect = 0.002 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPPP PPPP PPPPPP PP Sbjct: 384 PPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPP 429 Score = 43.6 bits (98), Expect = 0.006 Identities = 20/48 (41%), Positives = 20/48 (41%) Frame = +3 Query: 423 GXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 G PP PPPPP PPPP PPPPP P PP Sbjct: 373 GCSPPSPPPPPPPPPPPPPPPPPPPPP---PPPPPPPPYVYPSPPPPP 417 Score = 42.7 bits (96), Expect = 0.010 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PPPPP PPPP PPPPPP PP Sbjct: 380 PPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPP 418 Score = 41.9 bits (94), Expect = 0.017 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PPPPP PPPP PPPPPP PP Sbjct: 379 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPP 417 Score = 41.9 bits (94), Expect = 0.017 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPPP PPPP PPPPP PP Sbjct: 383 PPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPP 428 Score = 41.5 bits (93), Expect = 0.023 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPPP PPPP P PPPP PP Sbjct: 382 PPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPP 427 Score = 41.1 bits (92), Expect = 0.030 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPPP PPPP PPPPP PP Sbjct: 396 PPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPPPYVYPPPPSPP 441 Score = 39.9 bits (89), Expect = 0.070 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = +1 Query: 439 GXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 G P PPP PPPP PPPPPP PP Sbjct: 373 GCSPPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPP 415 Score = 37.1 bits (82), Expect = 0.50 Identities = 18/48 (37%), Positives = 18/48 (37%), Gaps = 3/48 (6%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXP---PPPPXPXXXAXXXXPP 566 PP PPPPP PPP P PPPP P PP Sbjct: 394 PPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPPPYVYPPPPSPP 441 Score = 33.5 bits (73), Expect = 6.1 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +1 Query: 433 PXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPP 531 P PPPPP PPPP PPPPP Sbjct: 420 PPPYVYPPPPP---PYVYPPPPSPPYVYPPPPP 449 >UniRef50_Q3HTK4 Cluster: Pherophorin-C3 protein precursor; n=1; Chlamydomonas reinhardtii|Rep: Pherophorin-C3 protein precursor - Chlamydomonas reinhardtii Length = 443 Score = 46.4 bits (105), Expect = 8e-04 Identities = 19/45 (42%), Positives = 20/45 (44%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P + PP Sbjct: 228 PPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPSPPPPSPNPPPP 272 Score = 46.0 bits (104), Expect = 0.001 Identities = 19/46 (41%), Positives = 20/46 (43%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPPP PPPP PPPPPP + PP Sbjct: 225 PPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPSPPPPSPNPP 270 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPPP PPPP PPPPPP PP Sbjct: 226 PPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPSPPPPSPNPPP 271 Score = 43.2 bits (97), Expect = 0.008 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +1 Query: 433 PXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 P PPPPP PPPP PPPPPP PP Sbjct: 219 PVASPSPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPSPP 263 Score = 42.7 bits (96), Expect = 0.010 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 P PPPPP PPPP PPPPP P PP Sbjct: 219 PVASPSPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPSPP 263 Score = 36.3 bits (80), Expect = 0.86 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PPPP SP PP PPPPP P PP Sbjct: 211 PPPPFRDRPVASPSPPPPPPPPPPPPPPPPPSPPPPPPP 249 Score = 35.1 bits (77), Expect = 2.0 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPP 534 PP PPPPP PPPP P PPPP Sbjct: 243 PPPPPPPPPPPPPPPPPPSPPPP-----SPNPPPP 272 Score = 34.7 bits (76), Expect = 2.6 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +1 Query: 433 PXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 P PPPP P PP PPPPPP PP Sbjct: 205 PTPVSAPPPPFRDRPVASPSPPPPPPPPPPPPPPPPPSPPPPPPP 249 Score = 34.7 bits (76), Expect = 2.6 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 PP PPPPP SPPPP PPPP P Sbjct: 245 PPPPPPPPPPP-PPPPPSPPPPSPN---PPPPKGP 275 Score = 34.3 bits (75), Expect = 3.5 Identities = 16/41 (39%), Positives = 17/41 (41%), Gaps = 3/41 (7%) Frame = +1 Query: 454 PPPPXXXKXXX---PPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PPPP + PPPP PPPPPP PP Sbjct: 211 PPPPFRDRPVASPSPPPPPPPPPPPPPPPPPSPPPPPPPPP 251 Score = 34.3 bits (75), Expect = 3.5 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 PP PPPPP SP PP G P P P Sbjct: 249 PPPPPPPPPPPPSPPPPSPNPPPPKGPSPTPNNFP 283 Score = 33.5 bits (73), Expect = 6.1 Identities = 18/58 (31%), Positives = 18/58 (31%) Frame = +3 Query: 393 GGGGXXFXXXGXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 G GG F PP P PPPP PPP P P PP Sbjct: 198 GPGGPTFPTPVSAPPPPFRDRPVASPSPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPP 255 >UniRef50_A7S5P1 Cluster: Predicted protein; n=1; Nematostella vectensis|Rep: Predicted protein - Nematostella vectensis Length = 1254 Score = 46.4 bits (105), Expect = 8e-04 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PP PPPP GG PPPPP P PP Sbjct: 500 PPAPPLPGGSAPPPPPPPGGSVPPPPPLPGGTCSSGPPP 538 Score = 46.4 bits (105), Expect = 8e-04 Identities = 20/38 (52%), Positives = 20/38 (52%), Gaps = 4/38 (10%) Frame = +3 Query: 435 PXGXXPPPPPXXXXXXSPPPPXXGG----GXPPPPPXP 536 P G PPPPP PPPP GG G PPPPP P Sbjct: 506 PGGSAPPPPPPPGGSVPPPPPLPGGTCSSGPPPPPPPP 543 Score = 40.3 bits (90), Expect = 0.053 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 PPP P P PP GG PPPPP P Sbjct: 489 PPPKPVARASAPPAPPLPGGSAPPPPPPP 517 Score = 39.9 bits (89), Expect = 0.070 Identities = 18/38 (47%), Positives = 18/38 (47%), Gaps = 3/38 (7%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXG---XXXPPPPPP 534 P G PPPPP PPPP G PPPPPP Sbjct: 504 PLPGGSAPPPPPPPGGSVPPPPPLPGGTCSSGPPPPPP 541 Score = 38.3 bits (85), Expect = 0.21 Identities = 16/39 (41%), Positives = 17/39 (43%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PP PPPP G PPPPP + PP Sbjct: 500 PPAPPLPGGSAPPPPPPPGGSVPPPPPLPGGTCSSGPPP 538 Score = 37.5 bits (83), Expect = 0.37 Identities = 15/38 (39%), Positives = 17/38 (44%) Frame = +3 Query: 453 PPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PPP +PP P GG PPPP P + PP Sbjct: 489 PPPKPVARASAPPAPPLPGGSAPPPPPPPGGSVPPPPP 526 Score = 36.7 bits (81), Expect = 0.65 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +2 Query: 452 PPPPXXXXKXXXPPPXXXGXXXPPPPXPXXXXXXXXPPP 568 P PP PPP G PPPP P PPP Sbjct: 501 PAPPLPGGSAPPPPPPPGGSVPPPPPLPGGTCSSGPPPP 539 >UniRef50_A2F502 Cluster: Formin Homology 2 Domain containing protein; n=2; Trichomonas vaginalis G3|Rep: Formin Homology 2 Domain containing protein - Trichomonas vaginalis G3 Length = 1139 Score = 46.4 bits (105), Expect = 8e-04 Identities = 18/35 (51%), Positives = 18/35 (51%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPP 534 PP G PPPPP PPPP G PPPPP Sbjct: 531 PPSGTAPPPPPPPPGLVPPPPPPPPGASLVPPPPP 565 Score = 44.8 bits (101), Expect = 0.002 Identities = 19/36 (52%), Positives = 19/36 (52%) Frame = +3 Query: 423 GXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPP 530 G PP PPPPP PPPP G G PPPPP Sbjct: 611 GLVPP----PPPPPPGAGGIPPPPPPPGAGIPPPPP 642 Score = 44.4 bits (100), Expect = 0.003 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPPXXXXXG 584 PPPPP PPP G PPPPP P A PP G Sbjct: 564 PPPPPGAPGLVPSPPPGAAGLVPPPPPPPPPGASLVPPPPPPPPG 608 Score = 44.4 bits (100), Expect = 0.003 Identities = 20/54 (37%), Positives = 20/54 (37%) Frame = +3 Query: 423 GXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPPXXXXXG 584 G PP PPP PPPP G PPPPP P PP G Sbjct: 583 GLVPPPPPPPPPGASLVPPPPPPPPGAAGLVPPPPPPPPGAGGIPPPPPPPGAG 636 Score = 43.6 bits (98), Expect = 0.006 Identities = 24/67 (35%), Positives = 24/67 (35%), Gaps = 5/67 (7%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPPP-----PPXPXXX 545 PP G G P G PPPPP PPPP G PPP PP P Sbjct: 604 PPPPGAAGLVPPPPPPPPGAGGIPPPPPPPGAGIPPPPPGVPGIPPPPGAPGLPPPPPGV 663 Query: 546 AXXXXPP 566 PP Sbjct: 664 PGIPPPP 670 Score = 42.7 bits (96), Expect = 0.010 Identities = 23/66 (34%), Positives = 23/66 (34%), Gaps = 4/66 (6%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXXPPPPPXXXXXXS----PPPPXXGGGXPPPPPXPXXXA 548 PP G G P PPPPP PPPP G G PPPP P Sbjct: 577 PPPGAAGLVPPPPPPPPPGASLVPPPPPPPPGAAGLVPPPPPPPPGAGGIPPPPPPPGAG 636 Query: 549 XXXXPP 566 PP Sbjct: 637 IPPPPP 642 Score = 41.1 bits (92), Expect = 0.030 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 3/49 (6%) Frame = +1 Query: 430 PPXGXX---XPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPPP PPPP PPPPPP PP Sbjct: 530 PPPSGTAPPPPPPPPGLVPPPPPPPPGASLVPPPPPPPPGAPGLVPSPP 578 Score = 40.7 bits (91), Expect = 0.040 Identities = 25/73 (34%), Positives = 25/73 (34%), Gaps = 5/73 (6%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPX--GXXPPPPPXXXXXXSPPPPXXGGGX---PPPPPXPXXX 545 PP G PP G P PPP PPPP G PPPPP P Sbjct: 550 PPPPPPGASLVPPPPPPPPGAPGLVPSPPPGAAGLVPPPPPPPPPGASLVPPPPPPPPGA 609 Query: 546 AXXXXPPXXXXXG 584 A PP G Sbjct: 610 AGLVPPPPPPPPG 622 Score = 40.3 bits (90), Expect = 0.053 Identities = 19/52 (36%), Positives = 19/52 (36%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 PP G PP PPPP PPPP G PPPP P Sbjct: 603 PPPPPGAAGLVPPPPPPPPGAGGIPPPPPPPGAGIPPPPPGVPGIPPPPGAP 654 Score = 39.5 bits (88), Expect = 0.093 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +1 Query: 457 PPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PPP PPPP G PPPPPP PP Sbjct: 529 PPPPSGTAPPPPPPPPGLVPPPPPPPPGASLVPPPPP 565 Score = 38.7 bits (86), Expect = 0.16 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 3/49 (6%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXP---PPPPPLXXXXXAXXPP 567 PP G PPPPP PPPP P P PPP PP Sbjct: 542 PPPGLVPPPPPPPPGASLVPPPPPPPPGAPGLVPSPPPGAAGLVPPPPP 590 Score = 38.7 bits (86), Expect = 0.16 Identities = 20/50 (40%), Positives = 20/50 (40%), Gaps = 4/50 (8%) Frame = +1 Query: 430 PPXGXXX---PPPPPXXXKXXXP-PPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP G PPPPP P PPP PPPPPP PP Sbjct: 553 PPPGASLVPPPPPPPPGAPGLVPSPPPGAAGLVPPPPPPPPPGASLVPPP 602 Score = 38.7 bits (86), Expect = 0.16 Identities = 17/37 (45%), Positives = 17/37 (45%), Gaps = 3/37 (8%) Frame = +1 Query: 430 PPXGXX---XPPPPPXXXKXXXPPPPXXGXXXPPPPP 531 PP PPPPP PPPP G PPPPP Sbjct: 606 PPGAAGLVPPPPPPPPGAGGIPPPPPPPGAGIPPPPP 642 Score = 38.3 bits (85), Expect = 0.21 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +3 Query: 456 PPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PPP PPPP G PPPPP P PP Sbjct: 529 PPPPSGTAPPPPPPPPGLVPPPPPPPPGASLVPPPPP 565 Score = 38.3 bits (85), Expect = 0.21 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP G P P P A PP Sbjct: 543 PPGLVPPPPPPPPGASLVPPPPPPPPGAPGLVPSPPPGAAGLVPP 587 Score = 37.9 bits (84), Expect = 0.28 Identities = 19/50 (38%), Positives = 19/50 (38%), Gaps = 4/50 (8%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXX----PPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPPP PPPP G PPPPP PP Sbjct: 593 PPGASLVPPPPPPPPGAAGLVPPPPPPPPGAGGIPPPPPPPGAGIPPPPP 642 Score = 37.9 bits (84), Expect = 0.28 Identities = 20/50 (40%), Positives = 20/50 (40%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPP 530 PP G G PP G PPP PPPP G PPPPP Sbjct: 632 PPGAGIPPPPPGVPGIPPPPGAPGLPPPPPGVPGIPPPP-GAPGLPPPPP 680 Score = 37.5 bits (83), Expect = 0.37 Identities = 21/55 (38%), Positives = 21/55 (38%), Gaps = 3/55 (5%) Frame = +3 Query: 381 PPRGGGG---GXXFXXXGXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 PP G GG G PP P PP PPPP G PPPP P Sbjct: 619 PPPGAGGIPPPPPPPGAGIPPPPPGVPGIPPPPGAPGLPPPPPGVPGIPPPPGAP 673 Score = 37.5 bits (83), Expect = 0.37 Identities = 18/35 (51%), Positives = 18/35 (51%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPP 534 PP G PPPPP PPPP G PPPPP Sbjct: 631 PPPGAGIPPPPPGV--PGIPPPP--GAPGLPPPPP 661 Score = 35.5 bits (78), Expect = 1.5 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PPPP PPPP PPPPP PP Sbjct: 529 PPPPSGTAPPPPPPPPGLVPPPPPPPPGASLVPPPPPPP 567 Score = 35.1 bits (77), Expect = 2.0 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PPPP PPPP PPPPP PP Sbjct: 529 PPPPSGTAPPPPPPPPGLVPPPPPPPPGASLVPPPPPPP 567 Score = 35.1 bits (77), Expect = 2.0 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPP 534 PP PPPPP PPPP G PPPPP Sbjct: 650 PPGAPGLPPPPPGVP--GIPPPP--GAPGLPPPPP 680 Score = 34.7 bits (76), Expect = 2.6 Identities = 17/40 (42%), Positives = 17/40 (42%), Gaps = 5/40 (12%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPP-----PPPP 534 PP G PPPP PPP G PP PPPP Sbjct: 640 PPPGVPGIPPPPGAPGLPPPPPGVPGIPPPPGAPGLPPPP 679 >UniRef50_A0DA74 Cluster: Chromosome undetermined scaffold_43, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_43, whole genome shotgun sequence - Paramecium tetraurelia Length = 1401 Score = 46.4 bits (105), Expect = 8e-04 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP G PPPP PPPP G G PPPPP P PP Sbjct: 833 PPGGKSAPPPPP------PPPPPGGKGAPPPPPPPPPPGSKTGPP 871 Score = 44.8 bits (101), Expect = 0.002 Identities = 25/73 (34%), Positives = 26/73 (35%), Gaps = 5/73 (6%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXP-----PXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXX 545 PP GG G P P PPPPP +PPPP GG PP P P Sbjct: 847 PPPGGKGAPPPPPPPPPPGSKTGPPPPPPPPPPGAKTGSAPPPPPPPGGPRPPGPPPPPG 906 Query: 546 AXXXXPPXXXXXG 584 PP G Sbjct: 907 GAPPLPPGPRPPG 919 Score = 41.5 bits (93), Expect = 0.023 Identities = 20/51 (39%), Positives = 20/51 (39%), Gaps = 6/51 (11%) Frame = +3 Query: 432 PPXGXXPPPP------PXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPP P PPPP G PPPPP P PP Sbjct: 806 PPPPPPPPPPGGSKTLPRPPPPPPPPPPPGGKSAPPPPPPPPPPGGKGAPP 856 Score = 41.5 bits (93), Expect = 0.023 Identities = 25/70 (35%), Positives = 25/70 (35%), Gaps = 2/70 (2%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPP--PPPXPXXXAXX 554 PP GG PP G PPPP PPPP G PP PPP P Sbjct: 831 PPPPGGKSAPPPPPPPPPPGGKGAPPPPPP-----PPPPGSKTGPPPPPPPPPPGAKTGS 885 Query: 555 XXPPXXXXXG 584 PP G Sbjct: 886 APPPPPPPGG 895 Score = 39.5 bits (88), Expect = 0.093 Identities = 21/49 (42%), Positives = 21/49 (42%), Gaps = 3/49 (6%) Frame = +1 Query: 430 PPXGXXX---PPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP G PPPPP PPPP G PPPPPP PP Sbjct: 814 PPGGSKTLPRPPPPPP------PPPPPGGKSAPPPPPPPPPPGGKGAPP 856 Score = 37.5 bits (83), Expect = 0.37 Identities = 19/50 (38%), Positives = 19/50 (38%) Frame = +3 Query: 435 PXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPPXXXXXG 584 P PPPPP S PPP PPPPP P PP G Sbjct: 822 PRPPPPPPPPPPPGGKSAPPP------PPPPPPPGGKGAPPPPPPPPPPG 865 Score = 36.7 bits (81), Expect = 0.65 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP G P P PPP PPPPPP A PP Sbjct: 813 PPPGGSKTLPRPPPPPPPPPPPGGKSAPPPPPPPPPPGGKGAPPPP 858 Score = 36.3 bits (80), Expect = 0.86 Identities = 19/55 (34%), Positives = 19/55 (34%), Gaps = 4/55 (7%) Frame = +2 Query: 416 KXXXXPPXGXXXPPPP----XXXXKXXXPPPXXXGXXXPPPPXPXXXXXXXXPPP 568 K PP PPPP PPP G PPPP P PPP Sbjct: 819 KTLPRPPPPPPPPPPPGGKSAPPPPPPPPPPGGKGAPPPPPPPPPPGSKTGPPPP 873 Score = 35.9 bits (79), Expect = 1.1 Identities = 23/65 (35%), Positives = 23/65 (35%), Gaps = 3/65 (4%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXXPPPPPXXXXXXSPPPPXXGGGX---PPPPPXPXXXAX 551 PP GG G PP PPPP PPPP G PPPPP Sbjct: 846 PPPPGGKGAPPPPPPPPPPGSKTGPPPPPP-----PPPPGAKTGSAPPPPPPPGGPRPPG 900 Query: 552 XXXPP 566 PP Sbjct: 901 PPPPP 905 Score = 34.7 bits (76), Expect = 2.6 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -1 Query: 404 PPPPPPGGXXXTPXGGXPPPXXG 336 PPPPPPGG P PPP G Sbjct: 829 PPPPPPGGKSAPPPPPPPPPPGG 851 Score = 33.9 bits (74), Expect = 4.6 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -1 Query: 440 PXGGXXXXXKXXPPPPPPGGXXXTPXGGXPPP 345 P G PPPPPPGG P PPP Sbjct: 832 PPPGGKSAPPPPPPPPPPGGKGAPPPPPPPPP 863 Score = 33.5 bits (73), Expect = 6.1 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -1 Query: 404 PPPPPPGGXXXTPXGGXPPPXXGXK 330 PPPPPP G P PPP G K Sbjct: 828 PPPPPPPGGKSAPPPPPPPPPPGGK 852 Score = 33.5 bits (73), Expect = 6.1 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -1 Query: 404 PPPPPPGGXXXTPXGGXPPPXXGXK 330 PPPPPP G P PPP G K Sbjct: 843 PPPPPPPGGKGAPPPPPPPPPPGSK 867 Score = 33.1 bits (72), Expect = 8.1 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -1 Query: 404 PPPPPPGGXXXTPXGGXPPP 345 PPPPPPGG P PPP Sbjct: 810 PPPPPPGGSKTLPRPPPPPP 829 Score = 33.1 bits (72), Expect = 8.1 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -3 Query: 354 PPPXXGXKXXXXXXPPXKKXPPPPPXGGXGXP 259 PPP G K PP PPPPP GG P Sbjct: 812 PPPPGGSKTLPRPPPPP---PPPPPPGGKSAP 840 Score = 33.1 bits (72), Expect = 8.1 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = -1 Query: 464 GGGGGXXXPXGGXXXXXKXXPPPPPPGGXXXTPXGGXPPP 345 GG G P K PPPPPP G PPP Sbjct: 850 GGKGAPPPPPPPPPPGSKTGPPPPPPPPPPGAKTGSAPPP 889 >UniRef50_UPI000049A0E6 Cluster: diaphanous protein; n=1; Entamoeba histolytica HM-1:IMSS|Rep: diaphanous protein - Entamoeba histolytica HM-1:IMSS Length = 1176 Score = 46.0 bits (104), Expect = 0.001 Identities = 20/43 (46%), Positives = 20/43 (46%), Gaps = 1/43 (2%) Frame = +3 Query: 441 GXXPPPPPXXXXXXSPPPPXXG-GGXPPPPPXPXXXAXXXXPP 566 G PPPPP PPPP G G PPPPP P PP Sbjct: 627 GMPPPPPPPGMPGMPPPPPPPGMPGMPPPPPPPGMPGMPPPPP 669 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPPXXXXXG 584 PPPPP PPPP G PPPPP P PP G Sbjct: 607 PPPPPGASSIPPPPPPPGMPGMPPPPPPPGMPGMPPPPPPPGMPG 651 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPPXXXXXG 584 PPPPP PPPP G PPPPP P PP G Sbjct: 619 PPPPPGMPGMPPPPPPPGMPGMPPPPPPPGMPGMPPPPPPPGMPG 663 Score = 44.0 bits (99), Expect = 0.004 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPPP PPPP G PPPPP PP Sbjct: 646 PPGMPGMPPPPPPPGMPGMPPPPPPGMPGMPPPPPGMPGMPPPPPP 691 Score = 43.6 bits (98), Expect = 0.006 Identities = 24/72 (33%), Positives = 24/72 (33%), Gaps = 2/72 (2%) Frame = +1 Query: 358 PPXGVXSXXXXXXXXXXFXXXXXXPPXGXXX--PPPPPXXXKXXXPPPPXXGXXXPPPPP 531 PP G S PP G PPPPP PPPP G PPPP Sbjct: 609 PPPGASSIPPPPPPPGMPGMPPPPPPPGMPGMPPPPPPPGMPGMPPPPPPPGMPGMPPPP 668 Query: 532 PLXXXXXAXXPP 567 P PP Sbjct: 669 PPGMPGMPPPPP 680 Score = 43.2 bits (97), Expect = 0.008 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = +3 Query: 441 GXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 G PPPPP PPPP G PPPP P PP Sbjct: 639 GMPPPPPPPGMPGMPPPPPPPGMPGMPPPPPPGMPGMPPPPP 680 Score = 41.9 bits (94), Expect = 0.017 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PPPPP PPPP G PPPPP PP Sbjct: 606 PPPPPPGASSIPPPPPPPGMPGMPPPPPPPGMPGMPPPP 644 Score = 41.5 bits (93), Expect = 0.023 Identities = 18/35 (51%), Positives = 18/35 (51%), Gaps = 2/35 (5%) Frame = +3 Query: 432 PPXGXX--PPPPPXXXXXXSPPPPXXGGGXPPPPP 530 PP G PPPPP PPPP G PPPPP Sbjct: 657 PPPGMPGMPPPPPPGMPGMPPPPPGMPGMPPPPPP 691 Score = 41.1 bits (92), Expect = 0.030 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PPPPP PPPP G PPPP P PP Sbjct: 606 PPPPPPGASSIPPPPPPPGMPGMPPPPPPPGMPGMPPPP 644 Score = 40.3 bits (90), Expect = 0.053 Identities = 18/37 (48%), Positives = 18/37 (48%), Gaps = 2/37 (5%) Frame = +3 Query: 432 PPXGXX--PPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 PP G PPPPP PPPP G PPPP P Sbjct: 668 PPPGMPGMPPPPPGMPGMPPPPPPGMPGMPPPPPGMP 704 Score = 40.3 bits (90), Expect = 0.053 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPP 531 PP G PPPP PPPP PPPPP Sbjct: 678 PPPGMPGMPPPPPPGMPGMPPPPPGMPGMPPPPP 711 Score = 39.9 bits (89), Expect = 0.070 Identities = 20/52 (38%), Positives = 20/52 (38%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 PP G G P PPPPP PPPP G PPPP P Sbjct: 632 PPPPGMPGMPPPPPPPGMPGMPPPPPPPGMPGMPPPPPPGMPGMPPPPPGMP 683 Score = 39.9 bits (89), Expect = 0.070 Identities = 18/38 (47%), Positives = 18/38 (47%), Gaps = 2/38 (5%) Frame = +3 Query: 423 GXXPPXGXXP--PPPPXXXXXXSPPPPXXGGGXPPPPP 530 G PP P PPPP PPPP G PPPPP Sbjct: 674 GMPPPPPGMPGMPPPPPPGMPGMPPPPPGMPGMPPPPP 711 Score = 39.5 bits (88), Expect = 0.093 Identities = 20/47 (42%), Positives = 20/47 (42%), Gaps = 2/47 (4%) Frame = +3 Query: 432 PPXGXXP--PPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP P PPPP PPPP G PPPPP P PP Sbjct: 656 PPPPGMPGMPPPPPPGMPGMPPPPPGMPGMPPPPP-PGMPGMPPPPP 701 Score = 39.5 bits (88), Expect = 0.093 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPP 530 PP G PPP PPPP G PPPPP Sbjct: 689 PPPGMPGMPPPPPGMPGMPPPPPGMPGMPPPPP 721 Score = 35.5 bits (78), Expect = 1.5 Identities = 16/34 (47%), Positives = 16/34 (47%), Gaps = 2/34 (5%) Frame = +3 Query: 432 PPXGXXP--PPPPXXXXXXSPPPPXXGGGXPPPP 527 PP P PPPP PPPP G PPPP Sbjct: 688 PPPPGMPGMPPPPPGMPGMPPPPPGMPGMPPPPP 721 Score = 35.1 bits (77), Expect = 2.0 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 PP G PPP PPPP G G P P P Sbjct: 699 PPPGMPGMPPPPPGMPGMPPPPPGGFGFRPAAPKP 733 >UniRef50_UPI0000F30461 Cluster: Formin-2.; n=2; Bos taurus|Rep: Formin-2. - Bos Taurus Length = 1349 Score = 46.0 bits (104), Expect = 0.001 Identities = 18/34 (52%), Positives = 18/34 (52%) Frame = +3 Query: 435 PXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 P PPPPP PPPP G G PPPPP P Sbjct: 914 PGVGIPPPPPLPGVGIPPPPPLPGVGIPPPPPLP 947 Score = 43.2 bits (97), Expect = 0.008 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPP 531 P G PPPPP PPPP G PPPPP Sbjct: 912 PLPGVGIPPPPPLPGVGIPPPPPLPGVGIPPPPP 945 Score = 42.7 bits (96), Expect = 0.010 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = +3 Query: 435 PXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 P PP PP PPPP G G PPPPP P Sbjct: 903 PGVGIPPAPPLPGVGIPPPPPLPGVGIPPPPPLP 936 Score = 41.9 bits (94), Expect = 0.017 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = +3 Query: 435 PXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 P PPP P PPPP G G PPPPP P Sbjct: 804 PEMLPPPPLPLPGVGVPPPPPLPGVGIPPPPPLP 837 Score = 39.9 bits (89), Expect = 0.070 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPP 531 P G PP PP PPPP G PPPPP Sbjct: 901 PLPGVGIPPAPPLPGVGIPPPPPLPGVGIPPPPP 934 Score = 39.5 bits (88), Expect = 0.093 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = +3 Query: 435 PXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 P PPPPP PPPP G P PPP P Sbjct: 815 PGVGVPPPPPLPGVGIPPPPPLPTVGIPTPPPLP 848 Score = 39.5 bits (88), Expect = 0.093 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = +3 Query: 435 PXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 P PPPPP PPP G G PP PP P Sbjct: 826 PGVGIPPPPPLPTVGIPTPPPLPGVGIPPAPPLP 859 Score = 39.5 bits (88), Expect = 0.093 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = +3 Query: 435 PXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 P PP PP P PP G G PPPPP P Sbjct: 848 PGVGIPPAPPLPGVGIPPAPPLPGVGIPPPPPLP 881 Score = 39.5 bits (88), Expect = 0.093 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = +3 Query: 435 PXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 P PP PP PPPP G G PP PP P Sbjct: 859 PGVGIPPAPPLPGVGIPPPPPLPGVGIPPAPPLP 892 Score = 39.5 bits (88), Expect = 0.093 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = +3 Query: 435 PXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 P PPPPP P PP G G PP PP P Sbjct: 870 PGVGIPPPPPLPGVGIPPAPPLPGVGIPPAPPLP 903 Score = 39.5 bits (88), Expect = 0.093 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = +3 Query: 435 PXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 P PP PP P PP G G PPPPP P Sbjct: 892 PGVGIPPAPPLPGVGIPPAPPLPGVGIPPPPPLP 925 Score = 37.9 bits (84), Expect = 0.28 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +3 Query: 435 PXGXXPPPPPXXXXXXSPPPPXXGGGXPPP 524 P PPPPP PPPP G G PPP Sbjct: 925 PGVGIPPPPPLPGVGIPPPPPLPGVGIPPP 954 Score = 37.5 bits (83), Expect = 0.37 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = +3 Query: 435 PXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 P G PPP PP P G G PPPPP P Sbjct: 793 PAGLSPPPCLGPEMLPPPPLPLPGVGVPPPPPLP 826 Score = 37.5 bits (83), Expect = 0.37 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPP 525 P G PPPPP PPPP G PPP Sbjct: 923 PLPGVGIPPPPPLPGVGIPPPPPLPGVGIPPP 954 Score = 36.7 bits (81), Expect = 0.65 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPP 531 P G PPPPP PPPP P PPP Sbjct: 813 PLPGVGVPPPPPLPGVGIPPPPPLPTVGIPTPPP 846 Score = 36.7 bits (81), Expect = 0.65 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPP 531 P G PPPPP PPP G PP PP Sbjct: 824 PLPGVGIPPPPPLPTVGIPTPPPLPGVGIPPAPP 857 Score = 36.7 bits (81), Expect = 0.65 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPP 531 P G PP PP P PP G PPPPP Sbjct: 846 PLPGVGIPPAPPLPGVGIPPAPPLPGVGIPPPPP 879 Score = 36.7 bits (81), Expect = 0.65 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPP 531 P G PP PP PPPP G PP PP Sbjct: 857 PLPGVGIPPAPPLPGVGIPPPPPLPGVGIPPAPP 890 Score = 36.7 bits (81), Expect = 0.65 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPP 531 P G PP PP P PP G PPPPP Sbjct: 890 PLPGVGIPPAPPLPGVGIPPAPPLPGVGIPPPPP 923 Score = 36.3 bits (80), Expect = 0.86 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PPP P PPPP G PPPPP L PP Sbjct: 809 PPPLPLPGVGVPPPPPLPGVGIPPPPP-LPTVGIPTPPP 846 Score = 36.3 bits (80), Expect = 0.86 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +3 Query: 435 PXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 P P PPP P PP G G PP PP P Sbjct: 837 PTVGIPTPPPLPGVGIPPAPPLPGVGIPPAPPLP 870 Score = 36.3 bits (80), Expect = 0.86 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +3 Query: 435 PXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 P PP PP P PP G G PP PP P Sbjct: 881 PGVGIPPAPPLPGVGIPPAPPLPGVGIPPAPPLP 914 Score = 33.5 bits (73), Expect = 6.1 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPP P PP PP PPL PP Sbjct: 823 PPLPGVGIPPPPPLPTVGIPTPPPLPGVGIPPAPPLPGVGIPPAPP 868 Score = 33.5 bits (73), Expect = 6.1 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPP 531 P G PP PP P PP G PP PP Sbjct: 879 PLPGVGIPPAPPLPGVGIPPAPPLPGVGIPPAPP 912 Score = 33.1 bits (72), Expect = 8.1 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 1/35 (2%) Frame = +1 Query: 430 PPXGXX-XPPPPPXXXKXXXPPPPXXGXXXPPPPP 531 PP PPPPP P PP G PP PP Sbjct: 867 PPLPGVGIPPPPPLPGVGIPPAPPLPGVGIPPAPP 901 >UniRef50_Q4RR29 Cluster: Chromosome 14 SCAF15003, whole genome shotgun sequence; n=2; Tetraodontidae|Rep: Chromosome 14 SCAF15003, whole genome shotgun sequence - Tetraodon nigroviridis (Green puffer) Length = 1140 Score = 46.0 bits (104), Expect = 0.001 Identities = 19/45 (42%), Positives = 20/45 (44%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP G PPPP +PPPP G PPPP P PP Sbjct: 539 PPGGPLPPPPLPCFAGLAPPPPPLPGAMMPPPPPPPPPPGGPPPP 583 Score = 42.7 bits (96), Expect = 0.010 Identities = 18/35 (51%), Positives = 18/35 (51%), Gaps = 1/35 (2%) Frame = +1 Query: 433 PXGXXXPPPP-PXXXKXXXPPPPXXGXXXPPPPPP 534 P G PPPP P PPPP G PPPPPP Sbjct: 539 PPGGPLPPPPLPCFAGLAPPPPPLPGAMMPPPPPP 573 Score = 37.1 bits (82), Expect = 0.50 Identities = 16/42 (38%), Positives = 17/42 (40%) Frame = +3 Query: 441 GXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 G PPPPP PPPP PPPP + PP Sbjct: 554 GLAPPPPPLPGAMMPPPPPPPPPPGGPPPPGRPPVSGVPPPP 595 Score = 36.7 bits (81), Expect = 0.65 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 2/36 (5%) Frame = +3 Query: 435 PXGXXPPPPPXXXXXXSPPPPXXG--GGXPPPPPXP 536 P PPPPP PPPP G PPPP P Sbjct: 563 PGAMMPPPPPPPPPPGGPPPPGRPPVSGVPPPPGAP 598 Score = 35.9 bits (79), Expect = 1.1 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPP 534 P G PPPPP PPPP PPPP Sbjct: 561 PLPGAMMPPPPPPPPPPGGPPPPGRPPVSGVPPPP 595 Score = 35.5 bits (78), Expect = 1.5 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PPPPP PPPP PPPP PP Sbjct: 557 PPPPPLPGAMMPPPPPPPPPPGGPPPPGRPPVSGVPPPP 595 Score = 34.3 bits (75), Expect = 3.5 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = +3 Query: 435 PXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPPXXXXXG 584 P G P P PP P G PPPPP P PP G Sbjct: 530 PGGPPLVPGPPGGPLPPPPLPCFAGLAPPPPPLPGAMMPPPPPPPPPPGG 579 >UniRef50_Q8YQB7 Cluster: All3916 protein; n=2; Nostocaceae|Rep: All3916 protein - Anabaena sp. (strain PCC 7120) Length = 383 Score = 46.0 bits (104), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 312 PPPPSDPPPPPDPPPPPDPPPPDPPPPDPPPPPDPPPPPDPPPPP 356 Score = 42.3 bits (95), Expect = 0.013 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPP PPPPP P PP Sbjct: 318 PPPPPDPPPPPDPPPPDPPPPDPPPPPDPPPPPDPPPPPPPDPPP 362 Score = 40.7 bits (91), Expect = 0.040 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPP 534 PP PPPPP PPPP PP PPP Sbjct: 347 PPPPDPPPPPPPDPPPPPDPPPPDRPPPPPPEPPP 381 Score = 40.7 bits (91), Expect = 0.040 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 PP PPPPP PPPP PP PP P Sbjct: 348 PPPDPPPPPPPDPPPPPDPPPPDRPPPPPPEPPPP 382 Score = 39.1 bits (87), Expect = 0.12 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPP PPP PPPPP P PP Sbjct: 324 PPPPPDPPPPDPPPPDPPPPPDPPPPPDPPPPPPPDPPPPPDPPP 368 Score = 39.1 bits (87), Expect = 0.12 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = +3 Query: 435 PXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 P PPPPP PPPP PPPPP P PP Sbjct: 335 PPPPDPPPPPDPPPPPDPPPPPPPD--PPPPPDPPPPDRPPPPP 376 Score = 38.3 bits (85), Expect = 0.21 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPP P PPPP P PPPP PP Sbjct: 335 PPPPDPPPPPDPPPPPDPPPPPPPDPPPPPDPPPPDRPPPPPPEPP 380 Score = 37.1 bits (82), Expect = 0.50 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 2/47 (4%) Frame = +3 Query: 432 PPXGXXP-PPPPXXXXXXSPPPPXXGGGXPPP-PPXPXXXAXXXXPP 566 PP P PPPP PPPP PPP PP P PP Sbjct: 327 PPDPPPPDPPPPDPPPPPDPPPPPDPPPPPPPDPPPPPDPPPPDRPP 373 Score = 36.3 bits (80), Expect = 0.86 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPP P PP P PPP PP PP Sbjct: 313 PPPSDPPPPPDPPPPPDPPPPDPPPPDPPPPPDPPPPPDPPPPPPP 358 Score = 36.3 bits (80), Expect = 0.86 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 1/36 (2%) Frame = +1 Query: 430 PPXGXX-XPPPPPXXXKXXXPPPPXXGXXXPPPPPP 534 PP PPPPP PPPP PPP PP Sbjct: 332 PPDPPPPDPPPPPDPPPPPDPPPPPPPDPPPPPDPP 367 Score = 36.3 bits (80), Expect = 0.86 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PP PP PPPP PPPP PP Sbjct: 336 PPPDPPPPPDPPPPPDPPPPPPPDPPPPPDPPPPDRPPPPPPEPPP 381 Score = 35.9 bits (79), Expect = 1.1 Identities = 18/49 (36%), Positives = 18/49 (36%), Gaps = 3/49 (6%) Frame = +1 Query: 430 PPXGXXXP---PPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP P PPPP PPPP PPPPP PP Sbjct: 319 PPPPDPPPPPDPPPPDPPPPDPPPPPDPPPPPDPPPPPPPDPPPPPDPP 367 Score = 33.5 bits (73), Expect = 6.1 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 PP PPPP PPP P PPP P Sbjct: 349 PPDPPPPPPPDPPPPPDPPPPDRPPPPPPEPPPPP 383 >UniRef50_A2XET4 Cluster: Putative uncharacterized protein; n=2; Oryza sativa|Rep: Putative uncharacterized protein - Oryza sativa subsp. indica (Rice) Length = 352 Score = 46.0 bits (104), Expect = 0.001 Identities = 21/48 (43%), Positives = 21/48 (43%), Gaps = 2/48 (4%) Frame = +1 Query: 430 PPXGXXXPPPP--PXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPP P PPPP G PPPPPPL PP Sbjct: 275 PPPQAPPPPPPNAPMGMPPRIPPPPVGGTQPPPPPPPLANGPPRSIPP 322 Score = 42.3 bits (95), Expect = 0.013 Identities = 24/71 (33%), Positives = 24/71 (33%), Gaps = 4/71 (5%) Frame = +3 Query: 384 PRGGGGGXXFXXXGXXPPXGXXPPPPPXXXXXXSPP----PPXXGGGXPPPPPXPXXXAX 551 P G GG PP PPPPP PP PP G PPPPP Sbjct: 258 PNGSGGPPRPPAPQVPPPPPQAPPPPPPNAPMGMPPRIPPPPVGGTQPPPPPPPLANGPP 317 Query: 552 XXXPPXXXXXG 584 PP G Sbjct: 318 RSIPPPPMTGG 328 >UniRef50_A0CZ14 Cluster: Chromosome undetermined scaffold_31, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_31, whole genome shotgun sequence - Paramecium tetraurelia Length = 417 Score = 46.0 bits (104), Expect = 0.001 Identities = 21/49 (42%), Positives = 22/49 (44%), Gaps = 3/49 (6%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXX---GXXXPPPPPPLXXXXXAXXPP 567 PP PPPPP + PPPP G PPPPPPL PP Sbjct: 326 PPPPPPPPPPPPIPGQQNPPPPPPPPLPGQQAPPPPPPLPGGARPPPPP 374 Score = 45.2 bits (102), Expect = 0.002 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PPPPP PPPP GG PPPP P PP Sbjct: 347 PPPPPLPGQQAPPPPPPLPGGARPPPPPPPPFGNAPPPP 385 Score = 44.8 bits (101), Expect = 0.002 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PPPP PPPP GG PPPPP P PP Sbjct: 348 PPPPLPGQQAPPPPPPLPGGARPPPPPPPPFGNAPPPPP 386 Score = 44.8 bits (101), Expect = 0.002 Identities = 19/36 (52%), Positives = 19/36 (52%), Gaps = 1/36 (2%) Frame = +1 Query: 430 PPXGXX-XPPPPPXXXKXXXPPPPXXGXXXPPPPPP 534 PP G PPPPP K PPPP G P PPPP Sbjct: 376 PPFGNAPPPPPPPPGSKIPGPPPPPGGPRPPGPPPP 411 Score = 43.2 bits (97), Expect = 0.008 Identities = 20/49 (40%), Positives = 21/49 (42%), Gaps = 3/49 (6%) Frame = +1 Query: 430 PPXGXXXPPPPPXXX---KXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 P G PPPPP + PPPP G PPPPPP PP Sbjct: 351 PLPGQQAPPPPPPLPGGARPPPPPPPPFGNAPPPPPPPPGSKIPGPPPP 399 Score = 43.2 bits (97), Expect = 0.008 Identities = 21/54 (38%), Positives = 21/54 (38%) Frame = +3 Query: 423 GXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPPXXXXXG 584 G PP PPPPP PPPP G P PPP P PP G Sbjct: 367 GARPP----PPPPPPFGNAPPPPPPPPGSKIPGPPPPPGGPRPPGPPPPPGQAG 416 Score = 42.7 bits (96), Expect = 0.010 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PPP P PPPP G PPPPP P PP Sbjct: 361 PPPLPGGARPPPPPPPPFGNAPPPPPPPPGSKIPGPPPP 399 Score = 42.3 bits (95), Expect = 0.013 Identities = 20/50 (40%), Positives = 20/50 (40%) Frame = +3 Query: 435 PXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPPXXXXXG 584 P PPPPP PPPP G PPPPP P PP G Sbjct: 321 PNSQAPPPPPPPP----PPPPIPGQQNPPPPPPPPLPGQQAPPPPPPLPG 366 Score = 42.3 bits (95), Expect = 0.013 Identities = 19/51 (37%), Positives = 19/51 (37%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPPXXXXXG 584 PP PPP P PPPP G PPPP P PP G Sbjct: 329 PPPPPPPPPIPGQQNPPPPPPPPLPGQQAPPPPPPLPGGARPPPPPPPPFG 379 Score = 42.3 bits (95), Expect = 0.013 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 P PPPPP PPPP G P PPPP PP Sbjct: 365 PGGARPPPPPPPPFGNAPPPPPPPPGSKIPGPPPPPGGPRPPGPPP 410 Score = 41.9 bits (94), Expect = 0.017 Identities = 17/39 (43%), Positives = 18/39 (46%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PPPP + PPPP G PPPPPP PP Sbjct: 348 PPPPLPGQQAPPPPPPLPGGARPPPPPPPPFGNAPPPPP 386 Score = 41.1 bits (92), Expect = 0.030 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 309 PPPPPPPPPPPLPNSQAPPPPPPP----PPPPPIPGQQNPPPPPP 349 Score = 38.3 bits (85), Expect = 0.21 Identities = 20/48 (41%), Positives = 21/48 (43%), Gaps = 3/48 (6%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXS---PPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP + PPPP PPPPP P A PP Sbjct: 288 PPPPPPPPPPPLPNSTSNVTAPPPPPP----PPPPPLPNSQAPPPPPP 331 Score = 36.7 bits (81), Expect = 0.65 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PPPPP PPPP PPPPPP PP Sbjct: 314 PPPPPPLPNSQAPPPPP-----PPPPPPPIPGQQNPPPP 347 Score = 34.3 bits (75), Expect = 3.5 Identities = 19/48 (39%), Positives = 19/48 (39%), Gaps = 3/48 (6%) Frame = +1 Query: 433 PXGXXXPPPPP---XXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 P PPPPP PPPP PPPPPPL PP Sbjct: 288 PPPPPPPPPPPLPNSTSNVTAPPPP-----PPPPPPPLPNSQAPPPPP 330 Score = 34.3 bits (75), Expect = 3.5 Identities = 18/51 (35%), Positives = 18/51 (35%), Gaps = 6/51 (11%) Frame = +1 Query: 433 PXGXXXPPPPPXXXKXXXPPPPXXGXXXP------PPPPPLXXXXXAXXPP 567 P PPPPP PPPP P PPPPP PP Sbjct: 309 PPPPPPPPPPPLPNSQAPPPPPPPPPPPPIPGQQNPPPPPPPPLPGQQAPP 359 Score = 33.5 bits (73), Expect = 6.1 Identities = 15/32 (46%), Positives = 16/32 (50%) Frame = +3 Query: 435 PXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPP 530 P G PPPPP +PPP PPPPP Sbjct: 365 PGGARPPPPPPPPFGNAPPP-------PPPPP 389 Score = 33.1 bits (72), Expect = 8.1 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Frame = -3 Query: 354 PPPXXGXKXXXXXXPPXKKXP-PPPPXGGXGXP 259 PPP G PP K P PPPP GG P Sbjct: 374 PPPPFGNAPPPPPPPPGSKIPGPPPPPGGPRPP 406 >UniRef50_A0BFK7 Cluster: Chromosome undetermined scaffold_104, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_104, whole genome shotgun sequence - Paramecium tetraurelia Length = 1152 Score = 46.0 bits (104), Expect = 0.001 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PPPPP PPPP G PPPPP P PP Sbjct: 621 PPPPPKIAAPPPPPPPPMKAGPPPPPPPPGVPRPPGGPP 659 Score = 44.8 bits (101), Expect = 0.002 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +3 Query: 435 PXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 P PPPPP PPPP PPPPP P A PP Sbjct: 603 PPPPPPPPPPVKSAPLPPPPPPPKIAAPPPPPPPPMKAGPPPPP 646 Score = 44.4 bits (100), Expect = 0.003 Identities = 22/52 (42%), Positives = 22/52 (42%), Gaps = 7/52 (13%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPP-------PXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPP P GG PPPPP P A PP Sbjct: 624 PPKIAAPPPPPPPPMKAGPPPPPPPPGVPRPPGGPPPPPPPPGSKAGGPPPP 675 Score = 43.2 bits (97), Expect = 0.008 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPP PPPP PPPPP P PP Sbjct: 603 PPPPPPPPPPVKSAPLPPPPPPPKIAAPPPPPPPPMKAGPPPPPP 647 Score = 41.9 bits (94), Expect = 0.017 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PPPPP PPPP PPPPPP PP Sbjct: 608 PPPPPVKSAPLPPPPPPPKIAAPPPPPPPPMKAGPPPPP 646 Score = 41.9 bits (94), Expect = 0.017 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PPPPP PPPP PPPPPP PP Sbjct: 621 PPPPPKIAAPPPPPPPPMKAGPPPPPPPPGVPRPPGGPP 659 Score = 40.7 bits (91), Expect = 0.040 Identities = 20/51 (39%), Positives = 20/51 (39%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPPXXXXXG 584 PP PPPP PPPP PPPPP P A PP G Sbjct: 596 PPNAPSLPPPPPP-----PPPPVKSAPLPPPPPPPKIAAPPPPPPPPMKAG 641 Score = 40.7 bits (91), Expect = 0.040 Identities = 18/39 (46%), Positives = 18/39 (46%), Gaps = 4/39 (10%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPP----PPXP 536 PP G PPPPP PPPP G PP PP P Sbjct: 654 PPGGPPPPPPPPGSKAGGPPPPPPPGAPQPPGGSAPPPP 692 Score = 40.3 bits (90), Expect = 0.053 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = +3 Query: 435 PXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPPXXXXXG 584 P PPPP PPPP G PPPPP PP G Sbjct: 617 PLPPPPPPPKIAAPPPPPPPPMKAGPPPPPPPPGVPRPPGGPPPPPPPPG 666 Score = 39.5 bits (88), Expect = 0.093 Identities = 20/51 (39%), Positives = 20/51 (39%), Gaps = 5/51 (9%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXP-----PPPPPLXXXXXAXXPP 567 PP PPPPP PPPP P PPPPP A PP Sbjct: 623 PPPKIAAPPPPPPPPMKAGPPPPPPPPGVPRPPGGPPPPPPPPGSKAGGPP 673 Score = 38.7 bits (86), Expect = 0.16 Identities = 21/68 (30%), Positives = 21/68 (30%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXX 560 PP G G P G PPPPP PPP G P PP Sbjct: 636 PPMKAGPPPPPPPPGVPRPPGGPPPPPPPPGSKAGGPPPPPPPGAPQPPGGSAPPPPFGA 695 Query: 561 PPXXXXXG 584 PP G Sbjct: 696 PPQPQNQG 703 Score = 35.5 bits (78), Expect = 1.5 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -1 Query: 404 PPPPPPGGXXXTPXGGXPPPXXG 336 PPPPPP G P G PPP G Sbjct: 672 PPPPPPPGAPQPPGGSAPPPPFG 694 Score = 34.3 bits (75), Expect = 3.5 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -1 Query: 413 KXXPPPPPPGGXXXTPXGGXPPP 345 K PPPPPP P GG PPP Sbjct: 639 KAGPPPPPPPPGVPRPPGGPPPP 661 Score = 33.1 bits (72), Expect = 8.1 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -1 Query: 404 PPPPPPGGXXXTPXGGXPPP 345 PPPPPP G P G PPP Sbjct: 643 PPPPPPPGVPRPPGGPPPPP 662 >UniRef50_Q9JL04 Cluster: Formin-2; n=4; Murinae|Rep: Formin-2 - Mus musculus (Mouse) Length = 1567 Score = 46.0 bits (104), Expect = 0.001 Identities = 18/34 (52%), Positives = 18/34 (52%) Frame = +3 Query: 435 PXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 P PPPPP PPPP G G PPPPP P Sbjct: 917 PGMGIPPPPPLPGMGIPPPPPLPGMGIPPPPPLP 950 Score = 46.0 bits (104), Expect = 0.001 Identities = 18/34 (52%), Positives = 18/34 (52%) Frame = +3 Query: 435 PXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 P PPPPP PPPP G G PPPPP P Sbjct: 928 PGMGIPPPPPLPGMGIPPPPPLPGVGIPPPPPLP 961 Score = 46.0 bits (104), Expect = 0.001 Identities = 18/34 (52%), Positives = 18/34 (52%) Frame = +3 Query: 435 PXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 P PPPPP PPPP G G PPPPP P Sbjct: 939 PGMGIPPPPPLPGVGIPPPPPLPGVGIPPPPPLP 972 Score = 46.0 bits (104), Expect = 0.001 Identities = 18/34 (52%), Positives = 18/34 (52%) Frame = +3 Query: 435 PXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 P PPPPP PPPP G G PPPPP P Sbjct: 950 PGVGIPPPPPLPGVGIPPPPPLPGVGIPPPPPLP 983 Score = 46.0 bits (104), Expect = 0.001 Identities = 18/34 (52%), Positives = 18/34 (52%) Frame = +3 Query: 435 PXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 P PPPPP PPPP G G PPPPP P Sbjct: 961 PGVGIPPPPPLPGVGIPPPPPLPGVGIPPPPPLP 994 Score = 46.0 bits (104), Expect = 0.001 Identities = 18/34 (52%), Positives = 18/34 (52%) Frame = +3 Query: 435 PXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 P PPPPP PPPP G G PPPPP P Sbjct: 972 PGVGIPPPPPLPGVGIPPPPPLPGVGIPPPPPLP 1005 Score = 46.0 bits (104), Expect = 0.001 Identities = 18/34 (52%), Positives = 18/34 (52%) Frame = +3 Query: 435 PXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 P PPPPP PPPP G G PPPPP P Sbjct: 983 PGVGIPPPPPLPGVGIPPPPPLPGVGIPPPPPLP 1016 Score = 46.0 bits (104), Expect = 0.001 Identities = 18/34 (52%), Positives = 18/34 (52%) Frame = +3 Query: 435 PXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 P PPPPP PPPP G G PPPPP P Sbjct: 994 PGVGIPPPPPLPGVGIPPPPPLPGVGIPPPPPLP 1027 Score = 46.0 bits (104), Expect = 0.001 Identities = 18/34 (52%), Positives = 18/34 (52%) Frame = +3 Query: 435 PXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 P PPPPP PPPP G G PPPPP P Sbjct: 1005 PGVGIPPPPPLPGVGIPPPPPLPGMGIPPPPPLP 1038 Score = 44.4 bits (100), Expect = 0.003 Identities = 20/44 (45%), Positives = 20/44 (45%) Frame = +3 Query: 435 PXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 P PPPPP PPPP G G PPPP P A PP Sbjct: 1016 PGVGIPPPPPLPGMGIPPPPPLPGSGIPPPPALP-GVAIPPPPP 1058 Score = 43.6 bits (98), Expect = 0.006 Identities = 19/37 (51%), Positives = 19/37 (51%), Gaps = 2/37 (5%) Frame = +3 Query: 432 PPXGXXPPPP--PXXXXXXSPPPPXXGGGXPPPPPXP 536 P G PPPP P PPPP G G PPPPP P Sbjct: 903 PGLGVPPPPPAPPLPGMGIPPPPPLPGMGIPPPPPLP 939 Score = 43.6 bits (98), Expect = 0.006 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPP 531 P G PPPPP PPPP G PPPPP Sbjct: 915 PLPGMGIPPPPPLPGMGIPPPPPLPGMGIPPPPP 948 Score = 43.6 bits (98), Expect = 0.006 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPP 531 P G PPPPP PPPP G PPPPP Sbjct: 926 PLPGMGIPPPPPLPGMGIPPPPPLPGVGIPPPPP 959 Score = 43.2 bits (97), Expect = 0.008 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPP 531 P G PPPPP PPPP G PPPPP Sbjct: 937 PLPGMGIPPPPPLPGVGIPPPPPLPGVGIPPPPP 970 Score = 43.2 bits (97), Expect = 0.008 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPP 531 P G PPPPP PPPP G PPPPP Sbjct: 948 PLPGVGIPPPPPLPGVGIPPPPPLPGVGIPPPPP 981 Score = 43.2 bits (97), Expect = 0.008 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPP 531 P G PPPPP PPPP G PPPPP Sbjct: 959 PLPGVGIPPPPPLPGVGIPPPPPLPGVGIPPPPP 992 Score = 43.2 bits (97), Expect = 0.008 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPP 531 P G PPPPP PPPP G PPPPP Sbjct: 970 PLPGVGIPPPPPLPGVGIPPPPPLPGVGIPPPPP 1003 Score = 43.2 bits (97), Expect = 0.008 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPP 531 P G PPPPP PPPP G PPPPP Sbjct: 981 PLPGVGIPPPPPLPGVGIPPPPPLPGVGIPPPPP 1014 Score = 43.2 bits (97), Expect = 0.008 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPP 531 P G PPPPP PPPP G PPPPP Sbjct: 992 PLPGVGIPPPPPLPGVGIPPPPPLPGVGIPPPPP 1025 Score = 43.2 bits (97), Expect = 0.008 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPP 531 P G PPPPP PPPP G PPPPP Sbjct: 1003 PLPGVGIPPPPPLPGVGIPPPPPLPGMGIPPPPP 1036 Score = 43.2 bits (97), Expect = 0.008 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = +3 Query: 435 PXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 P PPPPP PPP G PPPPP P PP Sbjct: 1027 PGMGIPPPPPLPGSGIPPPPALPGVAIPPPPPLPGMGVPPPAPP 1070 Score = 41.5 bits (93), Expect = 0.023 Identities = 20/50 (40%), Positives = 20/50 (40%) Frame = +3 Query: 435 PXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPPXXXXXG 584 P PPPP PPPP G G PPP P P A PP G Sbjct: 1038 PGSGIPPPPALPGVAIPPPPPLPGMGVPPPAP-PPPGAGIPPPPLLPGSG 1086 Score = 40.7 bits (91), Expect = 0.040 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPP 531 P G PPPPP PPP G PPPPP Sbjct: 1025 PLPGMGIPPPPPLPGSGIPPPPALPGVAIPPPPP 1058 Score = 39.5 bits (88), Expect = 0.093 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPP 534 P G PPPP PPPP G PPP PP Sbjct: 1036 PLPGSGIPPPPALPGVAIPPPPPLPGMGVPPPAPP 1070 Score = 37.9 bits (84), Expect = 0.28 Identities = 17/35 (48%), Positives = 17/35 (48%), Gaps = 1/35 (2%) Frame = +3 Query: 435 PXGXXPPPPPXXXXXXSPP-PPXXGGGXPPPPPXP 536 P PPP P PP PP G G PPPPP P Sbjct: 894 PAPPQPPPLPGLGVPPPPPAPPLPGMGIPPPPPLP 928 Score = 37.5 bits (83), Expect = 0.37 Identities = 17/37 (45%), Positives = 17/37 (45%), Gaps = 3/37 (8%) Frame = +1 Query: 430 PPXGXXXPPP---PPXXXKXXXPPPPXXGXXXPPPPP 531 P G PPP PP PPPP G PPPPP Sbjct: 901 PLPGLGVPPPPPAPPLPGMGIPPPPPLPGMGIPPPPP 937 Score = 34.3 bits (75), Expect = 3.5 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 1/47 (2%) Frame = +2 Query: 431 PPXGXX-XPPPPXXXXKXXXPPPXXXGXXXPPPPXPXXXXXXXXPPP 568 PP PPPP PPP G PPPP P PPP Sbjct: 914 PPLPGMGIPPPPPLPGMGIPPPPPLPGMGIPPPP-PLPGVGIPPPPP 959 Score = 34.3 bits (75), Expect = 3.5 Identities = 18/48 (37%), Positives = 18/48 (37%), Gaps = 2/48 (4%) Frame = +2 Query: 431 PPXGXX-XPPPPXXXXKXXXPPPXXXG-XXXPPPPXPXXXXXXXXPPP 568 PP PPPP PPP G PPPP P PPP Sbjct: 1024 PPLPGMGIPPPPPLPGSGIPPPPALPGVAIPPPPPLPGMGVPPPAPPP 1071 Score = 33.9 bits (74), Expect = 4.6 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +3 Query: 489 PPPXXGGGXPPPPPXPXXXAXXXXPP 566 PPP G G PPPPP P PP Sbjct: 899 PPPLPGLGVPPPPPAPPLPGMGIPPP 924 Score = 33.1 bits (72), Expect = 8.1 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PPP P PP P PPPPPL PP Sbjct: 899 PPPLPGLGVPPPPPAPPLPGMGIPPPPPLPGMGIPPPPP 937 >UniRef50_UPI0000F1E7FE Cluster: PREDICTED: similar to formin 2; n=2; Danio rerio|Rep: PREDICTED: similar to formin 2 - Danio rerio Length = 1331 Score = 45.6 bits (103), Expect = 0.001 Identities = 21/47 (44%), Positives = 21/47 (44%), Gaps = 1/47 (2%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXP-PPPXXGXXXPPPPPPLXXXXXAXXPP 567 P G PPPPP P PPP G PPPPPPL PP Sbjct: 757 PLPGVCAPPPPPPLPGVCVPTPPPLPGVCPPPPPPPLPGVCAIPPPP 803 Score = 45.6 bits (103), Expect = 0.001 Identities = 21/48 (43%), Positives = 21/48 (43%), Gaps = 2/48 (4%) Frame = +1 Query: 430 PPXGXXXPPPPPXXX--KXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 P G PPPPP PPPP G PPPPPPL PP Sbjct: 804 PLPGASLPPPPPPLPCLSVPPPPPPLPGMGAPPPPPPLPGLSAPPPPP 851 Score = 45.2 bits (102), Expect = 0.002 Identities = 21/49 (42%), Positives = 21/49 (42%), Gaps = 3/49 (6%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXX---PPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPPP PPPP G PPPPPPL PP Sbjct: 779 PPLPGVCPPPPPPPLPGVCAIPPPPPLPGASLPPPPPPLPCLSVPPPPP 827 Score = 44.8 bits (101), Expect = 0.002 Identities = 21/47 (44%), Positives = 21/47 (44%), Gaps = 1/47 (2%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXP-PPPPPLXXXXXAXXPP 567 P G PPPP PPPP G P PPPPPL A PP Sbjct: 830 PGMGAPPPPPPLPGLSAPPPPPPLPGMGVPPPPPPPLTHTGPAPPPP 876 Score = 43.6 bits (98), Expect = 0.006 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PPPP PPPP G PPPPPPL PP Sbjct: 825 PPPPLPGMGAPPPPPPLPGLSAPPPPPPLPGMGVPPPPP 863 Score = 43.2 bits (97), Expect = 0.008 Identities = 21/47 (44%), Positives = 21/47 (44%), Gaps = 3/47 (6%) Frame = +3 Query: 435 PXGXXPPPPP--XXXXXXSPPPPXXG-GGXPPPPPXPXXXAXXXXPP 566 P PPPPP PPPP G G PPPPP P A PP Sbjct: 806 PGASLPPPPPPLPCLSVPPPPPPLPGMGAPPPPPPLPGLSAPPPPPP 852 Score = 41.9 bits (94), Expect = 0.017 Identities = 20/53 (37%), Positives = 20/53 (37%), Gaps = 2/53 (3%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGG--GXPPPPPXPXXXAXXXXPPXXXXXG 584 P PPPPP PPPP G PPPPP P PP G Sbjct: 818 PCLSVPPPPPPLPGMGAPPPPPPLPGLSAPPPPPPLPGMGVPPPPPPPLTHTG 870 Score = 40.7 bits (91), Expect = 0.040 Identities = 20/54 (37%), Positives = 21/54 (38%), Gaps = 3/54 (5%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXS---PPPPXXGGGXPPPPPXPXXXAXXXXPPXXXXXG 584 P G PPPPP PPPP G PPPPP + PP G Sbjct: 780 PLPGVCPPPPPPPLPGVCAIPPPPPLPGASLPPPPPPLPCLSVPPPPPPLPGMG 833 Score = 40.7 bits (91), Expect = 0.040 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PPPP PPPP PPPPPPL PP Sbjct: 801 PPPPLPGASLPPPPPPLPCLSVPPPPPPLPGMGAPPPPP 839 Score = 40.3 bits (90), Expect = 0.053 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PPPPP PPPP PPPPP A PP Sbjct: 800 PPPPPLPGASLPPPPPPLPCLSVPPPPPPLPGMGAPPPP 838 Score = 39.1 bits (87), Expect = 0.12 Identities = 18/40 (45%), Positives = 18/40 (45%), Gaps = 1/40 (2%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGG-GXPPPPPXPXXXAXXXXPP 566 PPPPP PPP G PPPPP P A PP Sbjct: 765 PPPPPLPGVCVPTPPPLPGVCPPPPPPPLPGVCAIPPPPP 804 Score = 39.1 bits (87), Expect = 0.12 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 2/41 (4%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXG--GGXPPPPPXPXXXAXXXXPP 566 PPPPP PPPP PPPPP P A PP Sbjct: 800 PPPPPLPGASLPPPPPPLPCLSVPPPPPPLPGMGAPPPPPP 840 Score = 38.3 bits (85), Expect = 0.21 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 1/47 (2%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXX-GXXXPPPPPPLXXXXXAXXPP 567 P G P PPP PPPP G PPPPPL PP Sbjct: 769 PLPGVCVPTPPPLPGVCPPPPPPPLPGVCAIPPPPPLPGASLPPPPP 815 Score = 37.9 bits (84), Expect = 0.28 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 2/46 (4%) Frame = +3 Query: 435 PXGXXPPPPPXXXXXXSPPPPXXGG--GXPPPPPXPXXXAXXXXPP 566 P P PPP PPPP G PPPPP P PP Sbjct: 771 PGVCVPTPPPLPGVCPPPPPPPLPGVCAIPPPPPLPGASLPPPPPP 816 Score = 37.5 bits (83), Expect = 0.37 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PPPPP PPPP P PPPL PP Sbjct: 753 PPPPPLPGVCAPPPPPPLPGVCVPTPPPLPGVCPPPPPP 791 Score = 37.1 bits (82), Expect = 0.50 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PPPP PPPP G P PPP P PP Sbjct: 754 PPPPLPGVCAPPPPPPLPGVCVPTPPPLPGVCPPPPPPP 792 Score = 35.5 bits (78), Expect = 1.5 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 PPP P PPPP G PPPP P Sbjct: 850 PPPLPGMGVPPPPPPPLTHTGPAPPPPPP 878 Score = 35.1 bits (77), Expect = 2.0 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 4/37 (10%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXX----GGGXPPPPP 530 P PPPPP PPPP G PPPPP Sbjct: 842 PGLSAPPPPPPLPGMGVPPPPPPPLTHTGPAPPPPPP 878 Score = 33.9 bits (74), Expect = 4.6 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 P G PPPPP P PP PPPP P A PP Sbjct: 852 PLPGMGVPPPPPPPLTHTGPAPP-----PPPPPIPPSMAPGACAPP 892 >UniRef50_UPI0000DB6CCB Cluster: PREDICTED: hypothetical protein; n=1; Apis mellifera|Rep: PREDICTED: hypothetical protein - Apis mellifera Length = 394 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 234 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPPP 278 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 235 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPPPP 279 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 236 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPPPPP 280 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 237 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPPPPPP 281 Score = 44.8 bits (101), Expect = 0.002 Identities = 18/36 (50%), Positives = 18/36 (50%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPL 537 PP PPPPP PPPP PPPPPPL Sbjct: 247 PPPPPPPPPPPPPPPPPPPPPPPPPLPPPPPPPPPL 282 Score = 43.6 bits (98), Expect = 0.006 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPP 534 PP PPPPP PPPP PPPPPP Sbjct: 227 PPQVQVVPPPPPPPPPPPPPPPPPPPPPPPPPPPP 261 Score = 43.2 bits (97), Expect = 0.008 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 PP PPPPP PPPP PPPPP P Sbjct: 249 PPPPPPPPPPPPPPPPPPPPPPPLPPPPPPPPPLP 283 Score = 42.3 bits (95), Expect = 0.013 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPL 537 PP PPPPP PPPP PPPPP L Sbjct: 254 PPPPPPPPPPPPPPPPPPLPPPPPPPPPLPPPPPSL 289 Score = 41.5 bits (93), Expect = 0.023 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPP PPPP PPPPPP PP Sbjct: 226 PPPQVQVVPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 271 Score = 41.5 bits (93), Expect = 0.023 Identities = 18/36 (50%), Positives = 18/36 (50%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPL 537 PP PPPPP PPPP PPPPPPL Sbjct: 239 PPPPPPPPPPPPPPPPPPPPPPPP--PPPPPPPPPL 272 Score = 41.5 bits (93), Expect = 0.023 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PP PP P PP Sbjct: 242 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPPPPPPLPPPP 286 Score = 41.5 bits (93), Expect = 0.023 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP P PPP P PP Sbjct: 243 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPPPPPPLPPPPP 287 Score = 39.1 bits (87), Expect = 0.12 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 PP PPPPP PPPP PPPP P Sbjct: 256 PPPPPPPPPPPPPPPPLPPPPPPPPPLPPPPPSLP 290 Score = 36.7 bits (81), Expect = 0.65 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = +3 Query: 435 PXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 P PPP PPPP PPPPP P PP Sbjct: 220 PTAVVVPPPQVQVVPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 263 >UniRef50_UPI00015A5D5E Cluster: UPI00015A5D5E related cluster; n=2; Danio rerio|Rep: UPI00015A5D5E UniRef100 entry - Danio rerio Length = 1093 Score = 45.6 bits (103), Expect = 0.001 Identities = 21/47 (44%), Positives = 21/47 (44%), Gaps = 1/47 (2%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXP-PPPXXGXXXPPPPPPLXXXXXAXXPP 567 P G PPPPP P PPP G PPPPPPL PP Sbjct: 830 PLPGVCAPPPPPPLPGVCVPTPPPLPGVCPPPPPPPLPGVCAIPPPP 876 Score = 45.6 bits (103), Expect = 0.001 Identities = 21/48 (43%), Positives = 21/48 (43%), Gaps = 2/48 (4%) Frame = +1 Query: 430 PPXGXXXPPPPPXXX--KXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 P G PPPPP PPPP G PPPPPPL PP Sbjct: 877 PLPGASLPPPPPPLPCLSVPPPPPPLPGMGAPPPPPPLPGLSAPPPPP 924 Score = 45.2 bits (102), Expect = 0.002 Identities = 21/49 (42%), Positives = 21/49 (42%), Gaps = 3/49 (6%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXX---PPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPPP PPPP G PPPPPPL PP Sbjct: 852 PPLPGVCPPPPPPPLPGVCAIPPPPPLPGASLPPPPPPLPCLSVPPPPP 900 Score = 44.8 bits (101), Expect = 0.002 Identities = 21/47 (44%), Positives = 21/47 (44%), Gaps = 1/47 (2%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXP-PPPPPLXXXXXAXXPP 567 P G PPPP PPPP G P PPPPPL A PP Sbjct: 903 PGMGAPPPPPPLPGLSAPPPPPPLPGMGVPPPPPPPLTHTGPAPPPP 949 Score = 43.6 bits (98), Expect = 0.006 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PPPP PPPP G PPPPPPL PP Sbjct: 898 PPPPLPGMGAPPPPPPLPGLSAPPPPPPLPGMGVPPPPP 936 Score = 43.2 bits (97), Expect = 0.008 Identities = 21/47 (44%), Positives = 21/47 (44%), Gaps = 3/47 (6%) Frame = +3 Query: 435 PXGXXPPPPP--XXXXXXSPPPPXXG-GGXPPPPPXPXXXAXXXXPP 566 P PPPPP PPPP G G PPPPP P A PP Sbjct: 879 PGASLPPPPPPLPCLSVPPPPPPLPGMGAPPPPPPLPGLSAPPPPPP 925 Score = 41.9 bits (94), Expect = 0.017 Identities = 20/53 (37%), Positives = 20/53 (37%), Gaps = 2/53 (3%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGG--GXPPPPPXPXXXAXXXXPPXXXXXG 584 P PPPPP PPPP G PPPPP P PP G Sbjct: 891 PCLSVPPPPPPLPGMGAPPPPPPLPGLSAPPPPPPLPGMGVPPPPPPPLTHTG 943 Score = 40.7 bits (91), Expect = 0.040 Identities = 20/54 (37%), Positives = 21/54 (38%), Gaps = 3/54 (5%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXS---PPPPXXGGGXPPPPPXPXXXAXXXXPPXXXXXG 584 P G PPPPP PPPP G PPPPP + PP G Sbjct: 853 PLPGVCPPPPPPPLPGVCAIPPPPPLPGASLPPPPPPLPCLSVPPPPPPLPGMG 906 Score = 40.7 bits (91), Expect = 0.040 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PPPP PPPP PPPPPPL PP Sbjct: 874 PPPPLPGASLPPPPPPLPCLSVPPPPPPLPGMGAPPPPP 912 Score = 40.3 bits (90), Expect = 0.053 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PPPPP PPPP PPPPP A PP Sbjct: 873 PPPPPLPGASLPPPPPPLPCLSVPPPPPPLPGMGAPPPP 911 Score = 39.1 bits (87), Expect = 0.12 Identities = 18/40 (45%), Positives = 18/40 (45%), Gaps = 1/40 (2%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGG-GXPPPPPXPXXXAXXXXPP 566 PPPPP PPP G PPPPP P A PP Sbjct: 838 PPPPPLPGVCVPTPPPLPGVCPPPPPPPLPGVCAIPPPPP 877 Score = 39.1 bits (87), Expect = 0.12 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 2/41 (4%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXG--GGXPPPPPXPXXXAXXXXPP 566 PPPPP PPPP PPPPP P A PP Sbjct: 873 PPPPPLPGASLPPPPPPLPCLSVPPPPPPLPGMGAPPPPPP 913 Score = 38.3 bits (85), Expect = 0.21 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 1/47 (2%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXX-GXXXPPPPPPLXXXXXAXXPP 567 P G P PPP PPPP G PPPPPL PP Sbjct: 842 PLPGVCVPTPPPLPGVCPPPPPPPLPGVCAIPPPPPLPGASLPPPPP 888 Score = 37.9 bits (84), Expect = 0.28 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 2/46 (4%) Frame = +3 Query: 435 PXGXXPPPPPXXXXXXSPPPPXXGG--GXPPPPPXPXXXAXXXXPP 566 P P PPP PPPP G PPPPP P PP Sbjct: 844 PGVCVPTPPPLPGVCPPPPPPPLPGVCAIPPPPPLPGASLPPPPPP 889 Score = 37.5 bits (83), Expect = 0.37 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PPPPP PPPP P PPPL PP Sbjct: 826 PPPPPLPGVCAPPPPPPLPGVCVPTPPPLPGVCPPPPPP 864 Score = 37.1 bits (82), Expect = 0.50 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PPPP PPPP G P PPP P PP Sbjct: 827 PPPPLPGVCAPPPPPPLPGVCVPTPPPLPGVCPPPPPPP 865 Score = 35.5 bits (78), Expect = 1.5 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 PPP P PPPP G PPPP P Sbjct: 923 PPPLPGMGVPPPPPPPLTHTGPAPPPPPP 951 Score = 35.1 bits (77), Expect = 2.0 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 4/37 (10%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXX----GGGXPPPPP 530 P PPPPP PPPP G PPPPP Sbjct: 915 PGLSAPPPPPPLPGMGVPPPPPPPLTHTGPAPPPPPP 951 Score = 33.9 bits (74), Expect = 4.6 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 P G PPPPP P PP PPPP P A PP Sbjct: 925 PLPGMGVPPPPPPPLTHTGPAPP-----PPPPPIPPSMAPGACAPP 965 >UniRef50_Q2W222 Cluster: RTX toxins and related Ca2+-binding protein; n=1; Magnetospirillum magneticum AMB-1|Rep: RTX toxins and related Ca2+-binding protein - Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) Length = 1274 Score = 45.6 bits (103), Expect = 0.001 Identities = 22/59 (37%), Positives = 22/59 (37%) Frame = +3 Query: 390 GGGGGXXFXXXGXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 G GGG PP PPPPP PPP PPPPP P PP Sbjct: 258 GAGGGAEAAVVDVAPPPPPPPPPPP-PPPPPPPPPSPPAPAPPPPPPAPPPPPPAPPPP 315 Score = 42.7 bits (96), Expect = 0.010 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PPPPP PPPP PPPPPP PP Sbjct: 276 PPPPPPPPPPPPPPPPSPPAPAPPPPPPAPPPPPPAPPP 314 Score = 42.7 bits (96), Expect = 0.010 Identities = 18/45 (40%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP +P PP PPPPP P A P Sbjct: 278 PPPPPPPPPPPPPPSPPAPAPPPPPPAPPPPPPAPPPPAPVNNDP 322 Score = 38.7 bits (86), Expect = 0.16 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PPPPP PPPP PPPPP PP Sbjct: 275 PPPPPPPPPPPPPPPPPSPPAPAPPPPPPAPPPPPPAPP 313 Score = 38.3 bits (85), Expect = 0.21 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PPPPP PPP PPPPP A PP Sbjct: 277 PPPPPPPPPPPPPPPSPPAPAPPPPPPAPPPPPPAPPPP 315 >UniRef50_Q4U2V7 Cluster: Hydroxyproline-rich glycoprotein GAS31 precursor; n=2; Chlamydomonas reinhardtii|Rep: Hydroxyproline-rich glycoprotein GAS31 precursor - Chlamydomonas reinhardtii Length = 647 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 242 PPPPMPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPLLPPLPP 286 Score = 45.2 bits (102), Expect = 0.002 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPPP PPPP PPPPPP PP Sbjct: 241 PPPPPMPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPLLPPLPP 286 Score = 44.4 bits (100), Expect = 0.003 Identities = 19/52 (36%), Positives = 19/52 (36%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 PP PP PPPPP PPPP PPPPP P Sbjct: 224 PPPSASSPPSSPSPSPRPPPPPMPPPPPPPPPPPPPPPPPPSPPPPPPPPPP 275 Score = 43.6 bits (98), Expect = 0.006 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP SPPPP PPPP P PP Sbjct: 248 PPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPLLPPLPPFPAKPP 292 Score = 39.9 bits (89), Expect = 0.070 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 P PPPPP PPPP PP PP P PP Sbjct: 235 PSPSPRPPPPPMPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPP 279 Score = 39.1 bits (87), Expect = 0.12 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +1 Query: 433 PXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 P PPPPP PPPP PP PPP PP Sbjct: 235 PSPSPRPPPPPMPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPP 279 Score = 38.7 bits (86), Expect = 0.16 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 1/46 (2%) Frame = +3 Query: 432 PPXGXXPPP-PPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP P P PP PPPP PPPPP P PP Sbjct: 231 PPSSPSPSPRPPPPPMPPPPPPPPPPPPPPPPPPSPPPPPPPPPPP 276 Score = 36.7 bits (81), Expect = 0.65 Identities = 19/51 (37%), Positives = 19/51 (37%), Gaps = 6/51 (11%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSP------PPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPP SP PPP PPPPP P PP Sbjct: 217 PPPSSPPPPPSASSPPSSPSPSPRPPPPPMPPPPPPPPPPPPPPPPPPSPP 267 Score = 36.7 bits (81), Expect = 0.65 Identities = 16/46 (34%), Positives = 17/46 (36%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PP P PPP PPPPPP + PP Sbjct: 224 PPPSASSPPSSPSPSPRPPPPPMPPPPPPPPPPPPPPPPPPSPPPP 269 Score = 35.9 bits (79), Expect = 1.1 Identities = 18/50 (36%), Positives = 18/50 (36%), Gaps = 4/50 (8%) Frame = +1 Query: 430 PPXGXXXPP----PPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PP PP PPPP PPPPPP PP Sbjct: 218 PPSSPPPPPSASSPPSSPSPSPRPPPPPMPPPPPPPPPPPPPPPPPPSPP 267 Score = 34.7 bits (76), Expect = 2.6 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +2 Query: 431 PPXGXXXPPPPXXXXKXXXPPPXXXGXXXPPPPXPXXXXXXXXPPP 568 PP PPPP PPP PPPP P P P Sbjct: 243 PPPMPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPLLPPLPPFP 288 Score = 33.5 bits (73), Expect = 6.1 Identities = 15/46 (32%), Positives = 15/46 (32%) Frame = +2 Query: 431 PPXGXXXPPPPXXXXKXXXPPPXXXGXXXPPPPXPXXXXXXXXPPP 568 PP PP PPP PPPP P PPP Sbjct: 223 PPPPSASSPPSSPSPSPRPPPPPMPPPPPPPPPPPPPPPPPPSPPP 268 >UniRef50_Q75JU4 Cluster: Similar to Volvox carteri f. nagariensis. Pherophorin-dz1 protein; n=2; Dictyostelium discoideum|Rep: Similar to Volvox carteri f. nagariensis. Pherophorin-dz1 protein - Dictyostelium discoideum (Slime mold) Length = 243 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 56 PPLPPAPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 100 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 62 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPP 106 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 63 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPP 107 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 64 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPPP 108 Score = 45.2 bits (102), Expect = 0.002 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPPP PPPP PPPPPP PP Sbjct: 59 PPAPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPP 104 Score = 44.4 bits (100), Expect = 0.003 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPPP PPPP PPPPPP PP Sbjct: 55 PPPLPPAPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 100 >UniRef50_Q54WZ5 Cluster: Slob family protein kinase; n=1; Dictyostelium discoideum AX4|Rep: Slob family protein kinase - Dictyostelium discoideum AX4 Length = 574 Score = 45.6 bits (103), Expect = 0.001 Identities = 20/45 (44%), Positives = 21/45 (46%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP G PPPPP P + PP Sbjct: 492 PPISSPPPPPP-------PPPPSKSSGPPPPPPPPPKSSGPPPPP 529 Score = 41.5 bits (93), Expect = 0.023 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 PP PPPP PPPP PPPPP P Sbjct: 497 PPPPPPPPPPSKSSGPPPPPPPPPKSSGPPPPPPP 531 Score = 38.3 bits (85), Expect = 0.21 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPP 528 P PPPPP K PPPP PPPP Sbjct: 506 PSKSSGPPPPPPPPPKSSGPPPPPPPKSSPPPP 538 Score = 37.1 bits (82), Expect = 0.50 Identities = 16/31 (51%), Positives = 16/31 (51%), Gaps = 3/31 (9%) Frame = +1 Query: 451 PPPPPXXXK---XXXPPPPXXGXXXPPPPPP 534 PPPPP K PPPP PPPPPP Sbjct: 500 PPPPPPPSKSSGPPPPPPPPPKSSGPPPPPP 530 Score = 36.7 bits (81), Expect = 0.65 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PPPPP PPPP PPPPPP PP Sbjct: 497 PPPPPP------PPPPSKSSGPPPPPPPPPKSSGPPPPP 529 Score = 33.5 bits (73), Expect = 6.1 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PPPPP PPP PPPPPP PP Sbjct: 498 PPPPPP------PPPSKSSGPPPPPPPPPKSSGPPPPPP 530 >UniRef50_A3QX14 Cluster: Wiskott-Aldrich syndrome protein; n=1; Suberites domuncula|Rep: Wiskott-Aldrich syndrome protein - Suberites domuncula (Sponge) Length = 410 Score = 45.6 bits (103), Expect = 0.001 Identities = 23/69 (33%), Positives = 24/69 (34%), Gaps = 1/69 (1%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXXPPPPPXXXXXXSPP-PPXXGGGXPPPPPXPXXXAXXX 557 PP G PP G PPPP PP PP GG PPPP + Sbjct: 298 PPPSNSRGGSAPAPPPPPPVGVPAPPPPPPVGGTGPPKPPSAAGGPPPPPSRDKPSSSLP 357 Query: 558 XPPXXXXXG 584 PP G Sbjct: 358 APPAGGGRG 366 Score = 40.3 bits (90), Expect = 0.053 Identities = 22/61 (36%), Positives = 23/61 (37%), Gaps = 1/61 (1%) Frame = +3 Query: 387 RGGGGGXXFXXXGXXPPXGXXPPPP-PXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXP 563 RGGG G P G PPP +PPPP G PPPP P P Sbjct: 277 RGGGRGHPPPPPRGGPGRGGPPPPSNSRGGSAPAPPPPPPVGVPAPPPPPPVGGTGPPKP 336 Query: 564 P 566 P Sbjct: 337 P 337 Score = 38.7 bits (86), Expect = 0.16 Identities = 22/53 (41%), Positives = 22/53 (41%), Gaps = 4/53 (7%) Frame = +3 Query: 381 PPRGGGGGXX----FXXXGXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPP 527 PPRGG G G P PPPPP PPPP G G P PP Sbjct: 287 PPRGGPGRGGPPPPSNSRGGSAPAP--PPPPPVGVPAPPPPPPVGGTGPPKPP 337 Score = 37.1 bits (82), Expect = 0.50 Identities = 24/70 (34%), Positives = 25/70 (35%), Gaps = 6/70 (8%) Frame = -1 Query: 536 RGGGGGGXSXPXXGGGGXXXXXXXGG--GGGXXXPXGGXXXXXKXXPPPPPPGG----XX 375 RGGG G P GG G GG P PPPPP GG Sbjct: 277 RGGGRGHPPPPPRGGPGRGGPPPPSNSRGGSAPAPPPPPPVGVPAPPPPPPVGGTGPPKP 336 Query: 374 XTPXGGXPPP 345 + GG PPP Sbjct: 337 PSAAGGPPPP 346 Score = 33.9 bits (74), Expect = 4.6 Identities = 19/51 (37%), Positives = 19/51 (37%), Gaps = 1/51 (1%) Frame = -2 Query: 529 GGGGGXPPPXXGGGGXXFXXXXGGG-GGXXPXGGXXPXFXKXXPPPPPRGG 380 GG G PPP GG G GG P P PPPPP G Sbjct: 279 GGRGHPPPPPRGGPGRGGPPPPSNSRGGSAPAPPPPPPVGVPAPPPPPPVG 329 Score = 33.1 bits (72), Expect = 8.1 Identities = 20/55 (36%), Positives = 20/55 (36%), Gaps = 1/55 (1%) Frame = -1 Query: 497 GGGGXXXXXXXGGGG-GXXXPXGGXXXXXKXXPPPPPPGGXXXTPXGGXPPPXXG 336 GG G GG G G P PPPPPP G P PPP G Sbjct: 279 GGRGHPPPPPRGGPGRGGPPPPSNSRGGSAPAPPPPPPVGVPAPP---PPPPVGG 330 >UniRef50_A2F3Y4 Cluster: Putative uncharacterized protein; n=1; Trichomonas vaginalis G3|Rep: Putative uncharacterized protein - Trichomonas vaginalis G3 Length = 634 Score = 45.6 bits (103), Expect = 0.001 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = +3 Query: 441 GXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 G PPPP PPPP G PPPPP P PP Sbjct: 534 GEAPPPPSAPGAGIPPPPPVPGNAPPPPPPPPPPPGAGAPPP 575 Score = 43.2 bits (97), Expect = 0.008 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = +3 Query: 453 PPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPPXXXXXG 584 PPPP PPPP G PPPPP P PP G Sbjct: 537 PPPPSAPGAGIPPPPPVPGNAPPPPPPPPPPPGAGAPPPPPPPG 580 Score = 42.3 bits (95), Expect = 0.013 Identities = 18/37 (48%), Positives = 18/37 (48%), Gaps = 3/37 (8%) Frame = +3 Query: 435 PXGXXPPPPP---XXXXXXSPPPPXXGGGXPPPPPXP 536 P PPPPP PPPP G G PPPPP P Sbjct: 543 PGAGIPPPPPVPGNAPPPPPPPPPPPGAGAPPPPPPP 579 Score = 41.9 bits (94), Expect = 0.017 Identities = 22/52 (42%), Positives = 22/52 (42%), Gaps = 2/52 (3%) Frame = +3 Query: 381 PPRGGGGGXXFXXX--GXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPP 530 PP G G G PP PPPPP PPPP G G PPPP Sbjct: 539 PPSAPGAGIPPPPPVPGNAPPP--PPPPPPPPGAGAPPPPPPPGPGLAPPPP 588 Score = 40.7 bits (91), Expect = 0.040 Identities = 15/31 (48%), Positives = 16/31 (51%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPP 524 PP PPPPP +PPPP GG PP Sbjct: 567 PPGAGAPPPPPPPGPGLAPPPPKAGGSSSPP 597 Score = 39.9 bits (89), Expect = 0.070 Identities = 20/52 (38%), Positives = 20/52 (38%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 PP G P PPPPP PPPP G PPPPP P Sbjct: 537 PPPPSAPGAGIPPPPPVPGNAPPPPPPP-------PPPPGAGAPPPPPPPGP 581 Score = 39.9 bits (89), Expect = 0.070 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 P G PPP P PPPP PPPPP A PP Sbjct: 543 PGAGIPPPPPVPGNAPPPPPPPPPPPGAGAPPPPPPPGPGLAPPPP 588 Score = 38.7 bits (86), Expect = 0.16 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPP 525 PP G PPPPP PPPP G PP Sbjct: 566 PPPGAGAPPPPPPPGPGLAPPPPKAGGSSSPP 597 >UniRef50_Q6CEK4 Cluster: Similar to tr|O42854 Schizosaccharomyces pombe Hypothetical 170.5 kDa protein; n=1; Yarrowia lipolytica|Rep: Similar to tr|O42854 Schizosaccharomyces pombe Hypothetical 170.5 kDa protein - Yarrowia lipolytica (Candida lipolytica) Length = 1329 Score = 45.6 bits (103), Expect = 0.001 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 P G PPPPP PPPP PPPPP P Sbjct: 892 PERGAPPPPPPATERSAPPPPPERAAAPPPPPPVP 926 Score = 41.9 bits (94), Expect = 0.017 Identities = 18/44 (40%), Positives = 20/44 (45%) Frame = +3 Query: 435 PXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 P PPPPP +PPPP PPPPP P + PP Sbjct: 892 PERGAPPPPPPATERSAPPPPPERAAAPPPPP-PVPGSPQVPPP 934 Score = 41.9 bits (94), Expect = 0.017 Identities = 15/29 (51%), Positives = 17/29 (58%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPPL 537 PPPPP + PPPP PPPPPP+ Sbjct: 897 PPPPPPATERSAPPPPPERAAAPPPPPPV 925 Score = 39.5 bits (88), Expect = 0.093 Identities = 17/45 (37%), Positives = 18/45 (40%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPP P +PPPP PPP P A PP Sbjct: 879 PPASRAPPPIPQSPERGAPPPPPPATERSAPPPPPERAAAPPPPP 923 Score = 37.1 bits (82), Expect = 0.50 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXA 548 PPPPP PPPP G PPP P A Sbjct: 909 PPPPPERAAAPPPPPPVPGSPQVPPPSMPHQHA 941 Score = 33.5 bits (73), Expect = 6.1 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 1/34 (2%) Frame = +1 Query: 430 PPXGXX-XPPPPPXXXKXXXPPPPXXGXXXPPPP 528 PP PPPPP PPPP G PPP Sbjct: 901 PPATERSAPPPPPERAAAPPPPPPVPGSPQVPPP 934 >UniRef50_A4QSC9 Cluster: Predicted protein; n=2; Fungi/Metazoa group|Rep: Predicted protein - Magnaporthe grisea (Rice blast fungus) (Pyricularia grisea) Length = 309 Score = 45.6 bits (103), Expect = 0.001 Identities = 18/45 (40%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPP PPPP PPPPP P + PP Sbjct: 232 PPSHTPAPPPPSHTPAPPPPPPPPSSSLPPPPPPPPPSSTRPPPP 276 Score = 45.2 bits (102), Expect = 0.002 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPPP PPPP PPPPPP PP Sbjct: 220 PPSHTPSPPPPPPPSHTPAPPPPSHTPAPPPPPPPPSSSLPPPPPP 265 Score = 43.6 bits (98), Expect = 0.006 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPP PPPP PPPPPP PP Sbjct: 231 PPPSHTPAPPPPSHTPAPPPPPPPPSSSLPPPPPPPPPSSTRPPPP 276 Score = 42.7 bits (96), Expect = 0.010 Identities = 19/47 (40%), Positives = 20/47 (42%), Gaps = 2/47 (4%) Frame = +3 Query: 432 PPXGXX--PPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP +PPPP PPPPP P PP Sbjct: 219 PPPSHTPSPPPPPPPSHTPAPPPPSHTPAPPPPPPPPSSSLPPPPPP 265 Score = 41.1 bits (92), Expect = 0.030 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPP 534 PPPPP PPPP PPPPPP Sbjct: 251 PPPPPSSSLPPPPPPPPPSSTRPPPPPP 278 Score = 37.5 bits (83), Expect = 0.37 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPP 525 PP PPPPP PPPP PPP Sbjct: 254 PPSSSLPPPPPPPPPSSTRPPPPPPAQTTPPP 285 Score = 35.9 bits (79), Expect = 1.1 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPP PPPP PPPPP P PP Sbjct: 241 PPSHTPAPPPP-------PPPPSSSLPPPPPPPPPSSTRPPPPPP 278 Score = 35.1 bits (77), Expect = 2.0 Identities = 16/38 (42%), Positives = 17/38 (44%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXP 564 PPPPP P PP PPPPPP+ A P Sbjct: 176 PPPPPPSHT---PKPPPSHSPKPPPPPPISHSAAASLP 210 >UniRef50_P21260 Cluster: Uncharacterized proline-rich protein; n=1; Owenia fusiformis|Rep: Uncharacterized proline-rich protein - Owenia fusiformis Length = 141 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 43.6 bits (98), Expect = 0.006 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXA 548 PP PPPPP PPPP PPPPP P A Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRRA 61 >UniRef50_Q9Y4D1 Cluster: Disheveled-associated activator of morphogenesis 1; n=37; Amniota|Rep: Disheveled-associated activator of morphogenesis 1 - Homo sapiens (Human) Length = 1078 Score = 45.6 bits (103), Expect = 0.001 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PPPPP PPPP G PPPPP P PP Sbjct: 552 PPPPPLPGGMLPPPPPPLPPGGPPPPPGPPPLGAIMPPP 590 Score = 39.9 bits (89), Expect = 0.070 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +1 Query: 433 PXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 P PPPPP PPPP PPPPP A PP Sbjct: 545 PGSLLPPPPPPPLPGGMLPPPPPPLPPGGPPPPPGPPPLGAIMPP 589 Score = 38.7 bits (86), Expect = 0.16 Identities = 19/50 (38%), Positives = 19/50 (38%) Frame = +3 Query: 435 PXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPPXXXXXG 584 P G P P PPPP GG PPPPP P PP G Sbjct: 536 PGGPFPSSVPGSLLPPPPPPPLPGGMLPPPPP-PLPPGGPPPPPGPPPLG 584 Score = 37.9 bits (84), Expect = 0.28 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PPPPP PPPP PPPPP PP Sbjct: 552 PPPPPLPGGMLPPPPPPLPPGGPPPPPGPPPLGAIMPPP 590 Score = 35.5 bits (78), Expect = 1.5 Identities = 17/40 (42%), Positives = 17/40 (42%), Gaps = 2/40 (5%) Frame = +3 Query: 435 PXGXXPPPPPXXXXXXSPPPPXXG--GGXPPPPPXPXXXA 548 P G PPPPP PPPP G PPP P A Sbjct: 558 PGGMLPPPPPPLPPGGPPPPPGPPPLGAIMPPPGAPMGLA 597 Score = 34.3 bits (75), Expect = 3.5 Identities = 16/39 (41%), Positives = 17/39 (43%), Gaps = 3/39 (7%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPP---PPXXGXXXPPPPPPL 537 P G PPPPP PP PP G PPP P+ Sbjct: 556 PLPGGMLPPPPPPLPPGGPPPPPGPPPLGAIMPPPGAPM 594 >UniRef50_UPI0000F1DAD0 Cluster: PREDICTED: hypothetical protein; n=2; Danio rerio|Rep: PREDICTED: hypothetical protein - Danio rerio Length = 1102 Score = 45.2 bits (102), Expect = 0.002 Identities = 20/44 (45%), Positives = 20/44 (45%) Frame = +3 Query: 435 PXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 P PPPPP PPPP GG PPPPP P PP Sbjct: 588 PGAEAPPPPPP------PPPPSGSGGAPPPPPPPPPPGGGPPPP 625 Score = 45.2 bits (102), Expect = 0.002 Identities = 20/41 (48%), Positives = 20/41 (48%), Gaps = 3/41 (7%) Frame = +3 Query: 423 GXXPPXGXXPPPPP---XXXXXXSPPPPXXGGGXPPPPPXP 536 G P PPPPP PPPP GGG PPPPP P Sbjct: 589 GAEAPPPPPPPPPPSGSGGAPPPPPPPPPPGGGPPPPPPPP 629 Score = 44.0 bits (99), Expect = 0.004 Identities = 19/38 (50%), Positives = 19/38 (50%) Frame = +3 Query: 423 GXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 G PP PPPPP PPPP G G PPPP P Sbjct: 606 GGAPPP---PPPPPPPGGGPPPPPPPPGSGPPPPPGAP 640 Score = 40.7 bits (91), Expect = 0.040 Identities = 18/35 (51%), Positives = 18/35 (51%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPP 534 PP PPPPP PPPP G PPPPPP Sbjct: 571 PPSPAAAPPPPP-------PPPPLPGAEAPPPPPP 598 Score = 40.7 bits (91), Expect = 0.040 Identities = 21/49 (42%), Positives = 21/49 (42%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPP 527 PP G GG PP G PPPPP PPPP G PP P Sbjct: 601 PPSGSGGAPP--PPPPPPPPGGGPPPPPPPPGSGPPPPP----GAPPAP 643 Score = 39.5 bits (88), Expect = 0.093 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 P G PPPPP PPPP PPPPPP PP Sbjct: 586 PLPGAEAPPPPPP------PPPPSGSGGAPPPPPPPPPPGGGPPPP 625 Score = 39.5 bits (88), Expect = 0.093 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP G PPPP PPPP G PPPPP PP Sbjct: 601 PPSGSGGAPPPPPP-----PPPPGGGPPPPPPPPGSGPPPPPGAPP 641 Score = 38.3 bits (85), Expect = 0.21 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 P PPPPP PPPP G PPPPP P Sbjct: 572 PSPAAAPPPPP-------PPPPLPGAEAPPPPPPP 599 Score = 37.9 bits (84), Expect = 0.28 Identities = 16/31 (51%), Positives = 16/31 (51%), Gaps = 3/31 (9%) Frame = +1 Query: 451 PPPPPX---XXKXXXPPPPXXGXXXPPPPPP 534 PPPPP PPPP G PPPPPP Sbjct: 598 PPPPPSGSGGAPPPPPPPPPPGGGPPPPPPP 628 Score = 37.5 bits (83), Expect = 0.37 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = +3 Query: 441 GXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 G PPPPP PPPP G PPPPP PP Sbjct: 606 GGAPPPPPP------PPPPGGGPPPPPPPPGSGPPPPPGAPP 641 Score = 37.1 bits (82), Expect = 0.50 Identities = 18/45 (40%), Positives = 19/45 (42%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPPXXXXXG 584 PPPPP +PPPP PPPPP A PP G Sbjct: 581 PPPPPPLPGAEAPPPPP-----PPPPPSGSGGAPPPPPPPPPPGG 620 Score = 34.7 bits (76), Expect = 2.6 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = -1 Query: 464 GGGGGXXXPXGGXXXXXKXXPPPPPPGGXXXTPXGGXPPP 345 G GG P PPPPPPG P G P P Sbjct: 604 GSGGAPPPPPPPPPPGGGPPPPPPPPGSGPPPPPGAPPAP 643 Score = 34.3 bits (75), Expect = 3.5 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 3/38 (7%) Frame = -1 Query: 440 PXGGXXXXXKXXPPPPPPGG---XXXTPXGGXPPPXXG 336 P G PPPPPPGG P G PPP G Sbjct: 601 PPSGSGGAPPPPPPPPPPGGGPPPPPPPPGSGPPPPPG 638 >UniRef50_Q7T318 Cluster: Wiskott-Aldrich syndrome; n=7; Euteleostomi|Rep: Wiskott-Aldrich syndrome - Danio rerio (Zebrafish) (Brachydanio rerio) Length = 479 Score = 45.2 bits (102), Expect = 0.002 Identities = 17/35 (48%), Positives = 18/35 (51%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPP 534 P PPPPP + PPPP G PPPPPP Sbjct: 340 PHCNRSGPPPPPPPSQSHKPPPPPMGACAPPPPPP 374 Score = 43.6 bits (98), Expect = 0.006 Identities = 16/29 (55%), Positives = 16/29 (55%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 PPPPP PPPP G PPPPP P Sbjct: 347 PPPPPPPSQSHKPPPPPMGACAPPPPPPP 375 Score = 40.7 bits (91), Expect = 0.040 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 PPPPP PPPP PPPPP P Sbjct: 348 PPPPPPSQSHKPPPPPMGACAPPPPPPPP 376 Score = 39.9 bits (89), Expect = 0.070 Identities = 16/45 (35%), Positives = 18/45 (40%) Frame = +1 Query: 433 PXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 P PPP P + PPPP PPPPP+ PP Sbjct: 330 PPHRGPPPPAPHCNRSGPPPPPPPSQSHKPPPPPMGACAPPPPPP 374 Score = 39.1 bits (87), Expect = 0.12 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPP P PPPP PPPP A PP Sbjct: 330 PPHRGPPPPAPHCNRSGPPPPPPPSQSHKPPPPPMGACAPPPPPP 374 Score = 38.7 bits (86), Expect = 0.16 Identities = 22/62 (35%), Positives = 22/62 (35%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXX 560 PPRGG G PP P PP PP P PPPPP P Sbjct: 306 PPRGGLSSVP-GPTGRPPPPSRSPGPP---HRGPPPPAPHCNRSGPPPPPPPSQSHKPPP 361 Query: 561 PP 566 PP Sbjct: 362 PP 363 >UniRef50_Q4A2U1 Cluster: Putative membrane protein precursor; n=1; Emiliania huxleyi virus 86|Rep: Putative membrane protein precursor - Emiliania huxleyi virus 86 Length = 2873 Score = 45.2 bits (102), Expect = 0.002 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP P PPP SPPPP PPPPP P PP Sbjct: 2259 PPSPHPPSPPPPSPPPPSPPPPTPPPSPPPPPPTPPPSPPPPSPP 2303 Score = 44.8 bits (101), Expect = 0.002 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 PP PPPPP PPPP PPPPP P Sbjct: 227 PPPSPPPPPPPSPPPPSPPPPPPPSPPPPPPPPLP 261 Score = 43.6 bits (98), Expect = 0.006 Identities = 17/33 (51%), Positives = 17/33 (51%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPP 530 PP PPPPP SPPPP PPPPP Sbjct: 226 PPPPSPPPPPPPSPPPPSPPPPPPPSPPPPPPP 258 Score = 43.2 bits (97), Expect = 0.008 Identities = 18/45 (40%), Positives = 19/45 (42%) Frame = +1 Query: 433 PXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 P PPPPP PPPP PPPPPP + PP Sbjct: 203 PSPPPPPPPPPLPPPPPPPPPPSPPPPSPPPPPPPSPPPPSPPPP 247 Score = 42.7 bits (96), Expect = 0.010 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = +1 Query: 433 PXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPL 537 P PPPPP PPPP PPPPPPL Sbjct: 226 PPPPSPPPPPPPSPPPPSPPPPPPPSPPPPPPPPL 260 Score = 42.3 bits (95), Expect = 0.013 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 P PPPPP PPPP PPPPP P PP Sbjct: 203 PSPPPPPPPPPLPPPPPPPPPPSPPPPSPPPPPPPSPPPPSPPPP 247 Score = 42.3 bits (95), Expect = 0.013 Identities = 17/39 (43%), Positives = 18/39 (46%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PPPPP SPPPP PP PP P + PP Sbjct: 219 PPPPPPSPPPPSPPPPPPPSPPPPSPPPPPPPSPPPPPP 257 Score = 42.3 bits (95), Expect = 0.013 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPL 537 PP PPPP PPPP PPPPPPL Sbjct: 1178 PPSPPPPSPPPPPSPPPPSPPPPLPPPPSPPPPPPL 1213 Score = 41.9 bits (94), Expect = 0.017 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPPP PPPP PP PPP PP Sbjct: 212 PPLPPPPPPPPPPSPPPPSPPPPPPPSPPPPSPPPPPPPSPPPPPP 257 Score = 41.9 bits (94), Expect = 0.017 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP P PPP SPPPP PPP P P PP Sbjct: 2537 PPPSPPPSPPPPLPPPPSPPPPSPPPPSPPPSPPPPSPPPSPPPP 2581 Score = 41.9 bits (94), Expect = 0.017 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP P PPP SPPPP PPP P P PP Sbjct: 2685 PPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPSPPPPSPPPPSPPP 2729 Score = 41.9 bits (94), Expect = 0.017 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP P PPP SPPPP PPP P P PP Sbjct: 2690 PPSPPPPSPPPPSPPPPSPPPPSPPPSPPPPSPPPPSPPPPSPPP 2734 Score = 41.9 bits (94), Expect = 0.017 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PP PP SPPPP PPPP P PP Sbjct: 2699 PPPSPPPPSPPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 2743 Score = 41.9 bits (94), Expect = 0.017 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PP PP SPPPP PPPP P PP Sbjct: 2704 PPPSPPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 2748 Score = 41.9 bits (94), Expect = 0.017 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP P PPP SPPPP PPPP P PP Sbjct: 2709 PPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 2753 Score = 41.9 bits (94), Expect = 0.017 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP P PPP SPPPP PPP P P PP Sbjct: 2739 PPSPPPPSPPPPSPPPPSPPPPLPPAPSPPPSPPPPSPPPSPPPP 2783 Score = 41.5 bits (93), Expect = 0.023 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP P PPP PPPP PPPP P A PP Sbjct: 2723 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPLPPAPSPP 2768 Score = 41.1 bits (92), Expect = 0.030 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PP PP SPPPP PPPP P PP Sbjct: 2680 PPPPSPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPSPPPPSPPP 2724 Score = 41.1 bits (92), Expect = 0.030 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP P PPP SPPPP PPPP P PP Sbjct: 2714 PPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 2758 Score = 41.1 bits (92), Expect = 0.030 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP P PPP SPPPP PPPP P PP Sbjct: 2719 PPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPLPP 2763 Score = 40.7 bits (91), Expect = 0.040 Identities = 20/45 (44%), Positives = 21/45 (46%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP SPPPP PPPPP P + PP Sbjct: 209 PPPPPLPPPPPPPPPP-SPPPPSP---PPPPPPSPPPPSPPPPPP 249 Score = 40.3 bits (90), Expect = 0.053 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = +3 Query: 435 PXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 P PPPPP PPPP P PPP P PP Sbjct: 215 PPPPPPPPPPSPPPPSPPPPPPPSPPPPSPPPPPPPSPPPPPPP 258 Score = 40.3 bits (90), Expect = 0.053 Identities = 20/48 (41%), Positives = 21/48 (43%), Gaps = 3/48 (6%) Frame = +3 Query: 432 PPXGXXPP-PPPXXXXXXSPPPPXXGGGXPP--PPPXPXXXAXXXXPP 566 PP PP PPP SPPPP PP PPP P + PP Sbjct: 2541 PPPSPPPPLPPPPSPPPPSPPPPSPPPSPPPPSPPPSPPPPSPPPYPP 2588 Score = 40.3 bits (90), Expect = 0.053 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP P PPP SPPPP PPPP P PP Sbjct: 2729 PPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPLPPAPSPPPSPPP 2773 Score = 40.3 bits (90), Expect = 0.053 Identities = 17/46 (36%), Positives = 18/46 (39%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP P PPP PPPP PPP PP + PP Sbjct: 2738 PPPSPPPPSPPPPSPPPPSPPPPLPPAPSPPPSPPPPSPPPSPPPP 2783 Score = 39.9 bits (89), Expect = 0.070 Identities = 17/46 (36%), Positives = 18/46 (39%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPPP P PP PPPP P + PP Sbjct: 210 PPPPLPPPPPPPPPPSPPPPSPPPPPPPSPPPPSPPPPPPPSPPPP 255 Score = 39.9 bits (89), Expect = 0.070 Identities = 18/47 (38%), Positives = 19/47 (40%), Gaps = 1/47 (2%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPP-PPLXXXXXAXXPP 567 PP P PPP PPPP PPPP PP + PP Sbjct: 2728 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPLPPAPSPPPSPPPP 2774 Score = 39.5 bits (88), Expect = 0.093 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPPXXXXXG 584 PP PPPP PPPP PPPP P PP G Sbjct: 215 PPPPPPPPPPSPPPPSPPPPPPPSPPPPSPPPPPPPSPPPPPPPPLPTPTG 265 Score = 39.5 bits (88), Expect = 0.093 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP P PPP PPPP PPPPP PP Sbjct: 2258 PPPSPHPPSPPPPSPPPPSPPPPTPPPSPPPPPPTPPPSPPPPSPP 2303 Score = 39.5 bits (88), Expect = 0.093 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP P PPP PPPP PPPP P PP Sbjct: 2268 PPPSPPPPSPPPPTPPPSPPPPPPTPPPSPPPPSPPPPSPPPPSPP 2313 Score = 39.5 bits (88), Expect = 0.093 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP P PPP PPPP PPP PP PP Sbjct: 2689 PPPSPPPPSPPPPSPPPPSPPPPSPPPSPPPPSPPPPSPPPPSPPP 2734 Score = 39.5 bits (88), Expect = 0.093 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP P PPP PPPP PPPP P PP Sbjct: 2713 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 2758 Score = 39.5 bits (88), Expect = 0.093 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP P PPP PPPP PPPP P PP Sbjct: 2718 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPLPP 2763 Score = 39.1 bits (87), Expect = 0.12 Identities = 17/44 (38%), Positives = 18/44 (40%) Frame = +3 Query: 453 PPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPPXXXXXG 584 PPPP SPPPP PPPP P + PP G Sbjct: 1175 PPPPPSPPPPSPPPPPSPPPPSPPPPLPPPPSPPPPPPLPLIPG 1218 Score = 39.1 bits (87), Expect = 0.12 Identities = 19/48 (39%), Positives = 20/48 (41%), Gaps = 3/48 (6%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPP---PPPXPXXXAXXXXPP 566 PP P PPP SPPPP PP PPP P + PP Sbjct: 2734 PPSPPPPSPPPPSPPPPSPPPPSPPPPLPPAPSPPPSPPPPSPPPSPP 2781 Score = 38.7 bits (86), Expect = 0.16 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPP PPPP PPP PP PP Sbjct: 2269 PPSPPPPSPPPPTPPPSPPPPPPTPPPSPPPPSPPPPSPPPPSPPP 2314 Score = 38.7 bits (86), Expect = 0.16 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PP PP PPPP PPPP P PP Sbjct: 2532 PPPPSPPPSPPPSPPPPLPPPPSPPPPSPPPPSPPPSPPPPSPPP 2576 Score = 38.7 bits (86), Expect = 0.16 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PP PP SPPP PP PP P PP Sbjct: 2667 PPSPPPPPSPPPSPPPPSPPPSPPPSPPPPSPPPPSPPPPSPPPP 2711 Score = 38.7 bits (86), Expect = 0.16 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PP PP SPPP PPP P P PP Sbjct: 2671 PPPPSPPPSPPPPSPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPP 2715 Score = 38.7 bits (86), Expect = 0.16 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP P PPP SPPP PPP P P PP Sbjct: 2695 PPSPPPPSPPPPSPPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPP 2739 Score = 38.7 bits (86), Expect = 0.16 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PP PP PPPP PPPP P PP Sbjct: 2698 PPPPSPPPPSPPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 2743 Score = 38.7 bits (86), Expect = 0.16 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PP PP PPPP PPPP P PP Sbjct: 2703 PPPPSPPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 2748 Score = 38.7 bits (86), Expect = 0.16 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP P PPP PPPP PPPP P PP Sbjct: 2708 PPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 2753 Score = 38.3 bits (85), Expect = 0.21 Identities = 18/52 (34%), Positives = 18/52 (34%) Frame = +3 Query: 411 FXXXGXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 F PP P P P SPPPP PPP P P PP Sbjct: 2247 FYNENSPPPSPPPPSPHPPSPPPPSPPPPSPPPPTPPPSPPPPPPTPPPSPP 2298 Score = 38.3 bits (85), Expect = 0.21 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = +3 Query: 435 PXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 P PPP P SPPPP PPPP P PP Sbjct: 2676 PPPSPPPPSPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPSPPP 2719 Score = 37.9 bits (84), Expect = 0.28 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPPP PPP PPP PP PP Sbjct: 211 PPPLPPPPPPPPPPSPPPPSPPPPPPPSPPPPSPPPPPPPSPPPPP 256 Score = 37.5 bits (83), Expect = 0.37 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPP SPPPP PP PP P PP Sbjct: 2279 PPTPPPSPPPPPPTPPPSPPPPSP---PPPSPPPPSPPPPSQPPP 2320 Score = 37.5 bits (83), Expect = 0.37 Identities = 18/48 (37%), Positives = 19/48 (39%), Gaps = 2/48 (4%) Frame = +1 Query: 430 PPXGXXXPP--PPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PP PPP PPPP PPP PP + PP Sbjct: 2534 PPSPPPSPPPSPPPPLPPPPSPPPPSPPPPSPPPSPPPPSPPPSPPPP 2581 Score = 37.5 bits (83), Expect = 0.37 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPP 534 PP PP PP PPPP PPP PP Sbjct: 2550 PPPPSPPPPSPPPPSPPPSPPPPSPPPSPPPPSPP 2584 Score = 37.5 bits (83), Expect = 0.37 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 1/47 (2%) Frame = +1 Query: 430 PPXGXXXPPPP-PXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPP P PPPP PPPP P PP Sbjct: 2673 PPSPPPSPPPPSPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPSPPP 2719 Score = 37.1 bits (82), Expect = 0.50 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 4/47 (8%) Frame = +3 Query: 402 GXXFXXXGXXPPXGXXP----PPPPXXXXXXSPPPPXXGGGXPPPPP 530 G F PP P PPPP SPPPP PPPPP Sbjct: 1165 GKYFSCNPPSPPPPPSPPPPSPPPPPSPPPPSPPPPLPPPPSPPPPP 1211 Score = 37.1 bits (82), Expect = 0.50 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +3 Query: 435 PXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 P PPPPP PPP PPPPP P Sbjct: 1181 PPPPSPPPPPSPPPPSPPPPLPPPPSPPPPPPLP 1214 Score = 37.1 bits (82), Expect = 0.50 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPP 530 PP PP PP SPPPP PPP P Sbjct: 2753 PPPSPPPPLPPAPSPPPSPPPPSPPPSPPPPSP 2785 Score = 36.7 bits (81), Expect = 0.65 Identities = 17/37 (45%), Positives = 17/37 (45%), Gaps = 2/37 (5%) Frame = +3 Query: 432 PPXGXXP--PPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 PP P PPPP SPPPP PPPP P Sbjct: 1172 PPSPPPPPSPPPPSPPPPPSPPPPSPPPPLPPPPSPP 1208 Score = 36.7 bits (81), Expect = 0.65 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP P PPP SPPPP PPPP P PP Sbjct: 2529 PPSPPPPSPPP--SPPPSPPPPLPPPPSPPPPSPPPPSPPPSPPP 2571 Score = 36.7 bits (81), Expect = 0.65 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPP 534 PP PP PP PPPP PPP PP Sbjct: 2752 PPPPSPPPPLPPAPSPPPSPPPPSPPPSPPPPSPP 2786 Score = 36.3 bits (80), Expect = 0.86 Identities = 15/39 (38%), Positives = 16/39 (41%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 P PPP PPPP PP PPP + PP Sbjct: 2668 PSPPPPPSPPPSPPPPSPPPSPPPSPPPPSPPPPSPPPP 2706 Score = 36.3 bits (80), Expect = 0.86 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP P PPP PPPP PP P P PP Sbjct: 2733 PPPSPPPPSPPPPSPPPPSPPPPSPPPPLPPAPSPPPSPPPPSPPP 2778 Score = 35.9 bits (79), Expect = 1.1 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP P P P PPPP PPP PP PP Sbjct: 2253 PPPSPPPPSPHPPSPPPPSPPPPSPPPPTPPPSPPPPPPTPPPSPP 2298 Score = 35.9 bits (79), Expect = 1.1 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +1 Query: 433 PXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 P PP PP PPPP PPPP P PP Sbjct: 2532 PPPPSPPPSPPPSPPPPLPPPPSPPPPSPPPPSPPPSPPPPSPPP 2576 Score = 35.5 bits (78), Expect = 1.5 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PP PP P PP PPPP P PP Sbjct: 205 PPPPPPPPPLPPPPPPPPPPSPPPPSPPPPPPPSPPPPSPPPPPPP 250 Score = 35.5 bits (78), Expect = 1.5 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPP PP P PPP PP PP Sbjct: 2264 PPSPPPPSPPPPSPPPPTPPPSPPPPPPTPPPSPPPPSPPPPSPPP 2309 Score = 35.5 bits (78), Expect = 1.5 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 2/37 (5%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPP--PP 534 PP PP PP PPPP PPPP PP Sbjct: 2283 PPSPPPPPPTPPPSPPPPSPPPPSPPPPSPPPPSQPP 2319 Score = 35.5 bits (78), Expect = 1.5 Identities = 17/46 (36%), Positives = 17/46 (36%), Gaps = 1/46 (2%) Frame = +1 Query: 433 PXGXXXPPPP-PXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 P PPPP P PPPP PPPP P PP Sbjct: 2526 PCSPPSPPPPSPPPSPPPSPPPPLPPPPSPPPPSPPPPSPPPSPPP 2571 Score = 35.5 bits (78), Expect = 1.5 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PP PP PPP PPPP P PP Sbjct: 2693 PPPPSPPPPSPPPPSPPPPSPPPSPPPPSPPPPSPPPPSPPPPSPP 2738 Score = 35.1 bits (77), Expect = 2.0 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PPPPP PPPP PP PP P PP Sbjct: 1175 PPPPPSPPPPSPPPPPSP---PPPSPPPPLPPPPSPPPP 1210 Score = 35.1 bits (77), Expect = 2.0 Identities = 17/46 (36%), Positives = 18/46 (39%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPP PPPP PP PPP + PP Sbjct: 2278 PPPTPPPSPPPPPPTPPPSPPPPSP---PPPSPPPPSPPPPSQPPP 2320 Score = 35.1 bits (77), Expect = 2.0 Identities = 17/47 (36%), Positives = 17/47 (36%), Gaps = 1/47 (2%) Frame = +2 Query: 431 PPXGXXXPP-PPXXXXKXXXPPPXXXGXXXPPPPXPXXXXXXXXPPP 568 PP PP PP PPP PPPP P PPP Sbjct: 2727 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPLPPAPSPPPSPPP 2773 Score = 34.3 bits (75), Expect = 3.5 Identities = 17/48 (35%), Positives = 17/48 (35%), Gaps = 2/48 (4%) Frame = +2 Query: 431 PPXGXXXPPPPXXXXKXXXP--PPXXXGXXXPPPPXPXXXXXXXXPPP 568 PP PPPP P PP PPPP P PPP Sbjct: 2538 PPSPPPSPPPPLPPPPSPPPPSPPPPSPPPSPPPPSPPPSPPPPSPPP 2585 Score = 34.3 bits (75), Expect = 3.5 Identities = 15/45 (33%), Positives = 16/45 (35%) Frame = +1 Query: 433 PXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 P PP PP PPP PP PPP + PP Sbjct: 2667 PPSPPPPPSPPPSPPPPSPPPSPPPSPPPPSPPPPSPPPPSPPPP 2711 Score = 33.9 bits (74), Expect = 4.6 Identities = 15/30 (50%), Positives = 15/30 (50%), Gaps = 1/30 (3%) Frame = +1 Query: 451 PPPPPXXXKXXXPPP-PXXGXXXPPPPPPL 537 PPPPP PPP P PPPP PL Sbjct: 1186 PPPPPSPPPPSPPPPLPPPPSPPPPPPLPL 1215 Score = 33.5 bits (73), Expect = 6.1 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +2 Query: 452 PPPPXXXXKXXXPPPXXXGXXXPPPPXPXXXXXXXXPPP 568 PPPP PPP PP P P PPP Sbjct: 2277 PPPPTPPPSPPPPPPTPPPSPPPPSPPPPSPPPPSPPPP 2315 >UniRef50_Q2IHA5 Cluster: Putative uncharacterized protein; n=1; Anaeromyxobacter dehalogenans 2CP-C|Rep: Putative uncharacterized protein - Anaeromyxobacter dehalogenans (strain 2CP-C) Length = 359 Score = 45.2 bits (102), Expect = 0.002 Identities = 21/48 (43%), Positives = 21/48 (43%), Gaps = 3/48 (6%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPP---PPXPXXXAXXXXPP 566 P G PPPPP PPPP G G PPP PP P PP Sbjct: 73 PVWGAPPPPPPGGELPPPPPPPPGGYGAPPPAWGPPPPSGAPGGWGPP 120 Score = 41.1 bits (92), Expect = 0.030 Identities = 21/54 (38%), Positives = 22/54 (40%), Gaps = 8/54 (14%) Frame = +3 Query: 399 GGXXFXXXGXXPPXGXXPPPPPXXXXXXSPPPPXXG--------GGXPPPPPXP 536 GG + PP G PPPPP PPP G GG PPPP P Sbjct: 71 GGPVWGAPPPPPPGGELPPPPPPPPGGYGAPPPAWGPPPPSGAPGGWGPPPPPP 124 Score = 39.5 bits (88), Expect = 0.093 Identities = 19/45 (42%), Positives = 20/45 (44%), Gaps = 10/45 (22%) Frame = +3 Query: 432 PPXGXXPPPP----------PXXXXXXSPPPPXXGGGXPPPPPXP 536 PP PPPP P +PPPP GG PPPPP P Sbjct: 50 PPAAEPPPPPAPAPASGPSEPGGPVWGAPPPPPPGGELPPPPPPP 94 Score = 36.7 bits (81), Expect = 0.65 Identities = 20/51 (39%), Positives = 20/51 (39%), Gaps = 6/51 (11%) Frame = +1 Query: 433 PXGXXX---PPPPPXXXKXXXPPPPXXGXXXPPP---PPPLXXXXXAXXPP 567 P G PPPPP PPPP G PPP PPP PP Sbjct: 70 PGGPVWGAPPPPPPGGELPPPPPPPPGGYGAPPPAWGPPPPSGAPGGWGPP 120 Score = 36.7 bits (81), Expect = 0.65 Identities = 18/45 (40%), Positives = 19/45 (42%), Gaps = 9/45 (20%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXX---------GXXXPPPPPPL 537 PP G PPPPP PPP G PPPPPP+ Sbjct: 82 PPGGELPPPPPPPPGGYGAPPPAWGPPPPSGAPGGWGPPPPPPPM 126 Score = 35.5 bits (78), Expect = 1.5 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -1 Query: 404 PPPPPPGGXXXTPXGGXPPPXXG 336 PPPPPPGG P PPP G Sbjct: 90 PPPPPPGGYGAPPPAWGPPPPSG 112 Score = 34.7 bits (76), Expect = 2.6 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +1 Query: 454 PPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXP 564 P P PPPP G PPPPPP A P Sbjct: 67 PSEPGGPVWGAPPPPPPGGELPPPPPPPPGGYGAPPP 103 >UniRef50_Q3HTK5 Cluster: Pherophorin-C2 protein precursor; n=8; Chlamydomonadales|Rep: Pherophorin-C2 protein precursor - Chlamydomonas reinhardtii Length = 853 Score = 45.2 bits (102), Expect = 0.002 Identities = 19/45 (42%), Positives = 20/45 (44%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP SPPPP PP PP P + PP Sbjct: 250 PPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPP 294 Score = 45.2 bits (102), Expect = 0.002 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP P PPP SPPPP PPPPP P PP Sbjct: 255 PPPPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPP 299 Score = 45.2 bits (102), Expect = 0.002 Identities = 18/35 (51%), Positives = 18/35 (51%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 PP PPPPP SPPPP PPPPP P Sbjct: 302 PPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPPPP 336 Score = 45.2 bits (102), Expect = 0.002 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP P PPP SPPPP PPPPP P PP Sbjct: 312 PPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPP 356 Score = 45.2 bits (102), Expect = 0.002 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP P PPP SPPPP PPPPP P PP Sbjct: 356 PPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPP 400 Score = 45.2 bits (102), Expect = 0.002 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP P PPP SPPPP PPPPP P PP Sbjct: 410 PPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPP 454 Score = 45.2 bits (102), Expect = 0.002 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPP P SPPPP PPPPP P PP Sbjct: 418 PPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPP 462 Score = 45.2 bits (102), Expect = 0.002 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP P PPP SPPPP PPPPP P PP Sbjct: 470 PPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPP 514 Score = 44.4 bits (100), Expect = 0.003 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP P PPP SPPPP PPPPP P PP Sbjct: 209 PPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPP 253 Score = 44.4 bits (100), Expect = 0.003 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPP P SPPPP PPPPP P PP Sbjct: 227 PPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPP 271 Score = 44.4 bits (100), Expect = 0.003 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP SPPPP PP PP P PP Sbjct: 232 PPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPP 276 Score = 44.4 bits (100), Expect = 0.003 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP SPPPP PP PP P PP Sbjct: 284 PPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPP 328 Score = 44.4 bits (100), Expect = 0.003 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP SPPPP PPPP P PP Sbjct: 341 PPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPP 385 Score = 44.4 bits (100), Expect = 0.003 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP SPPPP PPPP P PP Sbjct: 385 PPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 429 Score = 44.4 bits (100), Expect = 0.003 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP SPPPP PPPP P PP Sbjct: 455 PPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPP 499 Score = 44.4 bits (100), Expect = 0.003 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP SPPPP PPPP P PP Sbjct: 499 PPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPP 543 Score = 44.4 bits (100), Expect = 0.003 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP P PPP SPPPP PPPPP P PP Sbjct: 509 PPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPP 553 Score = 44.0 bits (99), Expect = 0.004 Identities = 20/46 (43%), Positives = 20/46 (43%), Gaps = 1/46 (2%) Frame = +3 Query: 432 PPXGXXPPPP-PXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPP P SPPPP PPPPP P PP Sbjct: 425 PPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPP 470 Score = 43.6 bits (98), Expect = 0.006 Identities = 18/46 (39%), Positives = 19/46 (41%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP P PPP PPPP PPPPPP + PP Sbjct: 208 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPP 253 Score = 43.6 bits (98), Expect = 0.006 Identities = 18/46 (39%), Positives = 19/46 (41%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP P PPP PPPP PPPPPP + PP Sbjct: 508 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPP 553 Score = 43.2 bits (97), Expect = 0.008 Identities = 20/47 (42%), Positives = 20/47 (42%), Gaps = 2/47 (4%) Frame = +3 Query: 432 PPXGXXPPPP--PXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPP P SPPPP PPPPP P PP Sbjct: 277 PPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPP 323 Score = 42.7 bits (96), Expect = 0.010 Identities = 18/46 (39%), Positives = 19/46 (41%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPP P PPPP PPPPPP + PP Sbjct: 278 PPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPP 323 Score = 42.7 bits (96), Expect = 0.010 Identities = 18/46 (39%), Positives = 19/46 (41%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPPP PPPP PP PPP + PP Sbjct: 283 PPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPP 328 Score = 42.7 bits (96), Expect = 0.010 Identities = 18/46 (39%), Positives = 19/46 (41%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPPP PPPP PPPP P + PP Sbjct: 340 PPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPP 385 Score = 42.7 bits (96), Expect = 0.010 Identities = 18/46 (39%), Positives = 19/46 (41%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPPP P PP PPPPPP + PP Sbjct: 431 PPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPP 476 Score = 42.7 bits (96), Expect = 0.010 Identities = 18/46 (39%), Positives = 19/46 (41%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPPP PPPP PPPP P + PP Sbjct: 454 PPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPP 499 Score = 41.9 bits (94), Expect = 0.017 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 PP PPP P SPPPP PPPPP P Sbjct: 245 PPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPPP 279 Score = 41.9 bits (94), Expect = 0.017 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP P PPP SPPPP PP PP P PP Sbjct: 289 PPPPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPP 333 Score = 41.9 bits (94), Expect = 0.017 Identities = 18/45 (40%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP P PPP SPPPP PP PP P + PP Sbjct: 307 PPPPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPP 351 Score = 41.9 bits (94), Expect = 0.017 Identities = 18/45 (40%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP P PPP SPPPP PP PP P + PP Sbjct: 351 PPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPP 395 Score = 41.9 bits (94), Expect = 0.017 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPPP PPPP PPPP P PP Sbjct: 384 PPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 429 Score = 41.9 bits (94), Expect = 0.017 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 PP P PPP SPPPP PPPPP P Sbjct: 400 PPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPP 434 Score = 41.9 bits (94), Expect = 0.017 Identities = 18/45 (40%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP P PPP SPPPP PP PP P + PP Sbjct: 405 PPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPP 449 Score = 41.9 bits (94), Expect = 0.017 Identities = 18/45 (40%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP P PPP SPPPP PP PP P + PP Sbjct: 465 PPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPP 509 Score = 41.9 bits (94), Expect = 0.017 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPPP PPPP PPPP P PP Sbjct: 498 PPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPP 543 Score = 41.5 bits (93), Expect = 0.023 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPP 534 PP P PPP PPPP PPPPPP Sbjct: 399 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPP 433 Score = 41.1 bits (92), Expect = 0.030 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP P PPP SPPPP PPPP P PP Sbjct: 194 PPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 238 Score = 41.1 bits (92), Expect = 0.030 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP P PPP SPPPP PPPP P PP Sbjct: 199 PPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPP 243 Score = 41.1 bits (92), Expect = 0.030 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP P PPP SPPPP PPPP P PP Sbjct: 204 PPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPP 248 Score = 41.1 bits (92), Expect = 0.030 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP P PPP SPPPP PP PP P PP Sbjct: 214 PPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPP 258 Score = 41.1 bits (92), Expect = 0.030 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPP P SPPPP PPPP P PP Sbjct: 297 PPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPP 341 Score = 41.1 bits (92), Expect = 0.030 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP P PPP SPPPP PPPP P PP Sbjct: 390 PPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPP 434 Score = 41.1 bits (92), Expect = 0.030 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP P PPP SPPPP PPPP P PP Sbjct: 395 PPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPP 439 Score = 41.1 bits (92), Expect = 0.030 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP P PPP SPPPP PPPP P PP Sbjct: 504 PPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPP 548 Score = 41.1 bits (92), Expect = 0.030 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP P PPP SPPPP PP PP P PP Sbjct: 514 PPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPP 558 Score = 40.7 bits (91), Expect = 0.040 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PP PP PPPP PPPP P PP Sbjct: 264 PPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPP 308 Score = 40.7 bits (91), Expect = 0.040 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PP PP PPPP PPPP P PP Sbjct: 321 PPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPP 365 Score = 40.7 bits (91), Expect = 0.040 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PP PP PPPP PPPP P PP Sbjct: 365 PPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPP 409 Score = 40.7 bits (91), Expect = 0.040 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PP PP PPPP PPPP P PP Sbjct: 479 PPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPP 523 Score = 40.3 bits (90), Expect = 0.053 Identities = 17/46 (36%), Positives = 18/46 (39%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP P PPP PPPP PPPP P + PP Sbjct: 203 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPP 248 Score = 40.3 bits (90), Expect = 0.053 Identities = 17/46 (36%), Positives = 18/46 (39%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP P PPP PPPP PP PPP + PP Sbjct: 213 PPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPP 258 Score = 40.3 bits (90), Expect = 0.053 Identities = 17/46 (36%), Positives = 18/46 (39%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP P PPP PPPP PPPP P + PP Sbjct: 394 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPP 439 Score = 40.3 bits (90), Expect = 0.053 Identities = 17/46 (36%), Positives = 18/46 (39%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP P PPP PPPP PP PPP + PP Sbjct: 513 PPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPP 558 Score = 39.9 bits (89), Expect = 0.070 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPP PPPP P PPPP PP Sbjct: 219 PPSPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPP 264 Score = 39.9 bits (89), Expect = 0.070 Identities = 17/45 (37%), Positives = 18/45 (40%) Frame = +1 Query: 433 PXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 P PPP P PPPP PPPPPP + PP Sbjct: 227 PPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPP 271 Score = 39.9 bits (89), Expect = 0.070 Identities = 17/45 (37%), Positives = 18/45 (40%) Frame = +1 Query: 433 PXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 P PPPPP PPPP PP PPP + PP Sbjct: 232 PPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPP 276 Score = 39.9 bits (89), Expect = 0.070 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPP PPPP P PPPP PP Sbjct: 237 PPPPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPP 282 Score = 39.9 bits (89), Expect = 0.070 Identities = 17/46 (36%), Positives = 18/46 (39%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPP P PPPP PPPP P + PP Sbjct: 239 PPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPP 284 Score = 39.9 bits (89), Expect = 0.070 Identities = 17/46 (36%), Positives = 18/46 (39%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPP PPPP PP PPP + PP Sbjct: 265 PPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPP 310 Score = 39.9 bits (89), Expect = 0.070 Identities = 17/46 (36%), Positives = 18/46 (39%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPP PPPP PPPP P + PP Sbjct: 273 PPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPP 318 Score = 39.9 bits (89), Expect = 0.070 Identities = 17/45 (37%), Positives = 18/45 (40%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPP PPPP PPPP P + PP Sbjct: 291 PPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPPP 335 Score = 39.9 bits (89), Expect = 0.070 Identities = 18/47 (38%), Positives = 19/47 (40%), Gaps = 1/47 (2%) Frame = +1 Query: 430 PPXGXXXP-PPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP P PPPP PPPP PPPP P + PP Sbjct: 311 PPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPP 357 Score = 39.9 bits (89), Expect = 0.070 Identities = 17/46 (36%), Positives = 18/46 (39%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPP PPPP PP PPP + PP Sbjct: 322 PPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPP 367 Score = 39.9 bits (89), Expect = 0.070 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP SPPPP PP PP P PP Sbjct: 332 PPPPPSPPPPP----PPSPPPPPPPSPPPPSPPPPSPPPPSPPPP 372 Score = 39.9 bits (89), Expect = 0.070 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPPP P PP P PPPP PP Sbjct: 333 PPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPP 378 Score = 39.9 bits (89), Expect = 0.070 Identities = 18/47 (38%), Positives = 19/47 (40%), Gaps = 1/47 (2%) Frame = +1 Query: 430 PPXGXXXP-PPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP P PPPP PPPP PPPP P + PP Sbjct: 355 PPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPP 401 Score = 39.9 bits (89), Expect = 0.070 Identities = 17/46 (36%), Positives = 18/46 (39%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPP PPPP PP PPP + PP Sbjct: 366 PPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPP 411 Score = 39.9 bits (89), Expect = 0.070 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP SPPPP PP PP P PP Sbjct: 376 PPPPPSPPPPP----PPSPPPPPPPSPPPPSPPPPSPPPPSPPPP 416 Score = 39.9 bits (89), Expect = 0.070 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PP P PP PP P PP Sbjct: 377 PPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPP 421 Score = 39.9 bits (89), Expect = 0.070 Identities = 18/47 (38%), Positives = 19/47 (40%), Gaps = 1/47 (2%) Frame = +1 Query: 430 PPXGXXXP-PPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP P PPPP PPPP PPPP P + PP Sbjct: 409 PPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPP 455 Score = 39.9 bits (89), Expect = 0.070 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPP PPP PPPPPP PP Sbjct: 424 PPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPP 469 Score = 39.9 bits (89), Expect = 0.070 Identities = 17/46 (36%), Positives = 18/46 (39%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPP PPPP PP PPP + PP Sbjct: 436 PPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPP 481 Score = 39.9 bits (89), Expect = 0.070 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP SPPPP PP PP P PP Sbjct: 446 PPPPPSPPPPP----PPSPPPPPPPSPPPPSPPPPSPPPPSPPPP 486 Score = 39.9 bits (89), Expect = 0.070 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPPP P PP P PPPP PP Sbjct: 447 PPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPP 492 Score = 39.9 bits (89), Expect = 0.070 Identities = 18/47 (38%), Positives = 19/47 (40%), Gaps = 1/47 (2%) Frame = +1 Query: 430 PPXGXXXP-PPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP P PPPP PPPP PPPP P + PP Sbjct: 469 PPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPP 515 Score = 39.9 bits (89), Expect = 0.070 Identities = 17/46 (36%), Positives = 18/46 (39%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPP PPPP PP PPP + PP Sbjct: 480 PPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPP 525 Score = 39.9 bits (89), Expect = 0.070 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP SPPPP PP PP P PP Sbjct: 490 PPPPPSPPPPP----PPSPPPPPPPSPPPPSPPPPSPPPPSPPPP 530 Score = 39.9 bits (89), Expect = 0.070 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PP P PP PP P PP Sbjct: 491 PPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPP 535 Score = 39.5 bits (88), Expect = 0.093 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP P PPP PPPP PPPP P PP Sbjct: 193 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 238 Score = 39.5 bits (88), Expect = 0.093 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP P PPP PPPP PPPP P PP Sbjct: 198 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPP 243 Score = 39.5 bits (88), Expect = 0.093 Identities = 17/46 (36%), Positives = 18/46 (39%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPP P PP PPPPPP + PP Sbjct: 260 PPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPP 305 Score = 39.5 bits (88), Expect = 0.093 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PP PP PPPP PPPP P PP Sbjct: 263 PPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPP 308 Score = 39.5 bits (88), Expect = 0.093 Identities = 17/46 (36%), Positives = 18/46 (39%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPP P PP PPPPPP + PP Sbjct: 317 PPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPP 362 Score = 39.5 bits (88), Expect = 0.093 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PP PP PPPP PPPP P PP Sbjct: 320 PPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPP 365 Score = 39.5 bits (88), Expect = 0.093 Identities = 17/46 (36%), Positives = 18/46 (39%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPP P PPPP PP PPP + PP Sbjct: 327 PPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPP 372 Score = 39.5 bits (88), Expect = 0.093 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP P PPP PPPP PP PPP PP Sbjct: 350 PPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPP 395 Score = 39.5 bits (88), Expect = 0.093 Identities = 17/46 (36%), Positives = 18/46 (39%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPP P PP PPPPPP + PP Sbjct: 361 PPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPP 406 Score = 39.5 bits (88), Expect = 0.093 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PP PP PPPP PPPP P PP Sbjct: 364 PPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPP 409 Score = 39.5 bits (88), Expect = 0.093 Identities = 17/46 (36%), Positives = 18/46 (39%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPP P PPPP PP PPP + PP Sbjct: 371 PPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPP 416 Score = 39.5 bits (88), Expect = 0.093 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP P PPP PPPP PP PPP PP Sbjct: 404 PPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPP 449 Score = 39.5 bits (88), Expect = 0.093 Identities = 17/46 (36%), Positives = 18/46 (39%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPP P PPPP PP PPP + PP Sbjct: 441 PPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPP 486 Score = 39.5 bits (88), Expect = 0.093 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP P PPP PPPP PP PPP PP Sbjct: 464 PPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPP 509 Score = 39.5 bits (88), Expect = 0.093 Identities = 17/46 (36%), Positives = 18/46 (39%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPP P PP PPPPPP + PP Sbjct: 475 PPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPP 520 Score = 39.5 bits (88), Expect = 0.093 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PP PP PPPP PPPP P PP Sbjct: 478 PPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPP 523 Score = 39.5 bits (88), Expect = 0.093 Identities = 17/46 (36%), Positives = 18/46 (39%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPP P PPPP PP PPP + PP Sbjct: 485 PPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPP 530 Score = 39.1 bits (87), Expect = 0.12 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPP P PPPP PPPP P PP Sbjct: 222 PPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPP 266 Score = 39.1 bits (87), Expect = 0.12 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +1 Query: 433 PXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 P PPPPP PPPP PP PPP PP Sbjct: 250 PPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPP 294 Score = 39.1 bits (87), Expect = 0.12 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPP PPPP PPPP P PP Sbjct: 330 PPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPP 375 Score = 39.1 bits (87), Expect = 0.12 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPP PPP PPPPPP PP Sbjct: 346 PPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPP 391 Score = 39.1 bits (87), Expect = 0.12 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPP PPPP PPPP P PP Sbjct: 374 PPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPP 419 Score = 39.1 bits (87), Expect = 0.12 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPP PPPP PP PPP PP Sbjct: 420 PPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPP 465 Score = 39.1 bits (87), Expect = 0.12 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPP PPPP PPPP P PP Sbjct: 444 PPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPP 489 Score = 39.1 bits (87), Expect = 0.12 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPP PPP PPPPPP PP Sbjct: 460 PPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPP 505 Score = 39.1 bits (87), Expect = 0.12 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPP PPPP PPPP P PP Sbjct: 488 PPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPP 533 Score = 38.7 bits (86), Expect = 0.16 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPPP P PP PPPP P PP Sbjct: 325 PPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPP 370 Score = 38.7 bits (86), Expect = 0.16 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPPP PPP PPP PP PP Sbjct: 331 PPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPP 376 Score = 38.7 bits (86), Expect = 0.16 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPP P PPPP PPPP P PP Sbjct: 335 PPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPP 380 Score = 38.7 bits (86), Expect = 0.16 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPPP P PP PPPP P PP Sbjct: 369 PPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPP 414 Score = 38.7 bits (86), Expect = 0.16 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPPP PPP PPP PP PP Sbjct: 375 PPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPP 420 Score = 38.7 bits (86), Expect = 0.16 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPP P PPPP PPPP P PP Sbjct: 379 PPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 424 Score = 38.7 bits (86), Expect = 0.16 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPPP P PP PPPP P PP Sbjct: 439 PPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPP 484 Score = 38.7 bits (86), Expect = 0.16 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPPP PPP PPP PP PP Sbjct: 445 PPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPP 490 Score = 38.7 bits (86), Expect = 0.16 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPP P PPPP PPPP P PP Sbjct: 449 PPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPP 494 Score = 38.7 bits (86), Expect = 0.16 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPPP P PP PPPP P PP Sbjct: 483 PPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPP 528 Score = 38.7 bits (86), Expect = 0.16 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPPP PPP PPP PP PP Sbjct: 489 PPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPP 534 Score = 38.7 bits (86), Expect = 0.16 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPP P PPPP PPPP P PP Sbjct: 493 PPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 538 Score = 38.3 bits (85), Expect = 0.21 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = +3 Query: 435 PXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 P P PPP SPPPP PPPP P PP Sbjct: 190 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 233 Score = 37.9 bits (84), Expect = 0.28 Identities = 20/49 (40%), Positives = 20/49 (40%), Gaps = 4/49 (8%) Frame = +3 Query: 432 PPXGXXPP--PPPXXXXXXSPPPPXXGGGXP--PPPPXPXXXAXXXXPP 566 PP PP PPP SPPPP P PPPP P PP Sbjct: 217 PPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPP 265 Score = 37.9 bits (84), Expect = 0.28 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 1/47 (2%) Frame = +1 Query: 430 PPXGXXXPPPP-PXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPP P PPPP PPPP P PP Sbjct: 290 PPPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPPPP 336 Score = 37.5 bits (83), Expect = 0.37 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PP PP PPP PPP P P PP Sbjct: 241 PPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPP 285 Score = 37.5 bits (83), Expect = 0.37 Identities = 16/45 (35%), Positives = 17/45 (37%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP P PPP PP P PP PP P + PP Sbjct: 242 PPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPPP 286 Score = 37.5 bits (83), Expect = 0.37 Identities = 16/46 (34%), Positives = 17/46 (36%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPP P PP PPPP P + PP Sbjct: 247 PPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPP 292 Score = 37.5 bits (83), Expect = 0.37 Identities = 18/48 (37%), Positives = 19/48 (39%), Gaps = 2/48 (4%) Frame = +1 Query: 430 PPXGXXXPP--PPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PP PPP PPPP PP PPP + PP Sbjct: 286 PPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPP 333 Score = 37.5 bits (83), Expect = 0.37 Identities = 16/46 (34%), Positives = 17/46 (36%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPP P P PP PPPP P + PP Sbjct: 348 PPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPP 393 Score = 37.5 bits (83), Expect = 0.37 Identities = 16/46 (34%), Positives = 17/46 (36%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPP P P PP PPPP P + PP Sbjct: 462 PPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPP 507 Score = 37.1 bits (82), Expect = 0.50 Identities = 16/45 (35%), Positives = 17/45 (37%) Frame = +1 Query: 433 PXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 P PPP P PPPP PPPP P + PP Sbjct: 222 PPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPP 266 Score = 37.1 bits (82), Expect = 0.50 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPP P P PP P PPPP PP Sbjct: 392 PPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPP 437 Score = 36.7 bits (81), Expect = 0.65 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPP P PP PPPP P PP Sbjct: 229 PPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPP 274 Score = 36.7 bits (81), Expect = 0.65 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPP P PP P PPPP PP Sbjct: 294 PPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPPPPSPP 339 Score = 36.7 bits (81), Expect = 0.65 Identities = 16/45 (35%), Positives = 17/45 (37%) Frame = +1 Query: 433 PXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 P PPP P PPPP PPPP P + PP Sbjct: 297 PPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPP 341 Score = 36.7 bits (81), Expect = 0.65 Identities = 16/45 (35%), Positives = 17/45 (37%) Frame = +1 Query: 433 PXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 P P PPP PPPP PPPP P + PP Sbjct: 504 PPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPP 548 Score = 36.7 bits (81), Expect = 0.65 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPP P P PP P PPPP PP Sbjct: 506 PPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPSPP 551 Score = 36.3 bits (80), Expect = 0.86 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPP P PP P PPPP PP Sbjct: 224 PPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPSPP 269 Score = 36.3 bits (80), Expect = 0.86 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +1 Query: 433 PXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 P PPP P PPPP PP PPP PP Sbjct: 413 PPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPP 457 Score = 35.9 bits (79), Expect = 1.1 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +1 Query: 433 PXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 P P PPP PPPP PP PPP PP Sbjct: 307 PPPPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPP 351 Score = 35.9 bits (79), Expect = 1.1 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +1 Query: 433 PXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 P P PPP PPPP PPPP P PP Sbjct: 390 PPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPP 434 Score = 35.5 bits (78), Expect = 1.5 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 P PPP PPPP PPPP P PP Sbjct: 190 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 228 Score = 34.7 bits (76), Expect = 2.6 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +2 Query: 431 PPXGXXXPPPPXXXXKXXXPPPXXXGXXXPPPPXPXXXXXXXXPPP 568 PP PPPP PPP PPPP P PPP Sbjct: 423 PPPPSPPPPPP-----PSPPPPPPPSPPPPPPPSPPPPPPPSPPPP 463 Score = 34.3 bits (75), Expect = 3.5 Identities = 15/43 (34%), Positives = 16/43 (37%) Frame = +1 Query: 439 GXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 G PPPP PP P PP PPP + PP Sbjct: 188 GIPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPP 230 Score = 33.5 bits (73), Expect = 6.1 Identities = 15/45 (33%), Positives = 16/45 (35%) Frame = +1 Query: 433 PXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 P P PPP PP P PP PPP + PP Sbjct: 382 PPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPP 426 Score = 33.5 bits (73), Expect = 6.1 Identities = 15/45 (33%), Positives = 16/45 (35%) Frame = +1 Query: 433 PXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 P P PPP PP P PP PPP + PP Sbjct: 496 PPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPP 540 Score = 33.1 bits (72), Expect = 8.1 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +2 Query: 431 PPXGXXXPPPPXXXXKXXXPPPXXXGXXXPPPPXPXXXXXXXXPPP 568 PP P PP PPP PPPP P PPP Sbjct: 218 PPPSPPPPSPPPPSPPPPSPPPPP--PPSPPPPSPPPPSPPPPPPP 261 Score = 33.1 bits (72), Expect = 8.1 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +2 Query: 431 PPXGXXXPPPPXXXXKXXXPPPXXXGXXXPPPPXPXXXXXXXXPPP 568 PP PPP PPP PPPP P PPP Sbjct: 257 PPPPPSPPPPSPPPPS--PPPPPPPSPPPPPPPSPPPPPPPSPPPP 300 Score = 33.1 bits (72), Expect = 8.1 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +2 Query: 431 PPXGXXXPPPPXXXXKXXXPPPXXXGXXXPPPPXPXXXXXXXXPPP 568 PP PPP PPP PPPP P PPP Sbjct: 428 PPPPPPPSPPPPPPPS--PPPPPPPSPPPPPPPSPPPPPPPSPPPP 471 >UniRef50_Q01HL2 Cluster: H0211F06-OSIGBa0153M17.6 protein; n=12; Magnoliophyta|Rep: H0211F06-OSIGBa0153M17.6 protein - Oryza sativa (Rice) Length = 1510 Score = 45.2 bits (102), Expect = 0.002 Identities = 21/54 (38%), Positives = 22/54 (40%) Frame = +3 Query: 423 GXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPPXXXXXG 584 G PP P PP +PPPP G G PPPPP P PP G Sbjct: 1079 GGIPPL-PPPLPPTLGDYGVAPPPPSIGAGAPPPPPPPGGITGVPPPPPIGGLG 1131 Score = 41.1 bits (92), Expect = 0.030 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = +3 Query: 441 GXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 G P PPP PPP GG PPPP P PP Sbjct: 1158 GGPPAPPPPAGFRGGTPPPNAHGGVAPPPPPPRGHGGVGGPP 1199 Score = 39.5 bits (88), Expect = 0.093 Identities = 16/39 (41%), Positives = 17/39 (43%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PPPP PPPP G PPPPP+ PP Sbjct: 1099 PPPPSIGAGAPPPPPPPGGITGVPPPPPIGGLGGHQAPP 1137 Score = 39.5 bits (88), Expect = 0.093 Identities = 20/48 (41%), Positives = 20/48 (41%), Gaps = 3/48 (6%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXG-GG--XPPPPPXPXXXAXXXXPPXXXXXG 584 PPPPP PPPP G GG PP PP P PP G Sbjct: 1111 PPPPPGGITGVPPPPPIGGLGGHQAPPAPPLPEGIGGVPPPPPVGGLG 1158 Score = 38.7 bits (86), Expect = 0.16 Identities = 21/49 (42%), Positives = 21/49 (42%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPP 527 PPRG GG PP PP PP PPPP G G P PP Sbjct: 1188 PPRGHGG----VGGPPTPPGAPTPPMPPGVPG--GPPPPPGGRGLPAPP 1230 Score = 37.9 bits (84), Expect = 0.28 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 2/45 (4%) Frame = +1 Query: 439 GXXXPPPPPXXXKXXXPPPP--XXGXXXPPPPPPLXXXXXAXXPP 567 G PPPPP PPPP G PP PPL PP Sbjct: 1107 GAPPPPPPPGGITGVPPPPPIGGLGGHQAPPAPPLPEGIGGVPPP 1151 Score = 36.7 bits (81), Expect = 0.65 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 2/41 (4%) Frame = +3 Query: 450 PPPPPXXXXXXS-PPPPXXGG-GXPPPPPXPXXXAXXXXPP 566 PP PP PPPP GG G PP PP P PP Sbjct: 1136 PPAPPLPEGIGGVPPPPPVGGLGGPPAPPPPAGFRGGTPPP 1176 Score = 36.3 bits (80), Expect = 0.86 Identities = 23/64 (35%), Positives = 23/64 (35%), Gaps = 2/64 (3%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXX--PPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXX 554 PP GG GG PP G PPP PPPP G G PP P Sbjct: 1152 PPVGGLGGPP----APPPPAGFRGGTPPPNAHGGVAPPPPPPRGHGGVGGPPTPPGAPTP 1207 Query: 555 XXPP 566 PP Sbjct: 1208 PMPP 1211 Score = 35.5 bits (78), Expect = 1.5 Identities = 21/58 (36%), Positives = 22/58 (37%), Gaps = 7/58 (12%) Frame = +3 Query: 432 PPXGXX--PPPPPXXXXXX-----SPPPPXXGGGXPPPPPXPXXXAXXXXPPXXXXXG 584 PP G PPPPP +PP P GG PPPPP PP G Sbjct: 1114 PPGGITGVPPPPPIGGLGGHQAPPAPPLPEGIGGVPPPPPVGGLGGPPAPPPPAGFRG 1171 Score = 35.1 bits (77), Expect = 2.0 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 454 PPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP P PPPP G PP PPP PP Sbjct: 1139 PPLPEGIGGVPPPPPVGGLGGPPAPPPPAGFRGGTPPP 1176 Score = 34.7 bits (76), Expect = 2.6 Identities = 21/52 (40%), Positives = 21/52 (40%), Gaps = 3/52 (5%) Frame = -2 Query: 526 GGGGXPPPXXGGG--GXXFXXXXGG-GGGXXPXGGXXPXFXKXXPPPPPRGG 380 G G PPP GG G GG GG P P PPPPP GG Sbjct: 1105 GAGAPPPPPPPGGITGVPPPPPIGGLGGHQAPPAPPLPEGIGGVPPPPPVGG 1156 >UniRef50_Q22715 Cluster: Putative uncharacterized protein; n=3; Caenorhabditis|Rep: Putative uncharacterized protein - Caenorhabditis elegans Length = 866 Score = 45.2 bits (102), Expect = 0.002 Identities = 22/53 (41%), Positives = 22/53 (41%), Gaps = 8/53 (15%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGG--------GXPPPPPXPXXXAXXXXPP 566 P G PPPPP PPPP GG G PPPPP P PP Sbjct: 78 PGPGGIPPPPPMFAGGIPPPPPMMGGIPPPPPMFGAPPPPPPPSGLGVAPQPP 130 Score = 42.3 bits (95), Expect = 0.013 Identities = 19/46 (41%), Positives = 20/46 (43%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPPP PPPP G PPPPP+ PP Sbjct: 77 PPGPGGIPPPPPMFAGGIPPPPPMMGGI--PPPPPMFGAPPPPPPP 120 Score = 41.1 bits (92), Expect = 0.030 Identities = 20/46 (43%), Positives = 20/46 (43%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPP PPPP G PPPPPP A PP Sbjct: 87 PPMFAGGIPPPPPMMGGIPPPPPMFGA--PPPPPPPSGLGVAPQPP 130 Score = 40.7 bits (91), Expect = 0.040 Identities = 17/32 (53%), Positives = 17/32 (53%) Frame = +3 Query: 435 PXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPP 530 P G PPPP PPPP GG PPPPP Sbjct: 70 PNGFIPPPP--GPGGIPPPPPMFAGGIPPPPP 99 Score = 37.9 bits (84), Expect = 0.28 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 PP PPPP PPPP G G P PP P Sbjct: 98 PPMMGGIPPPPPMFGAPPPPPPPSGLGVAPQPPRP 132 Score = 34.7 bits (76), Expect = 2.6 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 4/39 (10%) Frame = +3 Query: 423 GXXPPXGXXPPP----PPXXXXXXSPPPPXXGGGXPPPP 527 G PP P P PP PPPP GG PPPP Sbjct: 50 GILPPGQSIPKPSFFIPPPVPNGFIPPPPGPGGIPPPPP 88 Score = 34.7 bits (76), Expect = 2.6 Identities = 19/51 (37%), Positives = 19/51 (37%), Gaps = 5/51 (9%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPP-----PPLXXXXXAXXPP 567 PP PPPP PPP G PPPP PP A PP Sbjct: 67 PPVPNGFIPPPPGPGGIPPPPPMFAGGIPPPPPMMGGIPPPPPMFGAPPPP 117 >UniRef50_A0E3T6 Cluster: Chromosome undetermined scaffold_77, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_77, whole genome shotgun sequence - Paramecium tetraurelia Length = 1215 Score = 45.2 bits (102), Expect = 0.002 Identities = 20/47 (42%), Positives = 21/47 (44%), Gaps = 2/47 (4%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGG--GXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP G PPPPP P + PP Sbjct: 658 PPPPPPPPPPPSKNGAPPPPPPPPPSRNGAPPPPPPPPPPSKTGAPP 704 Score = 44.8 bits (101), Expect = 0.002 Identities = 17/33 (51%), Positives = 17/33 (51%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPP 530 PP PPPP PPPP GG PPPPP Sbjct: 688 PPPPPPPPPPSKTGAPPPPPPPRIGGAPPPPPP 720 Score = 43.2 bits (97), Expect = 0.008 Identities = 21/50 (42%), Positives = 21/50 (42%), Gaps = 4/50 (8%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXX----GXXXPPPPPPLXXXXXAXXPP 567 PP PPPPP PPPP G PPPPPP A PP Sbjct: 657 PPPPPPPPPPPPSKNGAPPPPPPPPPSRNGAPPPPPPPPPPSKTGAPPPP 706 Score = 42.3 bits (95), Expect = 0.013 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +3 Query: 435 PXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 P PPPPP PPPP G PPPPP P PP Sbjct: 651 PNTQVPPPPPPPPP---PPPPSKNGAPPPPPPPPPSRNGAPPPP 691 Score = 41.1 bits (92), Expect = 0.030 Identities = 16/29 (55%), Positives = 16/29 (55%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPPL 537 PPPPP PPPP PPPPPPL Sbjct: 693 PPPPPSKTGAPPPPPPPRIGGAPPPPPPL 721 Score = 40.7 bits (91), Expect = 0.040 Identities = 22/62 (35%), Positives = 22/62 (35%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXX 560 PP G P PPPPP PPPP G PPPPP P Sbjct: 665 PPPPSKNGAPPPPPPPPPSRNGAPPPPP-------PPPPPSKTGAPPPPPPPRIGGAPPP 717 Query: 561 PP 566 PP Sbjct: 718 PP 719 Score = 39.9 bits (89), Expect = 0.070 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPP PPP G PPPPP P PP Sbjct: 648 PPLPNTQVPPPPPPPPPPPPPSKNGAPPPPPPPPPSRNGAPPPPP 692 Score = 39.9 bits (89), Expect = 0.070 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PPPPP PPPP PPPPPP A PP Sbjct: 656 PPPPPP---PPPPPPPSKNGAPPPPPPPPPSRNGAPPPP 691 Score = 39.5 bits (88), Expect = 0.093 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPPP PPPP PPPPPP PP Sbjct: 681 PPSRNGAPPPPPP------PPPPSKTGAPPPPPPPRIGGAPPPPPP 720 Score = 38.7 bits (86), Expect = 0.16 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 4/49 (8%) Frame = +3 Query: 432 PPXGXXPPPP----PXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PP P P PPPP G PPPPP P PP Sbjct: 642 PPPPPPPPLPNTQVPPPPPPPPPPPPPSKNGAPPPPPPPPPSRNGAPPP 690 Score = 38.3 bits (85), Expect = 0.21 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PPPPP PPPP PPPPPP PP Sbjct: 644 PPPPPPLPNTQVPPPPPP---PPPPPPPSKNGAPPPPPP 679 Score = 37.1 bits (82), Expect = 0.50 Identities = 18/47 (38%), Positives = 19/47 (40%), Gaps = 4/47 (8%) Frame = +1 Query: 439 GXXXPPPPPXXXKXXXPPPPXX----GXXXPPPPPPLXXXXXAXXPP 567 G PPPPP + PPPP PPPPP A PP Sbjct: 672 GAPPPPPPPPPSRNGAPPPPPPPPPPSKTGAPPPPPPPRIGGAPPPP 718 Score = 35.5 bits (78), Expect = 1.5 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PPPPP PPP PPPPPP A PP Sbjct: 643 PPPPPPPLPNTQVPPP----PPPPPPPPPPSKNGAPPPP 677 >UniRef50_UPI0000E4A382 Cluster: PREDICTED: similar to DNA-dependent protein kinase catalytic subunit; n=5; Strongylocentrotus purpuratus|Rep: PREDICTED: similar to DNA-dependent protein kinase catalytic subunit - Strongylocentrotus purpuratus Length = 1729 Score = 44.8 bits (101), Expect = 0.002 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPP 534 P PPPPP PPPP G PPPPPP Sbjct: 1642 PTMAPIPPPPPPPFGAAPPPPPPPCGAPPPPPPPP 1676 Score = 44.0 bits (99), Expect = 0.004 Identities = 17/33 (51%), Positives = 17/33 (51%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXA 548 PPPPP PPPP G PPPPP P A Sbjct: 1649 PPPPPPFGAAPPPPPPPCGAPPPPPPPPPPISA 1681 Score = 34.7 bits (76), Expect = 2.6 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 487 PPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PPPP G PPPPPP PP Sbjct: 1650 PPPPPFGAAPPPPPPPCGAPPPPPPPP 1676 Score = 34.3 bits (75), Expect = 3.5 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +3 Query: 486 PPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PPPP G PPPPP P PP Sbjct: 1649 PPPPPPFGAAPPPPPPPCGAPPPPPPP 1675 >UniRef50_Q8IMM6 Cluster: CG5514-PB, isoform B; n=3; Drosophila melanogaster|Rep: CG5514-PB, isoform B - Drosophila melanogaster (Fruit fly) Length = 1150 Score = 44.8 bits (101), Expect = 0.002 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 396 PPHTIEPPPPPAPPTLVPPPPPAPPTIKPPPPPAPPTVEPPPPPP 440 Score = 44.0 bits (99), Expect = 0.004 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPP 531 PP PPPPP K PPPP PPPPP Sbjct: 443 PPTVEPPPPPPPAPTKVEPPPPPAPAEVEPPPPP 476 Score = 42.7 bits (96), Expect = 0.010 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = +3 Query: 435 PXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 P PPPPP PPPP PPPPP P PP Sbjct: 408 PPTLVPPPPPAPPTIKPPPPPAPPTVEPPPPPPPAPPTVEPPPP 451 Score = 41.9 bits (94), Expect = 0.017 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPPP PPPP PPPPP PP Sbjct: 395 PPPHTIEPPPPPAPPTLVPPPPPAPPTIKPPPPPAPPTVEPPPPPP 440 Score = 41.9 bits (94), Expect = 0.017 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PPPPP PPPP PPPPPP PP Sbjct: 413 PPPPPAPPTIKPPPPPAPPTVEPPPPPPPAPPTVEPPPP 451 Score = 41.9 bits (94), Expect = 0.017 Identities = 18/46 (39%), Positives = 19/46 (41%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPP P + PPPP PPPPPP PP Sbjct: 419 PPTIKPPPPPAPPTVEPPPPPPPAPPTVEPPPPPPPAPTKVEPPPP 464 Score = 40.3 bits (90), Expect = 0.053 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 P PPPPP PPPP PPPPP P Sbjct: 444 PTVEPPPPPPPAPTKVEPPPPPAPAEVEPPPPPAP 478 Score = 39.9 bits (89), Expect = 0.070 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +1 Query: 433 PXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 P PPPPP PPPP PPPPP PP Sbjct: 443 PPTVEPPPPPPPAPTKVEPPPPPAPAEVEPPPPPAPTELEPPPPP 487 Score = 39.5 bits (88), Expect = 0.093 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPP PPPP PPPPP PP Sbjct: 394 PPPPHTIEPPPPPAPPTLVPPPPPAPPTIKPPPPPAPPTVEPPPPP 439 Score = 39.5 bits (88), Expect = 0.093 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPP PPPP PPPPP PP Sbjct: 453 PPAPTKVEPPPPPAPAEVEPPPPPAPTELEPPPPPAPPKVELPPPP 498 Score = 38.7 bits (86), Expect = 0.16 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPP PPPP PPPPP PP Sbjct: 405 PPAPPTLVPPPPPAPPTIKPPPPPAPPTVEPPPPPPPAPPTVEPPP 450 Score = 38.7 bits (86), Expect = 0.16 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPPP PPPP PPPP PP Sbjct: 430 PPTVEPPPPPPPAPPTVEPPPPPPPAPTKVEPPPPPAPAEVEPPPP 475 Score = 37.9 bits (84), Expect = 0.28 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPP PPPP G PP P P PP Sbjct: 352 PPKVNPPPPPRPASPKVEPPPPAPPGVESPPGPQPPASPRFDPPP 396 Score = 37.5 bits (83), Expect = 0.37 Identities = 16/36 (44%), Positives = 17/36 (47%), Gaps = 2/36 (5%) Frame = +1 Query: 430 PPXGXX--XPPPPPXXXKXXXPPPPXXGXXXPPPPP 531 PP PPPPP + PPPP PPPPP Sbjct: 452 PPPAPTKVEPPPPPAPAEVEPPPPPAPTELEPPPPP 487 Score = 37.1 bits (82), Expect = 0.50 Identities = 16/46 (34%), Positives = 17/46 (36%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPP + PP P PPP PP PP Sbjct: 386 PPASPRFDPPPPHTIEPPPPPAPPTLVPPPPPAPPTIKPPPPPAPP 431 Score = 35.9 bits (79), Expect = 1.1 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +3 Query: 435 PXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 P PPPPP PPPP PPPP P Sbjct: 467 PAEVEPPPPPAPTELEPPPPPAPPKVELPPPPAP 500 Score = 34.7 bits (76), Expect = 2.6 Identities = 17/46 (36%), Positives = 17/46 (36%), Gaps = 1/46 (2%) Frame = +1 Query: 433 PXGXXXPP-PPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 P G PP P P PPPP PPP PP PP Sbjct: 375 PPGVESPPGPQPPASPRFDPPPPHTIEPPPPPAPPTLVPPPPPAPP 420 Score = 34.7 bits (76), Expect = 2.6 Identities = 16/41 (39%), Positives = 17/41 (41%), Gaps = 2/41 (4%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPP--PPPLXXXXXAXXPP 567 PPPPP + PPPP PPP PP PP Sbjct: 461 PPPPPAPAEVEPPPPPAPTELEPPPPPAPPKVELPPPPAPP 501 Score = 34.3 bits (75), Expect = 3.5 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPP PPPP PPPP A P Sbjct: 464 PPAPAEVEPPPPPAPTELEPPPPPAPPKVELPPPPAPPKAEAAITP 509 Score = 33.1 bits (72), Expect = 8.1 Identities = 15/45 (33%), Positives = 15/45 (33%) Frame = +2 Query: 434 PXGXXXPPPPXXXXKXXXPPPXXXGXXXPPPPXPXXXXXXXXPPP 568 P PPPP PPP PPPP P P P Sbjct: 456 PTKVEPPPPPAPAEVEPPPPPAPTELEPPPPPAPPKVELPPPPAP 500 >UniRef50_Q1HMI7 Cluster: Formin B; n=4; Trypanosoma cruzi|Rep: Formin B - Trypanosoma cruzi strain CL Brener Length = 968 Score = 44.8 bits (101), Expect = 0.002 Identities = 19/35 (54%), Positives = 19/35 (54%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPP 534 PP G PPPPP PPPP G PPPPPP Sbjct: 477 PPPGKNAPPPPPPP-----PPPPPHGKKAPPPPPP 506 Score = 41.9 bits (94), Expect = 0.017 Identities = 19/45 (42%), Positives = 20/45 (44%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP +PPPP PPPPP P PP Sbjct: 466 PPPRTPPPPPPPPPGKNAPPPP-----PPPPPPPPHGKKAPPPPP 505 Score = 38.3 bits (85), Expect = 0.21 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = +3 Query: 435 PXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 P PPP PPPP PPPPP P PP Sbjct: 459 PVSPSSSPPPRTPPPPPPPPPGKNAPPPPPPPPPPPPHGKKAPP 502 Score = 37.1 bits (82), Expect = 0.50 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +1 Query: 457 PPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PPP PPPP PPPPPP PP Sbjct: 466 PPPRTPPPPPPPPPGKNAPPPPPPPPPPPPHGKKAPP 502 >UniRef50_Q1HMI6 Cluster: Formin A; n=4; Trypanosoma cruzi|Rep: Formin A - Trypanosoma cruzi strain CL Brener Length = 1178 Score = 44.8 bits (101), Expect = 0.002 Identities = 39/150 (26%), Positives = 40/150 (26%), Gaps = 16/150 (10%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPX-----GXXPPPPPXXXXXXS-----PPPPXXGGGX----- 515 PP G G PP G PPPPP PPPP G G Sbjct: 527 PPPGAGAKSGLPPPPPPPPGAGAKSGLPPPPPPPPGAGAKSGLPPPPPPPPGAGAKSGLP 586 Query: 516 PPPPPXPXXXAXXXXPPXXXXX-GXXXXXXXXXXKXGXXXXXXKXXKXXXXXXXXXXGSX 692 PPPPP P A PP G K G+ Sbjct: 587 PPPPPPPGAGAKSGLPPPPPPPPGAGAKSGLPPPPPPPPGAGAKSGLPPPPPPPPGAGAK 646 Query: 693 XXXPPPXXXXXAXGGAGGXXXXXXXXPPPP 782 PPP G G PPPP Sbjct: 647 SGLPPPPPPPPGAGAKSGLSPPPPPPPPPP 676 Score = 41.5 bits (93), Expect = 0.023 Identities = 41/152 (26%), Positives = 41/152 (26%), Gaps = 18/152 (11%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPX-----GXXPPPPPXXXXXXS-----PPPPXXGGGX----- 515 PP G G PP G PPPPP PPPP G G Sbjct: 543 PPPGAGAKSGLPPPPPPPPGAGAKSGLPPPPPPPPGAGAKSGLPPPPPPPPGAGAKSGLP 602 Query: 516 PPPPPXPXXXAXXXXPPXXXXX-GXXXXXXXXXXKXGXXXXXXKXXKXXXXXXXXXXG-- 686 PPPPP P A PP G K G Sbjct: 603 PPPPPPPGAGAKSGLPPPPPPPPGAGAKSGLPPPPPPPPGAGAKSGLPPPPPPPPGAGAK 662 Query: 687 SXXXXPPPXXXXXAXGGAGGXXXXXXXXPPPP 782 S PPP GAG PPPP Sbjct: 663 SGLSPPPPPPPPPPPPGAGAKSGLPPPPPPPP 694 Score = 41.1 bits (92), Expect = 0.030 Identities = 25/63 (39%), Positives = 25/63 (39%), Gaps = 7/63 (11%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPX-----GXXPPPPPXXXXXXSPPPPXXGG--GXPPPPPXPX 539 PP G G PP G PPPPP PPPP G G PPPPP P Sbjct: 639 PPPGAGAKSGLPPPPPPPPGAGAKSGLSPPPPPPPP----PPPPGAGAKSGLPPPPPPPP 694 Query: 540 XXA 548 A Sbjct: 695 PKA 697 Score = 39.5 bits (88), Expect = 0.093 Identities = 37/130 (28%), Positives = 38/130 (29%), Gaps = 10/130 (7%) Frame = +3 Query: 423 GXXPPXGXXPPPPPXXXXXXS----PPPPXXGGG-----XPPPPPXPXXXA-XXXXPPXX 572 G PP PPPPP S PPPP G G PPPPP P A PP Sbjct: 519 GLPPP----PPPPPPGAGAKSGLPPPPPPPPGAGAKSGLPPPPPPPPGAGAKSGLPPPPP 574 Query: 573 XXXGXXXXXXXXXXKXGXXXXXXKXXKXXXXXXXXXXGSXXXXPPPXXXXXAXGGAGGXX 752 G K G+ PPP GAG Sbjct: 575 PPPGAGAKSGLPPPPPPPPGAGAKSGLPPPPPPPPGAGAKSGLPPPPPPPP---GAGAKS 631 Query: 753 XXXXXXPPPP 782 PPPP Sbjct: 632 GLPPPPPPPP 641 Score = 33.1 bits (72), Expect = 8.1 Identities = 18/45 (40%), Positives = 19/45 (42%), Gaps = 2/45 (4%) Frame = +1 Query: 439 GXXXPPPPP--XXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 G PPPPP K PPP PPPPPP + PP Sbjct: 648 GLPPPPPPPPGAGAKSGLSPPP----PPPPPPPPPGAGAKSGLPP 688 >UniRef50_A7SHT8 Cluster: Predicted protein; n=2; Nematostella vectensis|Rep: Predicted protein - Nematostella vectensis Length = 1505 Score = 44.8 bits (101), Expect = 0.002 Identities = 18/35 (51%), Positives = 18/35 (51%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 P G PPPPP PPPP GGG P PP P Sbjct: 948 PFFGGIPPPPPGGGMFPPPPPPPPGGGVPGPPKPP 982 Score = 36.7 bits (81), Expect = 0.65 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = +3 Query: 459 PPXXXXXXSPPPPXXGGGXPPPPPXP 536 PP PPPP GG PPPPP P Sbjct: 945 PPNPFFGGIPPPPPGGGMFPPPPPPP 970 Score = 36.7 bits (81), Expect = 0.65 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 441 GXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 G PPPP PPPP GG PP P P Sbjct: 952 GIPPPPPGGGMFPPPPPPPPGGGVPGPPKPPP 983 >UniRef50_P12978 Cluster: Epstein-Barr nuclear antigen 2; n=2; Human herpesvirus 4|Rep: Epstein-Barr nuclear antigen 2 - Epstein-Barr virus (strain B95-8) (HHV-4) (Human herpesvirus 4) Length = 487 Score = 44.8 bits (101), Expect = 0.002 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPP 534 PP PPPPP PPPP PPPPPP Sbjct: 64 PPPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPP 98 Score = 44.0 bits (99), Expect = 0.004 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 PP PPPPP PPPP PPPPP P Sbjct: 63 PPPPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPP 97 Score = 44.0 bits (99), Expect = 0.004 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPP 534 PP PPPPP PPPP PPPPPP Sbjct: 65 PPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPP 99 Score = 44.0 bits (99), Expect = 0.004 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPP 534 PP PPPPP PPPP PPPPPP Sbjct: 66 PPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPP 100 Score = 43.2 bits (97), Expect = 0.008 Identities = 20/48 (41%), Positives = 20/48 (41%) Frame = +3 Query: 423 GXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 G PP PPPPP PPPP PPPPP P PP Sbjct: 57 GVPPPLPPPPPPPPPPPPPPPPPPPP----PPPPPPSPPPPPPPPPPP 100 Score = 41.5 bits (93), Expect = 0.023 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXP 563 PP PPPPP PPPP PPPPP A P Sbjct: 67 PPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPQRRDAWTQEP 110 Score = 39.9 bits (89), Expect = 0.070 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPPP PPPP PPPPPP PP Sbjct: 60 PPLPPPPPPPPPPPPPPPPPPPP------PPPPPPSPPPPPPPPPP 99 Score = 37.9 bits (84), Expect = 0.28 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PPP P PPPP PPPPPP PP Sbjct: 59 PPPLPPPPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPP 97 >UniRef50_UPI00015B5CAE Cluster: PREDICTED: similar to conserved hypothetical protein; n=1; Nasonia vitripennis|Rep: PREDICTED: similar to conserved hypothetical protein - Nasonia vitripennis Length = 1774 Score = 44.4 bits (100), Expect = 0.003 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPPP PPPP PPPPPP PP Sbjct: 272 PPSAGPVPPPPPPALILPPPPPPPLLISGPPPPPPNAFMDPPPLPP 317 Score = 41.9 bits (94), Expect = 0.017 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PPPPP PPPP G PPPPP PP Sbjct: 280 PPPPPALILPPPPPPPLLISGPPPPPPNAFMDPPPLPPP 318 Score = 41.9 bits (94), Expect = 0.017 Identities = 20/46 (43%), Positives = 20/46 (43%), Gaps = 1/46 (2%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPP-PPPLXXXXXAXXP 564 PP PPPPP PPPP PPP PPPL A P Sbjct: 283 PPALILPPPPPPPLLISGPPPPPPNAFMDPPPLPPPLQAPIAARVP 328 >UniRef50_Q948Y6 Cluster: VMP4 protein; n=1; Volvox carteri f. nagariensis|Rep: VMP4 protein - Volvox carteri f. nagariensis Length = 1143 Score = 44.4 bits (100), Expect = 0.003 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP SPPPP P PPP P PP Sbjct: 525 PPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPP 569 Score = 44.4 bits (100), Expect = 0.003 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP SPPPP P PPP P PP Sbjct: 531 PPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPP 575 Score = 44.4 bits (100), Expect = 0.003 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP SPPPP P PPP P PP Sbjct: 537 PPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPP 581 Score = 44.0 bits (99), Expect = 0.004 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP SPPPP P PPP P PP Sbjct: 549 PPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPRHPPSPPP 593 Score = 41.9 bits (94), Expect = 0.017 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 PP PPPPP SPPPP P PPP P Sbjct: 561 PPPPPSPPPPPSPPPPPSPPPPPSPRHPPSPPPRP 595 Score = 41.5 bits (93), Expect = 0.023 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = +3 Query: 435 PXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 P PPPPP SPPPP P PPP P PP Sbjct: 520 PSPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPP 563 Score = 39.9 bits (89), Expect = 0.070 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPP P PPP PPPPP P PP Sbjct: 527 PPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPP 571 Score = 39.9 bits (89), Expect = 0.070 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPP P PPP PPPPP P PP Sbjct: 533 PPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPP 577 Score = 39.9 bits (89), Expect = 0.070 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPP P PPP PPPPP P PP Sbjct: 539 PPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPP 583 Score = 39.9 bits (89), Expect = 0.070 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPP P PPP PPPPP P PP Sbjct: 545 PPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPRHPP 589 Score = 39.1 bits (87), Expect = 0.12 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 P PPPPP PPPP P PPPP PP Sbjct: 518 PRPSPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPP 563 Score = 39.1 bits (87), Expect = 0.12 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +1 Query: 433 PXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 P PPPPP PPPP P PPPP PP Sbjct: 549 PPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPRHPPSPPP 593 Score = 36.3 bits (80), Expect = 0.86 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPP PPP PP PPP PP Sbjct: 517 PPRPSPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPP 562 Score = 35.9 bits (79), Expect = 1.1 Identities = 19/46 (41%), Positives = 19/46 (41%), Gaps = 1/46 (2%) Frame = +3 Query: 432 PPXGXXP-PPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP P P PP SPPPP PPPPP P PP Sbjct: 512 PPSPRPPRPSPPSPPPPPSPPPPPS----PPPPPSPPPPPSPPPPP 553 Score = 35.9 bits (79), Expect = 1.1 Identities = 17/46 (36%), Positives = 18/46 (39%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPP PPPP PPPPP + PP Sbjct: 526 PPPPSP-PPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPP 570 Score = 35.9 bits (79), Expect = 1.1 Identities = 17/46 (36%), Positives = 18/46 (39%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPP PPPP PPPPP + PP Sbjct: 532 PPPPSP-PPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPP 576 Score = 35.9 bits (79), Expect = 1.1 Identities = 17/46 (36%), Positives = 18/46 (39%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPP PPPP PPPPP + PP Sbjct: 538 PPPPSP-PPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPP 582 Score = 35.5 bits (78), Expect = 1.5 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPP P PPP PPPPP PP Sbjct: 544 PPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPRHPP 589 Score = 34.7 bits (76), Expect = 2.6 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 P PPPP PPPP PPPPP P PP Sbjct: 520 PSPPSPPPPPSPPPPPSPPPPP-----SPPPPPSPPPPPSPPPPP 559 Score = 33.9 bits (74), Expect = 4.6 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 1/36 (2%) Frame = +1 Query: 430 PPXGXXXP-PPPPXXXKXXXPPPPXXGXXXPPPPPP 534 PP P PPPP PPP PP PPP Sbjct: 558 PPSPPPPPSPPPPPSPPPPPSPPPPPSPRHPPSPPP 593 Score = 33.1 bits (72), Expect = 8.1 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 PP PPPP PP P PP PP P Sbjct: 574 PPPPSPPPPPSPRHPPSPPPRPRPPRPQPPSPPSP 608 >UniRef50_Q3HTK2 Cluster: Pherophorin-C5 protein precursor; n=1; Chlamydomonas reinhardtii|Rep: Pherophorin-C5 protein precursor - Chlamydomonas reinhardtii Length = 541 Score = 44.4 bits (100), Expect = 0.003 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP SPPPP PPPP P PP Sbjct: 204 PPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPP 248 Score = 44.4 bits (100), Expect = 0.003 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP P PPP SPPPP PPPPP P PP Sbjct: 209 PPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPP 253 Score = 44.0 bits (99), Expect = 0.004 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP SPPPP PPPPP P PP Sbjct: 178 PPPPSPPPPPPPSPPPPSPPPPSP---PPPPPPSPPPPPPPSPPP 219 Score = 42.7 bits (96), Expect = 0.010 Identities = 18/46 (39%), Positives = 19/46 (41%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPPP PPPP PPPP P + PP Sbjct: 203 PPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPP 248 Score = 41.9 bits (94), Expect = 0.017 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPP P SPPPP PP PP P PP Sbjct: 191 PPPPSPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPP 235 Score = 41.1 bits (92), Expect = 0.030 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 2/47 (4%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPP--PPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PP PP PPPPP P PP Sbjct: 179 PPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPSPPPP 225 Score = 41.1 bits (92), Expect = 0.030 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP P PPP SPPPP PP PP P PP Sbjct: 214 PPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPP 258 Score = 40.7 bits (91), Expect = 0.040 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPP 534 PP PPPPP PPPP PP PPP Sbjct: 177 PPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPP 211 Score = 40.7 bits (91), Expect = 0.040 Identities = 19/48 (39%), Positives = 20/48 (41%), Gaps = 2/48 (4%) Frame = +1 Query: 430 PPXGXXXPPP--PPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPP PP PPPP PPPPPP + PP Sbjct: 206 PPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPP 253 Score = 40.3 bits (90), Expect = 0.053 Identities = 17/46 (36%), Positives = 18/46 (39%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP P PPP PPPP PP PPP + PP Sbjct: 213 PPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPP 258 Score = 39.9 bits (89), Expect = 0.070 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPP PPPP PPPP P PP Sbjct: 184 PPPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPP 228 Score = 39.9 bits (89), Expect = 0.070 Identities = 17/46 (36%), Positives = 18/46 (39%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPP P PPPP PP PPP + PP Sbjct: 185 PPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPP 230 Score = 39.9 bits (89), Expect = 0.070 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPPP P PP P PPPP PP Sbjct: 196 PPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPP 241 Score = 39.1 bits (87), Expect = 0.12 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPP PPPP PPPP P PP Sbjct: 193 PPSPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPP 238 Score = 38.7 bits (86), Expect = 0.16 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPP 534 PP PPPPP PPPP PPPPPP Sbjct: 176 PPPPPPSPPPPP----PPSPPPPSPPPPSPPPPPP 206 Score = 38.7 bits (86), Expect = 0.16 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPP P PPPP PPPP P PP Sbjct: 198 PPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPP 243 Score = 37.9 bits (84), Expect = 0.28 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +3 Query: 441 GXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 G PPPPP PPP PPP P P PP Sbjct: 172 GASPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPP 213 Score = 37.1 bits (82), Expect = 0.50 Identities = 15/38 (39%), Positives = 16/38 (42%) Frame = +1 Query: 454 PPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PPPP PPPP PPPP P + PP Sbjct: 175 PPPPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPP 212 Score = 36.7 bits (81), Expect = 0.65 Identities = 16/45 (35%), Positives = 17/45 (37%) Frame = +1 Query: 433 PXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 P PPP P PPPP PP PPP + PP Sbjct: 191 PPPPSPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPP 235 Score = 36.7 bits (81), Expect = 0.65 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPP P P PP PPPP P PP Sbjct: 211 PPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPP 256 Score = 35.5 bits (78), Expect = 1.5 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPP P PP PPPP P PP Sbjct: 188 PPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPP 233 >UniRef50_Q9VC23 Cluster: CG7016-PA; n=2; Sophophora|Rep: CG7016-PA - Drosophila melanogaster (Fruit fly) Length = 362 Score = 44.4 bits (100), Expect = 0.003 Identities = 22/65 (33%), Positives = 23/65 (35%) Frame = +3 Query: 390 GGGGGXXFXXXGXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPPX 569 GGG G + G G PPP P PPP G PPPP P PP Sbjct: 145 GGGQGPGWNGPGWNGGGGRGPPPRPGFNGGGPPPPRPGWNGGGPPPPMPGWNGGGPPPPR 204 Query: 570 XXXXG 584 G Sbjct: 205 PGWNG 209 Score = 41.1 bits (92), Expect = 0.030 Identities = 24/66 (36%), Positives = 24/66 (36%), Gaps = 1/66 (1%) Frame = +3 Query: 390 GGGGGXXFXXXGXXPPXGXXPPPPPXXXXXXSPPPPXXG-GGXPPPPPXPXXXAXXXXPP 566 GGGG G G PPPP PPPP G G PPPP P PP Sbjct: 159 GGGGRGPPPRPGFN---GGGPPPPRPGWNGGGPPPPMPGWNGGGPPPPRPGWNGGGPPPP 215 Query: 567 XXXXXG 584 G Sbjct: 216 RPGWNG 221 Score = 40.3 bits (90), Expect = 0.053 Identities = 25/66 (37%), Positives = 25/66 (37%) Frame = -1 Query: 533 GGGGGGXSXPXXGGGGXXXXXXXGGGGGXXXPXGGXXXXXKXXPPPPPPGGXXXTPXGGX 354 GGG G P GGG GGG P G PPPP PG GG Sbjct: 160 GGGRGPPPRPGFNGGGPPPPRPGWNGGGPPPPMPGWNG---GGPPPPRPGWN----GGGP 212 Query: 353 PPPXXG 336 PPP G Sbjct: 213 PPPRPG 218 Score = 38.7 bits (86), Expect = 0.16 Identities = 24/55 (43%), Positives = 24/55 (43%), Gaps = 5/55 (9%) Frame = +3 Query: 381 PPRGG--GGGXXFXXXGXXPPXGXXPPPPPXXXXXXSPPPPXXG---GGXPPPPP 530 PPR G GGG G G PPPP PPPP G GG PPP P Sbjct: 166 PPRPGFNGGGPPPPRPGWN---GGGPPPPMPGWNGGGPPPPRPGWNGGGPPPPRP 217 Score = 38.3 bits (85), Expect = 0.21 Identities = 26/68 (38%), Positives = 27/68 (39%), Gaps = 2/68 (2%) Frame = -1 Query: 533 GGGGGGXSXPXXGGGGXXXXXXXGG--GGGXXXPXGGXXXXXKXXPPPPPPGGXXXTPXG 360 GG G G + P GGG G GGG P G PPPP PG G Sbjct: 146 GGQGPGWNGPGWNGGGGRGPPPRPGFNGGGPPPPRPGWNG---GGPPPPMPGWN----GG 198 Query: 359 GXPPPXXG 336 G PPP G Sbjct: 199 GPPPPRPG 206 Score = 35.1 bits (77), Expect = 2.0 Identities = 25/70 (35%), Positives = 26/70 (37%), Gaps = 3/70 (4%) Frame = -2 Query: 583 PXXXXXGGXXXXAXXXGXGGGGG-XPPPXXG--GGGXXFXXXXGGGGGXXPXGGXXPXFX 413 P GG G GGGG PPP G GGG GGG P P + Sbjct: 140 PGWNGGGGQGPGWNGPGWNGGGGRGPPPRPGFNGGGPPPPRPGWNGGGPPP---PMPGWN 196 Query: 412 KXXPPPPPRG 383 PPPP G Sbjct: 197 GGGPPPPRPG 206 Score = 34.7 bits (76), Expect = 2.6 Identities = 22/62 (35%), Positives = 23/62 (37%), Gaps = 1/62 (1%) Frame = -2 Query: 565 GGXXXXAXXXGXGGGGGXPP-PXXGGGGXXFXXXXGGGGGXXPXGGXXPXFXKXXPPPPP 389 GG G GGG PP P GGG GGG P P + PPPP Sbjct: 160 GGGRGPPPRPGFNGGGPPPPRPGWNGGGPPPPMPGWNGGGPPP---PRPGWNGGGPPPPR 216 Query: 388 RG 383 G Sbjct: 217 PG 218 >UniRef50_Q93424 Cluster: Putative uncharacterized protein grl-23; n=5; Bilateria|Rep: Putative uncharacterized protein grl-23 - Caenorhabditis elegans Length = 385 Score = 44.4 bits (100), Expect = 0.003 Identities = 25/61 (40%), Positives = 25/61 (40%), Gaps = 2/61 (3%) Frame = -1 Query: 533 GGGGGGXSXPXXGGGGXXXXXXXGGGGGXXXPXGGXXXXXKXXPPPPPP--GGXXXTPXG 360 GGGG G GGGG G GGG GG PPPPPP GG G Sbjct: 68 GGGGCGGGGGGCGGGGGCGGGGGGCGGGGGGCGGGGGCGGGCAPPPPPPACGGGCGGGGG 127 Query: 359 G 357 G Sbjct: 128 G 128 Score = 39.9 bits (89), Expect = 0.070 Identities = 25/68 (36%), Positives = 25/68 (36%) Frame = -2 Query: 583 PXXXXXGGXXXXAXXXGXGGGGGXPPPXXGGGGXXFXXXXGGGGGXXPXGGXXPXFXKXX 404 P GG G GGGG GGGG GGGGG GG Sbjct: 57 PPPACGGGCGGGGGGCGGGGGGCGGGGGCGGGGGG----CGGGGGGCGGGGGCGGGCAPP 112 Query: 403 PPPPPRGG 380 PPPP GG Sbjct: 113 PPPPACGG 120 Score = 39.9 bits (89), Expect = 0.070 Identities = 23/60 (38%), Positives = 23/60 (38%), Gaps = 1/60 (1%) Frame = -1 Query: 533 GGGGGGXSXPXXGGGGXXXXXXXGGG-GGXXXPXGGXXXXXKXXPPPPPPGGXXXTPXGG 357 GGGGGG G GG GGG GG GG PPPPP GG Sbjct: 66 GGGGGGCGGGGGGCGGGGGCGGGGGGCGGGGGGCGGGGGCGGGCAPPPPPPACGGGCGGG 125 Score = 36.3 bits (80), Expect = 0.86 Identities = 19/50 (38%), Positives = 19/50 (38%) Frame = -1 Query: 506 PXXGGGGXXXXXXXGGGGGXXXPXGGXXXXXKXXPPPPPPGGXXXTPXGG 357 P GGGG G GGG GG PPPPP G GG Sbjct: 21 PSGGGGGGGGGCGGGCGGGGGCGGGGGCGGGCAPPPPPPACGGGCGGGGG 70 Score = 35.9 bits (79), Expect = 1.1 Identities = 27/61 (44%), Positives = 27/61 (44%), Gaps = 2/61 (3%) Frame = -1 Query: 533 GGGGGGXSXPXXGGGGXXXXXXXGGGGGXXXPXGGXXXXXKXXPPPPPP--GGXXXTPXG 360 GGGGGG GGGG GGGGG GG PPPPPP GG G Sbjct: 26 GGGGGGCGGGCGGGGG------CGGGGGC---GGG------CAPPPPPPACGGGCGGGGG 70 Query: 359 G 357 G Sbjct: 71 G 71 Score = 35.1 bits (77), Expect = 2.0 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = -1 Query: 566 GGXXAXXXXXRGGGGGGXSXPXXGGGGXXXXXXXGGGGGXXXPXGG 429 GG GGGGGG GG G GGGGG GG Sbjct: 124 GGGGGCGGGCGGGGGGGCGGGGGGGCGGGGGGCGGGGGGCGGGGGG 169 Score = 34.7 bits (76), Expect = 2.6 Identities = 24/52 (46%), Positives = 24/52 (46%) Frame = -2 Query: 535 GXGGGGGXPPPXXGGGGXXFXXXXGGGGGXXPXGGXXPXFXKXXPPPPPRGG 380 G GGGGG GGGG GGGGG GG P PPPPP G Sbjct: 25 GGGGGGGCGGGCGGGGG------CGGGGGC--GGGCAP------PPPPPACG 62 Score = 34.7 bits (76), Expect = 2.6 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = -1 Query: 566 GGXXAXXXXXRGGGGGGXSXPXXGGGGXXXXXXXGGGGGXXXPXGG 429 GG GGGGGG G GG GGGGG GG Sbjct: 139 GGCGGGGGGGCGGGGGGCGGGGGGCGGGGGGCGGGGGGGCGGGGGG 184 Score = 34.3 bits (75), Expect = 3.5 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = -1 Query: 566 GGXXAXXXXXRGGGGGGXSXPXXGGGGXXXXXXXGGGGGXXXPXGG 429 GG GGGGGG GGG GGGGG GG Sbjct: 123 GGGGGGCGGGCGGGGGGGCGGGGGGGCGGGGGGCGGGGGGCGGGGG 168 Score = 34.3 bits (75), Expect = 3.5 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = -1 Query: 566 GGXXAXXXXXRGGGGGGXSXPXXGGGGXXXXXXXGGGGGXXXPXGG 429 GG GGGGGG GG G GGGGG GG Sbjct: 131 GGCGGGGGGGCGGGGGGGCGGGGGGCGGGGGGCGGGGGGCGGGGGG 176 Score = 33.9 bits (74), Expect = 4.6 Identities = 20/51 (39%), Positives = 20/51 (39%), Gaps = 6/51 (11%) Frame = -2 Query: 565 GGXXXXAXXXGXGGGGGXPPP------XXGGGGXXFXXXXGGGGGXXPXGG 431 GG G GGG PPP GGGG GGGGG GG Sbjct: 94 GGGGGCGGGGGCGGGCAPPPPPPACGGGCGGGGGGCGGGCGGGGGGGCGGG 144 Score = 33.5 bits (73), Expect = 6.1 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 2/47 (4%) Frame = -2 Query: 565 GGXXXXAXXXGXGGGGG--XPPPXXGGGGXXFXXXXGGGGGXXPXGG 431 GG G GGG PPP GGG GGGGG GG Sbjct: 37 GGGGGCGGGGGCGGGCAPPPPPPACGGGCGGGGGGCGGGGGGCGGGG 83 Score = 33.5 bits (73), Expect = 6.1 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = -2 Query: 565 GGXXXXAXXXGXGGGGGXPPPXXGGGGXXFXXXXGGGGGXXPXGG 431 GG G GGGGG GGG GGGGG GG Sbjct: 130 GGGCGGGGGGGCGGGGGGGCGGGGGGCGGGGGGCGGGGGGCGGGG 174 Score = 33.5 bits (73), Expect = 6.1 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = -2 Query: 565 GGXXXXAXXXGXGGGGGXPPPXXGGGGXXFXXXXGGGGGXXPXGG 431 GG G GGGGG GG G GGGGG GG Sbjct: 138 GGGCGGGGGGGCGGGGGGCGGGGGGCGGGGGGCGGGGGGGCGGGG 182 Score = 33.1 bits (72), Expect = 8.1 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = -2 Query: 565 GGXXXXAXXXGXGGGGGXPPPXXGGGGXXFXXXXGGGGGXXPXGG 431 GG G GGGGG GG G GGGGG GG Sbjct: 145 GGGGCGGGGGGCGGGGGGCGGGGGGCGGGGGGGCGGGGGGGCGGG 189 >UniRef50_Q5CLH8 Cluster: Protease; n=3; Cryptosporidium|Rep: Protease - Cryptosporidium hominis Length = 1569 Score = 44.4 bits (100), Expect = 0.003 Identities = 18/35 (51%), Positives = 18/35 (51%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 PP PPPPP SPPPP PPPPP P Sbjct: 1534 PPPPPPPPPPPPSSSSPSPPPPPPPLPPPPPPPPP 1568 Score = 40.3 bits (90), Expect = 0.053 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP P PPP PPPP PPPPP P PP Sbjct: 1526 PPSSSSPSPPP--PPPPPPPPPSSSSPSPPPPPPPLPPPPPPPPP 1568 Score = 39.1 bits (87), Expect = 0.12 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP P PPP PPPP PPPPPP PP Sbjct: 1525 PPPSSSSPSPPPPPPPP--PPPPSSSSPSPPPPPPPLPPPPPPPPP 1568 Score = 35.1 bits (77), Expect = 2.0 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = +1 Query: 439 GXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 G PP PP PPPP PPPPPP PP Sbjct: 1518 GSNSPPLPPPSSSSPSPPPPPP----PPPPPPSSSSPSPPPPP 1556 Score = 33.9 bits (74), Expect = 4.6 Identities = 16/39 (41%), Positives = 17/39 (43%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PP SPPPP PPPPP + PP Sbjct: 1522 PPLPPPSSSSPSPPPPPP---PPPPPPSSSSPSPPPPPP 1557 >UniRef50_Q54ER5 Cluster: Formin homology domain-containing protein; n=1; Dictyostelium discoideum AX4|Rep: Formin homology domain-containing protein - Dictyostelium discoideum AX4 Length = 2546 Score = 44.4 bits (100), Expect = 0.003 Identities = 26/70 (37%), Positives = 26/70 (37%), Gaps = 2/70 (2%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXXPPPPPXXXXXXSPPPPXX--GGGXPPPPPXPXXXAXX 554 PP GG G PPPPP PPPP GGG PPPPP P Sbjct: 1036 PPPPPPGGNNNNESDVPSSSGGPPPPPPP------PPPPGKSSGGGPPPPPPPPPKGGKG 1089 Query: 555 XXPPXXXXXG 584 PP G Sbjct: 1090 GPPPPPPIGG 1099 Score = 36.3 bits (80), Expect = 0.86 Identities = 22/70 (31%), Positives = 22/70 (31%), Gaps = 2/70 (2%) Frame = +3 Query: 381 PPRGGGGGXX--FXXXGXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXX 554 PP GG PP PPPPP PPP PPPPP Sbjct: 1039 PPPGGNNNNESDVPSSSGGPPPPPPPPPPPGKSSGGGPPP-------PPPPPPKGGKGGP 1091 Query: 555 XXPPXXXXXG 584 PP G Sbjct: 1092 PPPPPIGGIG 1101 Score = 33.1 bits (72), Expect = 8.1 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -3 Query: 354 PPPXXGXKXXXXXXPPXKKXPPPPPXGGXGXP 259 PPP G PP PPPPP GG G P Sbjct: 1064 PPPPPGKSSGGGPPPP----PPPPPKGGKGGP 1091 >UniRef50_Q54B83 Cluster: Wiscott-Aldrich syndrome protein; n=2; Dictyostelium discoideum|Rep: Wiscott-Aldrich syndrome protein - Dictyostelium discoideum AX4 Length = 399 Score = 44.4 bits (100), Expect = 0.003 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 P G PPPPP K PP G PPPPPP PP Sbjct: 267 PSVGKSAPPPPPPSHKTPAAPPSGGGAPPPPPPPPPPSSGPPPPPP 312 Score = 43.6 bits (98), Expect = 0.006 Identities = 18/45 (40%), Positives = 20/45 (44%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPP +P P GGG PPPPP P + PP Sbjct: 266 PPSVGKSAPPPPPPSHKTPAAPPSGGGAPPPPPPPPPPSSGPPPP 310 Score = 40.7 bits (91), Expect = 0.040 Identities = 19/36 (52%), Positives = 20/36 (55%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPL 537 PP G PPPPP PPPP G PPPPPP+ Sbjct: 287 PPSGGGAPPPPP------PPPPPSSG--PPPPPPPM 314 Score = 38.3 bits (85), Expect = 0.21 Identities = 17/33 (51%), Positives = 17/33 (51%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPP 530 P G PPPPP PPPP G PPPPP Sbjct: 288 PSGGGAPPPPP-------PPPPPSSGPPPPPPP 313 Score = 37.1 bits (82), Expect = 0.50 Identities = 22/70 (31%), Positives = 22/70 (31%), Gaps = 8/70 (11%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXXPPPPPXXXXXXSPPPPXX--------GGGXPPPPPXP 536 PP G P PPPPP PPPP GG PPPP P Sbjct: 240 PPTQPGRSAPPAPPSSNQPGRSAPPPPPSVGKSAPPPPPPSHKTPAAPPSGGGAPPPPPP 299 Query: 537 XXXAXXXXPP 566 PP Sbjct: 300 PPPPSSGPPP 309 Score = 37.1 bits (82), Expect = 0.50 Identities = 16/35 (45%), Positives = 17/35 (48%), Gaps = 3/35 (8%) Frame = +1 Query: 439 GXXXPPPPPXXX---KXXXPPPPXXGXXXPPPPPP 534 G PP PP + PPPP G PPPPPP Sbjct: 245 GRSAPPAPPSSNQPGRSAPPPPPSVGKSAPPPPPP 279 Score = 34.3 bits (75), Expect = 3.5 Identities = 18/36 (50%), Positives = 18/36 (50%) Frame = +3 Query: 441 GXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXA 548 G PPPPP PPPP G PPPPP P A Sbjct: 292 GAPPPPPP-------PPPPSSG---PPPPPPPMASA 317 >UniRef50_A0DJB7 Cluster: Chromosome undetermined scaffold_53, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_53, whole genome shotgun sequence - Paramecium tetraurelia Length = 1117 Score = 44.4 bits (100), Expect = 0.003 Identities = 21/53 (39%), Positives = 21/53 (39%), Gaps = 2/53 (3%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXG--GGXPPPPPXPXXXAXXXXPPXXXXXG 584 PP PPP P PPPP G G PPPPP P PP G Sbjct: 564 PPPPPPPPPLPGQKTGPPPPPPLPGQKAGPPPPPPLPGQKTGPPPPPPPPLPG 616 Score = 42.7 bits (96), Expect = 0.010 Identities = 21/48 (43%), Positives = 21/48 (43%), Gaps = 2/48 (4%) Frame = +1 Query: 430 PPXGXXXPPPP-PXXXKXXXPPPPXXG-XXXPPPPPPLXXXXXAXXPP 567 PP PPPP P PPPP G PPPPPPL PP Sbjct: 562 PPPPPPPPPPPLPGQKTGPPPPPPLPGQKAGPPPPPPLPGQKTGPPPP 609 Score = 41.5 bits (93), Expect = 0.023 Identities = 19/46 (41%), Positives = 20/46 (43%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPPP + PPP PPPPPPL PP Sbjct: 541 PPPPPPPPPPPPLPGQHKQTPPP---PPPPPPPPPLPGQKTGPPPP 583 Score = 40.3 bits (90), Expect = 0.053 Identities = 20/45 (44%), Positives = 20/45 (44%), Gaps = 3/45 (6%) Frame = +3 Query: 441 GXXPPPP-PXXXXXXSPPPPXXGG--GXPPPPPXPXXXAXXXXPP 566 G PPPP P PPPP G G PPPPP P PP Sbjct: 579 GPPPPPPLPGQKAGPPPPPPLPGQKTGPPPPPPPPLPGQKAGAPP 623 Score = 39.9 bits (89), Expect = 0.070 Identities = 20/41 (48%), Positives = 20/41 (48%), Gaps = 2/41 (4%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGG--GXPPPPPXPXXXAXXXXPP 566 PPPPP PPPP G G PPPPP P A PP Sbjct: 561 PPPPPPPP----PPPPLPGQKTGPPPPPPLPGQKAGPPPPP 597 Score = 39.5 bits (88), Expect = 0.093 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPP PPPPP P PP Sbjct: 542 PPPPPPPPPPPLPGQHKQTPPPPPP--PPPPPPLPGQKTGPPPPP 584 Score = 39.1 bits (87), Expect = 0.12 Identities = 19/45 (42%), Positives = 19/45 (42%), Gaps = 6/45 (13%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXX------GGGXPPPPPXPXXXAXXXXPP 566 PPPPP PPPP G PPPPP P A PP Sbjct: 581 PPPPPLPGQKAGPPPPPPLPGQKTGPPPPPPPPLPGQKAGAPPPP 625 Score = 38.7 bits (86), Expect = 0.16 Identities = 19/40 (47%), Positives = 19/40 (47%), Gaps = 1/40 (2%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXX-PPPPPPLXXXXXAXXPP 567 PPPPP PPPP G PPPPPPL PP Sbjct: 561 PPPPPPPP----PPPPLPGQKTGPPPPPPLPGQKAGPPPP 596 Score = 38.7 bits (86), Expect = 0.16 Identities = 19/51 (37%), Positives = 19/51 (37%), Gaps = 6/51 (11%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXG------GGXPPPPPXPXXXAXXXXPPXXXXXG 584 PPPPP PPPP G PPPPP P PP G Sbjct: 594 PPPPPLPGQKTGPPPPPPPPLPGQKAGAPPPPPPPPPPGQKGIPPPPPTFG 644 Score = 35.5 bits (78), Expect = 1.5 Identities = 18/47 (38%), Positives = 19/47 (40%), Gaps = 5/47 (10%) Frame = +1 Query: 439 GXXXPPPPPXXXKXXX-----PPPPXXGXXXPPPPPPLXXXXXAXXP 564 G PPPPP + PPPP G PPPPP A P Sbjct: 605 GPPPPPPPPLPGQKAGAPPPPPPPPPPGQKGIPPPPPTFGGANAKGP 651 Score = 34.3 bits (75), Expect = 3.5 Identities = 17/45 (37%), Positives = 18/45 (40%), Gaps = 6/45 (13%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXX------PPPPPPLXXXXXAXXPP 567 PPPPP + PPPP PPPPPP PP Sbjct: 594 PPPPPLPGQKTGPPPPPPPPLPGQKAGAPPPPPPPPPPGQKGIPP 638 Score = 33.9 bits (74), Expect = 4.6 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = +2 Query: 416 KXXXXPPXGXXXPPPPXXXXKXXXPPPXXXGXXXPPPPXPXXXXXXXXPPP 568 K PP PPP K PPP PPPP P PPP Sbjct: 538 KSHPPPPPPPPPPPPLPGQHKQTPPPPP---PPPPPPPLPGQKTGPPPPPP 585 Score = 33.9 bits (74), Expect = 4.6 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +3 Query: 423 GXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 G PP PPPPP PPPP GG P P Sbjct: 620 GAPPPP---PPPPPPGQKGIPPPPPTFGGANAKGPGIP 654 >UniRef50_Q6BUJ5 Cluster: Similar to sp|P37370 Saccharomyces cerevisiae YLR337c VRP1; n=1; Debaryomyces hansenii|Rep: Similar to sp|P37370 Saccharomyces cerevisiae YLR337c VRP1 - Debaryomyces hansenii (Yeast) (Torulaspora hansenii) Length = 623 Score = 44.4 bits (100), Expect = 0.003 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = +3 Query: 435 PXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXP 563 P PPPPP PPP G PPPPP P A P Sbjct: 249 PTSSAPPPPPLPASSAPTPPPVPSSGAPPPPPLPNFSAAFQKP 291 Score = 41.9 bits (94), Expect = 0.017 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = +3 Query: 435 PXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXP 563 P PPPPP PPPP P PPP P A P Sbjct: 238 PASSAPPPPPLPTSSAPPPPPLPASSAPTPPPVPSSGAPPPPP 280 Score = 39.9 bits (89), Expect = 0.070 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +3 Query: 453 PPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXP 563 PPPP PPPP PPPPP P A P Sbjct: 233 PPPPLPASSAPPPPPLPTSSAPPPPPLPASSAPTPPP 269 Score = 37.1 bits (82), Expect = 0.50 Identities = 16/46 (34%), Positives = 17/46 (36%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPP PPPP P PPP+ PP Sbjct: 235 PPLPASSAPPPPPLPTSSAPPPPPLPASSAPTPPPVPSSGAPPPPP 280 Score = 37.1 bits (82), Expect = 0.50 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPP P PP PPPPPL A P Sbjct: 246 PPLPTSSAPPPPPLPASSAPTPPPVPSSGAPPPPPLPNFSAAFQKP 291 Score = 36.3 bits (80), Expect = 0.86 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +1 Query: 433 PXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 P PPPP PPPP PPPPPL PP Sbjct: 226 PSSIPTSPPPPLPASSAPPPPPLP-TSSAPPPPPLPASSAPTPPP 269 Score = 33.1 bits (72), Expect = 8.1 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 2/36 (5%) Frame = +1 Query: 430 PPXGXX--XPPPPPXXXKXXXPPPPXXGXXXPPPPP 531 PP PPPPP PPPP P PPP Sbjct: 234 PPPLPASSAPPPPPLPTSSAPPPPPLPASSAPTPPP 269 >UniRef50_Q1E467 Cluster: Putative uncharacterized protein; n=1; Coccidioides immitis|Rep: Putative uncharacterized protein - Coccidioides immitis Length = 1705 Score = 44.4 bits (100), Expect = 0.003 Identities = 24/62 (38%), Positives = 24/62 (38%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXX 560 PP G G P PPPPP PP P GG PPPPP P A Sbjct: 986 PPLPGFSGPPPPPPPPLPGFSGGPPPPPP------PPLPGFSGGAPPPPPPPMPGAPIPP 1039 Query: 561 PP 566 PP Sbjct: 1040 PP 1041 Score = 42.3 bits (95), Expect = 0.013 Identities = 20/48 (41%), Positives = 20/48 (41%), Gaps = 6/48 (12%) Frame = +3 Query: 441 GXXPPPPPXXXXXXSPPPPXX------GGGXPPPPPXPXXXAXXXXPP 566 G PPPPP PPPP GG PPPPP P PP Sbjct: 979 GPPPPPPPPLPGFSGPPPPPPPPLPGFSGGPPPPPPPPLPGFSGGAPP 1026 Score = 37.1 bits (82), Expect = 0.50 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = +1 Query: 439 GXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 G PPPPP PP P PPPPPPL PP Sbjct: 976 GFNGPPPPPP------PPLPGFSGPPPPPPPPLPGFSGGPPPP 1012 Score = 36.3 bits (80), Expect = 0.86 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPPXXXXXG 584 PPPPP S PPP PPPPP P PP G Sbjct: 981 PPPPPPPLPGFSGPPP------PPPPPLPGFSGGPPPPPPPPLPG 1019 Score = 35.5 bits (78), Expect = 1.5 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 PP PP P PPPP G PPPP P Sbjct: 980 PPPPPPPPLPGFSGPPPPPPPPLPGFSGGPPPPPP 1014 Score = 35.1 bits (77), Expect = 2.0 Identities = 17/38 (44%), Positives = 17/38 (44%), Gaps = 6/38 (15%) Frame = +3 Query: 441 GXXPPPPPXXXXXXS------PPPPXXGGGXPPPPPXP 536 G PPPPP S PPPP G PPPP P Sbjct: 1007 GGPPPPPPPPLPGFSGGAPPPPPPPMPGAPIPPPPGAP 1044 Score = 34.7 bits (76), Expect = 2.6 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 4/47 (8%) Frame = +1 Query: 439 GXXXPPPPPXXX----KXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 G PPPPP PPPP G PPPP A PP Sbjct: 993 GPPPPPPPPLPGFSGGPPPPPPPPLPGFSGGAPPPPPPPMPGAPIPP 1039 >UniRef50_Q0U8T6 Cluster: Predicted protein; n=1; Phaeosphaeria nodorum|Rep: Predicted protein - Phaeosphaeria nodorum (Septoria nodorum) Length = 285 Score = 44.4 bits (100), Expect = 0.003 Identities = 16/28 (57%), Positives = 16/28 (57%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPP 534 PPPPP PPPP G PPPPPP Sbjct: 196 PPPPPAAESGLPPPPPPAGCEAPPPPPP 223 Score = 41.5 bits (93), Expect = 0.023 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = +3 Query: 435 PXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPP 530 P PPPPP PPPP G PPPPP Sbjct: 191 PDAALPPPPPAAESGLPPPPPPAGCEAPPPPP 222 Score = 37.1 bits (82), Expect = 0.50 Identities = 22/66 (33%), Positives = 23/66 (34%), Gaps = 5/66 (7%) Frame = +3 Query: 384 PRGGGGGXXFXXXGXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPPP-----PPXPXXXA 548 P GG PP G PP PP +PP P G P P PP P A Sbjct: 98 PPAAGGAPPVGAAPPAPPAGAAPPAPP---AGAAPPAPPAGAAPPAPPAGAAPPAPPSGA 154 Query: 549 XXXXPP 566 PP Sbjct: 155 AAPPPP 160 Score = 35.5 bits (78), Expect = 1.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPP 530 P PPPP PPPP PPPPP Sbjct: 191 PDAALPPPPPAAESGLPPPPPPAGCEAPPPPPP 223 Score = 35.5 bits (78), Expect = 1.5 Identities = 19/55 (34%), Positives = 19/55 (34%), Gaps = 7/55 (12%) Frame = +3 Query: 441 GXXPPPPPXXXXXXSPPPPXXGGGX-------PPPPPXPXXXAXXXXPPXXXXXG 584 G PPPPP PPPP G PPPPP PP G Sbjct: 205 GLPPPPPPAGCEAPPPPPPAAGAAAAAAADAVPPPPPAGGAPDAKACPPGPAANG 259 Score = 34.3 bits (75), Expect = 3.5 Identities = 22/69 (31%), Positives = 23/69 (33%), Gaps = 7/69 (10%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXXPPPPPXXXXXXS-------PPPPXXGGGXPPPPPXPX 539 PP GG G P G P P + PPPP G PPPPP Sbjct: 159 PPAAGGASGA----GGAPAAGESPAPAAAAMRKRATPDAALPPPPPAAESGLPPPPPPAG 214 Query: 540 XXAXXXXPP 566 A PP Sbjct: 215 CEAPPPPPP 223 >UniRef50_A7TP17 Cluster: Putative uncharacterized protein; n=1; Vanderwaltozyma polyspora DSM 70294|Rep: Putative uncharacterized protein - Vanderwaltozyma polyspora DSM 70294 Length = 802 Score = 44.4 bits (100), Expect = 0.003 Identities = 18/45 (40%), Positives = 19/45 (42%) Frame = +1 Query: 433 PXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 P PPPPP PP P PPPPPP+ A PP Sbjct: 245 PLSAPPPPPPPPMGNIPAPPLPTSSPTAPPPPPPMASAPAAPPPP 289 Score = 44.4 bits (100), Expect = 0.003 Identities = 18/45 (40%), Positives = 19/45 (42%) Frame = +1 Query: 433 PXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 P PPPPP PPPP G PPPPP + PP Sbjct: 462 PAAPAAPPPPPMGNVSTPPPPPPMGSVPAPPPPPTMASAPSAPPP 506 Score = 43.6 bits (98), Expect = 0.006 Identities = 17/39 (43%), Positives = 18/39 (46%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PPPPP PPPP G PPPPP + PP Sbjct: 274 PPPPPMASAPAAPPPPPMGSVPAPPPPPTMASAPSAPPP 312 Score = 41.9 bits (94), Expect = 0.017 Identities = 17/39 (43%), Positives = 18/39 (46%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PPPPP +PPPP G PPPP A PP Sbjct: 274 PPPPPMASAPAAPPPPPMGSVPAPPPPPTMASAPSAPPP 312 Score = 41.5 bits (93), Expect = 0.023 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 P PPPPP PPPP G PPPP A PP Sbjct: 462 PAAPAAPPPPPMGNVSTPPPPPPMGSVPAPPPPPTMASAPSAPPP 506 Score = 38.3 bits (85), Expect = 0.21 Identities = 19/50 (38%), Positives = 19/50 (38%), Gaps = 4/50 (8%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXX----PPPPXXGXXXPPPPPPLXXXXXAXXPP 567 P PPPPP PPPP G PPPPP A PP Sbjct: 445 PTSSPTAPPPPPPMVSAPAAPAAPPPPPMGNVSTPPPPPPMGSVPAPPPP 494 Score = 37.9 bits (84), Expect = 0.28 Identities = 18/45 (40%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 P PPPPP +PP P PPPPP P A PP Sbjct: 245 PLSAPPPPPPPPMGNIPAPPLPTSSPTAPPPPP-PMASAPAAPPP 288 Score = 37.9 bits (84), Expect = 0.28 Identities = 16/45 (35%), Positives = 18/45 (40%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP G P PP +PPPP P PP P + PP Sbjct: 255 PPMGNIPAPPLPTSSPTAPPPPPPMASAPAAPPPPPMGSVPAPPP 299 Score = 37.5 bits (83), Expect = 0.37 Identities = 17/44 (38%), Positives = 18/44 (40%) Frame = +3 Query: 435 PXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 P PPPP PPPP G P PPP P + PP Sbjct: 270 PTAPPPPPPMASAPAAPPPPPM--GSVPAPPPPPTMASAPSAPP 311 Score = 36.7 bits (81), Expect = 0.65 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 3/42 (7%) Frame = +3 Query: 432 PPXGXX---PPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXA 548 PP G PPPPP PPPP PPP P A Sbjct: 471 PPMGNVSTPPPPPPMGSVPAPPPPPTMASAPSAPPPPPMGAA 512 Score = 35.9 bits (79), Expect = 1.1 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXA 548 PPPPP PPPP PPP P A Sbjct: 286 PPPPPMGSVPAPPPPPTMASAPSAPPPPPMGAA 318 Score = 34.3 bits (75), Expect = 3.5 Identities = 17/48 (35%), Positives = 18/48 (37%), Gaps = 2/48 (4%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXP--PPPPPLXXXXXAXXPP 567 PP P PP PPPP P PPPPP+ PP Sbjct: 254 PPPMGNIPAPPLPTSSPTAPPPPPPMASAPAAPPPPPMGSVPAPPPPP 301 Score = 33.5 bits (73), Expect = 6.1 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = +1 Query: 460 PPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP K PP P PPPPPP+ A P Sbjct: 433 PPPMGKMPAPPLPTSSPTAPPPPPPMVSAPAAPAAP 468 >UniRef50_A7EKZ0 Cluster: Putative uncharacterized protein; n=1; Sclerotinia sclerotiorum 1980|Rep: Putative uncharacterized protein - Sclerotinia sclerotiorum 1980 Length = 1373 Score = 44.4 bits (100), Expect = 0.003 Identities = 21/51 (41%), Positives = 21/51 (41%), Gaps = 6/51 (11%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXS------PPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP G G PPPPP P PP Sbjct: 1286 PPVASPPPPPPMPSAGAPGGPPPPPPPPPPGMGAPPPPPMPPMGGAPAAPP 1336 Score = 34.7 bits (76), Expect = 2.6 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 P G PPPP PPPP G PPPPP PP Sbjct: 1298 PSAGAPGGPPPP-------PPPPPPGMGAPPPPPMPPMGGAPAAPP 1336 >UniRef50_P42768 Cluster: Wiskott-Aldrich syndrome protein; n=14; Mammalia|Rep: Wiskott-Aldrich syndrome protein - Homo sapiens (Human) Length = 502 Score = 44.4 bits (100), Expect = 0.003 Identities = 20/41 (48%), Positives = 20/41 (48%), Gaps = 3/41 (7%) Frame = +3 Query: 423 GXXPPXGXXPPPPPXXXXXXS---PPPPXXGGGXPPPPPXP 536 G PP PPPPP S PPPP GG P PPP P Sbjct: 358 GPPPPGRGGPPPPPPPATGRSGPLPPPPPGAGGPPMPPPPP 398 Score = 42.3 bits (95), Expect = 0.013 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPP PPPP G P PPP P PP Sbjct: 352 PPPTPRGPPPPGRGGPPPPPPPATGRSGPLPPPPPGAGGPPMPPP 396 Score = 40.3 bits (90), Expect = 0.053 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPP PPPP G P PPPP PP Sbjct: 351 PPPPTPRGPPPPGRGGPPPPPPPATGRSGPLPPPPPGAGGPPMPPP 396 Score = 38.7 bits (86), Expect = 0.16 Identities = 20/50 (40%), Positives = 21/50 (42%) Frame = +3 Query: 435 PXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPPXXXXXG 584 P G PPPP PPPP GG PPPPP + PP G Sbjct: 346 PLGIAPPPPTPR----GPPPPGRGG-PPPPPPPATGRSGPLPPPPPGAGG 390 Score = 38.7 bits (86), Expect = 0.16 Identities = 23/68 (33%), Positives = 23/68 (33%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXX 560 PP G GG G PPPPP PPPP PPPP A Sbjct: 359 PPPPGRGGPPPPPPPATGRSGPLPPPPPGAGGPPMPPPPPP---PPPPPSSGNGPAPPPL 415 Query: 561 PPXXXXXG 584 PP G Sbjct: 416 PPALVPAG 423 Score = 36.3 bits (80), Expect = 0.86 Identities = 19/60 (31%), Positives = 20/60 (33%) Frame = +3 Query: 387 RGGGGGXXFXXXGXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 +G G G PP PPP PPPP G P PP P PP Sbjct: 336 KGRSGPLPPVPLGIAPPPPTPRGPPPPGRGGPPPPPPPATGRSGPLPPPPPGAGGPPMPP 395 >UniRef50_O60610 Cluster: Protein diaphanous homolog 1; n=43; Euteleostomi|Rep: Protein diaphanous homolog 1 - Homo sapiens (Human) Length = 1248 Score = 44.4 bits (100), Expect = 0.003 Identities = 20/45 (44%), Positives = 20/45 (44%), Gaps = 3/45 (6%) Frame = +3 Query: 441 GXXPPPPPXXXXXXSPPPP---XXGGGXPPPPPXPXXXAXXXXPP 566 G PPPPP PPPP G G PPPPP P PP Sbjct: 678 GIPPPPPPLPGEAGMPPPPPPLPGGPGIPPPPPFPGGPGIPPPPP 722 Score = 43.6 bits (98), Expect = 0.006 Identities = 20/48 (41%), Positives = 20/48 (41%), Gaps = 3/48 (6%) Frame = +1 Query: 433 PXGXXXPPPPPXXXKXXXPPPP---XXGXXXPPPPPPLXXXXXAXXPP 567 P G PPPPP PPPP PPPPPPL PP Sbjct: 649 PGGTAIPPPPPLPGSARIPPPPPPLPGSAGIPPPPPPLPGEAGMPPPP 696 Score = 41.5 bits (93), Expect = 0.023 Identities = 21/52 (40%), Positives = 21/52 (40%), Gaps = 2/52 (3%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXXPPPPPXXXXXXSPPPP--XXGGGXPPPPP 530 PP G G G PPPPP PPPP G G PPPPP Sbjct: 671 PPLPGSAGIPPPPPPLPGEAGMPPPPPPLPGGPGIPPPPPFPGGPGIPPPPP 722 Score = 41.1 bits (92), Expect = 0.030 Identities = 18/36 (50%), Positives = 18/36 (50%), Gaps = 1/36 (2%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGX-PPPPPXP 536 PP PPPP SPPPP G PPPPP P Sbjct: 602 PPPPPPPPPPLPGGTAISPPPPLSGDATIPPPPPLP 637 Score = 40.7 bits (91), Expect = 0.040 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPL 537 PP PPPP PPPP G PPPPPL Sbjct: 601 PPPPPPPPPPPLPGGTAISPPPPLSGDATIPPPPPL 636 Score = 40.3 bits (90), Expect = 0.053 Identities = 17/33 (51%), Positives = 17/33 (51%) Frame = +1 Query: 433 PXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPP 531 P G PPPPP PPPP G PPPPP Sbjct: 700 PGGPGIPPPPPFPGGPGIPPPPP-GMGMPPPPP 731 Score = 39.9 bits (89), Expect = 0.070 Identities = 23/67 (34%), Positives = 23/67 (34%), Gaps = 5/67 (7%) Frame = +3 Query: 399 GGXXFXXXGXXPPXGXXPPPPPXXXXXXS---PPPPXXG--GGXPPPPPXPXXXAXXXXP 563 GG P PPPPP PPPP G G PPPPP P P Sbjct: 650 GGTAIPPPPPLPGSARIPPPPPPLPGSAGIPPPPPPLPGEAGMPPPPPPLPGGPGIPPPP 709 Query: 564 PXXXXXG 584 P G Sbjct: 710 PFPGGPG 716 Score = 39.1 bits (87), Expect = 0.12 Identities = 23/71 (32%), Positives = 23/71 (32%), Gaps = 3/71 (4%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXXPPPPPXXXXXXSPPPP---XXGGGXPPPPPXPXXXAX 551 PP G P PPPPP PPPP G PPPPP A Sbjct: 632 PPPPLPEGVGIPSPSSLPGGTAIPPPPPLPGSARIPPPPPPLPGSAGIPPPPPPLPGEAG 691 Query: 552 XXXPPXXXXXG 584 PP G Sbjct: 692 MPPPPPPLPGG 702 Score = 38.3 bits (85), Expect = 0.21 Identities = 18/48 (37%), Positives = 19/48 (39%), Gaps = 2/48 (4%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXK--XXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 P PPPPP + PPPP G PPPPP PP Sbjct: 674 PGSAGIPPPPPPLPGEAGMPPPPPPLPGGPGIPPPPPFPGGPGIPPPP 721 Score = 36.7 bits (81), Expect = 0.65 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +1 Query: 433 PXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 P PPPPP PPPP G PPPPL PP Sbjct: 593 PGDSTTPPPPPPPPP---PPPPLPGGTAISPPPPLSGDATIPPPP 634 Score = 35.9 bits (79), Expect = 1.1 Identities = 20/68 (29%), Positives = 21/68 (30%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXX 560 PP GG PPPPP P P GG PPP P + Sbjct: 608 PPPPLPGGTAISPPPPLSGDATIPPPPPLPEGVGIPSPSSLPGGTAIPPPPPLPGSARIP 667 Query: 561 PPXXXXXG 584 PP G Sbjct: 668 PPPPPLPG 675 Score = 35.1 bits (77), Expect = 2.0 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 2/36 (5%) Frame = +1 Query: 433 PXGXXXPPPPP--XXXKXXXPPPPXXGXXXPPPPPP 534 P PPPPP PPPP G PPPPP Sbjct: 687 PGEAGMPPPPPPLPGGPGIPPPPPFPGGPGIPPPPP 722 Score = 34.3 bits (75), Expect = 3.5 Identities = 15/37 (40%), Positives = 16/37 (43%), Gaps = 2/37 (5%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXS--PPPPXXGGGXPPPPPXP 536 P PP PP + PPPP G PPPP P Sbjct: 568 PSRAPVPPAPPLPGDSGTIIPPPPAPGDSTTPPPPPP 604 Score = 33.9 bits (74), Expect = 4.6 Identities = 20/68 (29%), Positives = 20/68 (29%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXX 560 PP G G P G PPP PPP G PPPP Sbjct: 577 PPLPGDSGTIIPPP---PAPGDSTTPPPPPPPPPPPPPLPGGTAISPPPPLSGDATIPPP 633 Query: 561 PPXXXXXG 584 PP G Sbjct: 634 PPLPEGVG 641 Score = 33.9 bits (74), Expect = 4.6 Identities = 17/47 (36%), Positives = 17/47 (36%), Gaps = 2/47 (4%) Frame = +1 Query: 433 PXGXXXPPPPPXXXKXXXPPPPXX--GXXXPPPPPPLXXXXXAXXPP 567 P G P P PPPP PPPPPPL PP Sbjct: 637 PEGVGIPSPSSLPGGTAIPPPPPLPGSARIPPPPPPLPGSAGIPPPP 683 Score = 33.5 bits (73), Expect = 6.1 Identities = 19/52 (36%), Positives = 19/52 (36%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 PP GG P PPPPP PPPP G G P P P Sbjct: 695 PPPPLPGGPGIPPPPPFPGGPGIPPPPPGMGM---PPPPPFGFGVPAAPVLP 743 >UniRef50_UPI0000D8C71D Cluster: Wiskott-Aldrich syndrome protein (WASp).; n=3; Danio rerio|Rep: Wiskott-Aldrich syndrome protein (WASp). - Danio rerio Length = 490 Score = 44.0 bits (99), Expect = 0.004 Identities = 22/51 (43%), Positives = 22/51 (43%) Frame = +3 Query: 384 PRGGGGGXXFXXXGXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 P GG G G P G PPPP PP P GG PPPPP P Sbjct: 335 PPGGRTGPLPQPPG--PRSGPLPPPPTNRSGGLPPPLPEPSGGGPPPPPPP 383 Score = 39.1 bits (87), Expect = 0.12 Identities = 20/50 (40%), Positives = 20/50 (40%), Gaps = 4/50 (8%) Frame = +1 Query: 430 PPXGXXXP-PPPPXXXKXXXPPP---PXXGXXXPPPPPPLXXXXXAXXPP 567 PP P PPPP PPP P G PPPPPP PP Sbjct: 346 PPGPRSGPLPPPPTNRSGGLPPPLPEPSGGGPPPPPPPPAAPPPPPAAPP 395 Score = 37.1 bits (82), Expect = 0.50 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +3 Query: 441 GXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 G P PP PPP GG PPP P P PP Sbjct: 341 GPLPQPPGPRSGPLPPPPTNRSGGLPPPLPEPSGGGPPPPPP 382 Score = 35.5 bits (78), Expect = 1.5 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 441 GXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 G PPP P PPPP PPPP P Sbjct: 363 GGLPPPLPEPSGGGPPPPPPPPAAPPPPPAAP 394 Score = 33.1 bits (72), Expect = 8.1 Identities = 17/47 (36%), Positives = 17/47 (36%), Gaps = 1/47 (2%) Frame = +1 Query: 430 PPXGXXXP-PPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP G P P PP PPPP PPP P PP Sbjct: 335 PPGGRTGPLPQPPGPRSGPLPPPPTNRSGGLPPPLPEPSGGGPPPPP 381 >UniRef50_Q4SUB2 Cluster: Chromosome 3 SCAF13974, whole genome shotgun sequence; n=1; Tetraodon nigroviridis|Rep: Chromosome 3 SCAF13974, whole genome shotgun sequence - Tetraodon nigroviridis (Green puffer) Length = 692 Score = 44.0 bits (99), Expect = 0.004 Identities = 20/45 (44%), Positives = 21/45 (46%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP SPPPP PPPPP P + PP Sbjct: 115 PPPPPPPPPPPLPSFTLSPPPP-----PPPPPPPPLPPSPRPPPP 154 Score = 35.9 bits (79), Expect = 1.1 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +1 Query: 433 PXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 P PPPPP PPPP PPPPPP PP Sbjct: 115 PPPPPPPPPPPLPSFTLSPPPP------PPPPPPPPLPPSPRPPP 153 Score = 35.1 bits (77), Expect = 2.0 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 2/47 (4%) Frame = +1 Query: 433 PXGXXXPPPPPXXXK--XXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 P PPPPP PPPP PPPPPPL PP Sbjct: 113 PLPPPPPPPPPPPLPSFTLSPPPP----PPPPPPPPLPPSPRPPPPP 155 >UniRef50_Q1LVB7 Cluster: Novel protein; n=5; Danio rerio|Rep: Novel protein - Danio rerio (Zebrafish) (Brachydanio rerio) Length = 198 Score = 44.0 bits (99), Expect = 0.004 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPPXXXXXG 584 PPPPP PPP G PPPPP P A PP G Sbjct: 111 PPPPPPMHMRGPPPPHMHRHGPPPPPPPPGHPAFRGRPPHPRGRG 155 Score = 40.7 bits (91), Expect = 0.040 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPP 534 PPPPP PPPP PPPPPP Sbjct: 110 PPPPPPPMHMRGPPPPHMHRHGPPPPPP 137 >UniRef50_Q20IN6 Cluster: HrpW; n=1; Pseudomonas cichorii|Rep: HrpW - Pseudomonas cichorii Length = 561 Score = 44.0 bits (99), Expect = 0.004 Identities = 23/49 (46%), Positives = 23/49 (46%), Gaps = 1/49 (2%) Frame = -2 Query: 565 GGXXXXAXXXGXGGGGGXPPPXXGGGGXXFXXXXGGGGGXXP-XGGXXP 422 GG A G GGGGG P GGGG GGGGG P GG P Sbjct: 284 GGGGGGAPSVGGGGGGGAPSVGGGGGGGAPSVGGGGGGGSTPSIGGTAP 332 Score = 43.2 bits (97), Expect = 0.008 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = -2 Query: 565 GGXXXXAXXXGXGGGGGXPPPXXGGGGXXFXXXXGGGGGXXPXGG 431 GG A G GGGGG P GGGG GGGGG GG Sbjct: 251 GGGGGGAPSIGGGGGGGAPSVGGGGGGGAPSVGGGGGGGAPSVGG 295 Score = 43.2 bits (97), Expect = 0.008 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = -2 Query: 565 GGXXXXAXXXGXGGGGGXPPPXXGGGGXXFXXXXGGGGGXXPXGG 431 GG A G GGGGG P GGGG GGGGG GG Sbjct: 262 GGGGGGAPSVGGGGGGGAPSVGGGGGGGAPSVGGGGGGGAPSVGG 306 Score = 43.2 bits (97), Expect = 0.008 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = -2 Query: 565 GGXXXXAXXXGXGGGGGXPPPXXGGGGXXFXXXXGGGGGXXPXGG 431 GG A G GGGGG P GGGG GGGGG GG Sbjct: 273 GGGGGGAPSVGGGGGGGAPSVGGGGGGGAPSVGGGGGGGAPSVGG 317 Score = 41.9 bits (94), Expect = 0.017 Identities = 18/36 (50%), Positives = 19/36 (52%) Frame = -1 Query: 536 RGGGGGGXSXPXXGGGGXXXXXXXGGGGGXXXPXGG 429 +GGGGGG P GGGG GGGGG P G Sbjct: 248 KGGGGGGGGAPSIGGGGGGGAPSVGGGGGGGAPSVG 283 Score = 41.5 bits (93), Expect = 0.023 Identities = 27/74 (36%), Positives = 28/74 (37%), Gaps = 1/74 (1%) Frame = -1 Query: 566 GGXXAXXXXXRGGGGGGXSXPXXGGGGXXXXXXXGGGGGXXXPXGGXXXXXKXXPPPPPP 387 GG GGGGGG + GGGG GGGGG GG P Sbjct: 261 GGGGGGGAPSVGGGGGGGAPSVGGGGGGGAPSVGGGGGGGAPSVGGGGGG--GAPSVGGG 318 Query: 386 GGXXXTP-XGGXPP 348 GG TP GG P Sbjct: 319 GGGGSTPSIGGTAP 332 Score = 39.5 bits (88), Expect = 0.093 Identities = 19/46 (41%), Positives = 20/46 (43%) Frame = -1 Query: 566 GGXXAXXXXXRGGGGGGXSXPXXGGGGXXXXXXXGGGGGXXXPXGG 429 GG GGGGGG + GGGG GGGGG GG Sbjct: 250 GGGGGGGAPSIGGGGGGGAPSVGGGGGGGAPSVGGGGGGGAPSVGG 295 Score = 36.3 bits (80), Expect = 0.86 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = -2 Query: 565 GGXXXXAXXXGXGGGGGXPPPXXGGGGXXFXXXXGGGGG 449 GG GGGGG P GGGG GGGGG Sbjct: 249 GGGGGGGGAPSIGGGGGGGAPSVGGGGGGGAPSVGGGGG 287 Score = 35.5 bits (78), Expect = 1.5 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = -1 Query: 566 GGXXAXXXXXRGGGGGGXSXPXXGGGGXXXXXXXGGGGGXXXPXGG 429 GG GGGGG S GGGG GGGG GG Sbjct: 252 GGGGGAPSIGGGGGGGAPSVGGGGGGGAPSVGGGGGGGAPSVGGGG 297 >UniRef50_Q7YYP6 Cluster: Hydroxyproline-rich glycoprotein dz-hrgp, probable; n=4; Eukaryota|Rep: Hydroxyproline-rich glycoprotein dz-hrgp, probable - Cryptosporidium parvum Length = 832 Score = 44.0 bits (99), Expect = 0.004 Identities = 18/46 (39%), Positives = 19/46 (41%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPPP + PPPP G PP PP PP Sbjct: 611 PPPSEELPPPPPPSEELPPPPPPSSGELPPPLPPSFGELPLPPPPP 656 Score = 43.6 bits (98), Expect = 0.006 Identities = 19/46 (41%), Positives = 20/46 (43%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPPP + PPPP PPPPPP PP Sbjct: 601 PPPSEELPPPPPPSEELPPPPPP--SEELPPPPPPSSGELPPPLPP 644 Score = 41.1 bits (92), Expect = 0.030 Identities = 18/37 (48%), Positives = 19/37 (51%), Gaps = 1/37 (2%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXX-PPPPPPL 537 PP PPPPP + P PP G PPPPPPL Sbjct: 622 PPSEELPPPPPPSSGELPPPLPPSFGELPLPPPPPPL 658 Score = 38.7 bits (86), Expect = 0.16 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP PP Sbjct: 602 PPSEELPPPPPPSEELPPPPPPSEE--LPPPPPPSSGELPPPLPP 644 Score = 37.9 bits (84), Expect = 0.28 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP G PPP P PP Sbjct: 612 PPSEELPPPPPPSEELPPPPPPSSG---ELPPPLPPSFGELPLPP 653 Score = 37.5 bits (83), Expect = 0.37 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = +1 Query: 433 PXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPP 534 P PPPPP PPPP PPPPPP Sbjct: 593 PLPEELPPPPP---SEELPPPPPPSEELPPPPPP 623 Score = 34.7 bits (76), Expect = 2.6 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 P PPPPP PPPP G PPP P PP Sbjct: 613 PSEELPPPPPP--SEELPPPPPPSSGELPPPLPPSFGELPLPPPP 655 Score = 34.3 bits (75), Expect = 3.5 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 P PPPPP P PP G PPPP P Sbjct: 623 PSEELPPPPPPSSGELPPPLPPSFGELPLPPPPPP 657 Score = 33.1 bits (72), Expect = 8.1 Identities = 15/46 (32%), Positives = 16/46 (34%) Frame = +2 Query: 431 PPXGXXXPPPPXXXXKXXXPPPXXXGXXXPPPPXPXXXXXXXXPPP 568 PP PPP + PPP PPP P PPP Sbjct: 610 PPPPSEELPPPPPPSEELPPPPPPSSGELPPPLPPSFGELPLPPPP 655 >UniRef50_A0D1C0 Cluster: Chromosome undetermined scaffold_34, whole genome shotgun sequence; n=2; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_34, whole genome shotgun sequence - Paramecium tetraurelia Length = 1131 Score = 44.0 bits (99), Expect = 0.004 Identities = 20/43 (46%), Positives = 20/43 (46%), Gaps = 4/43 (9%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPP----XXGGGXPPPPPXPXXXA 548 PP PPPPP PPPP GG PPPPP P A Sbjct: 632 PPPPPPPPPPPGGKTGAPPPPPPPPGAKAGGPPPPPPPPGGKA 674 Score = 40.3 bits (90), Expect = 0.053 Identities = 21/47 (44%), Positives = 21/47 (44%), Gaps = 2/47 (4%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGG--GXPPPPPXPXXXAXXXXPPXXXXXG 584 PPPPP PPPP GG G PPPPP P PP G Sbjct: 632 PPPPP-------PPPPPPGGKTGAPPPPPPPPGAKAGGPPPPPPPPG 671 Score = 37.9 bits (84), Expect = 0.28 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPPP K PPPP PPP P A PP Sbjct: 595 PPPPPPPPPPPPPSAKSQVPPPP-----PPPPSVPKSTNNSAPPPP 635 Score = 36.7 bits (81), Expect = 0.65 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = +3 Query: 435 PXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 P PPPPP PPPP PPPPP P Sbjct: 589 PQKAAPPPPP--PPPPPPPPPSAKSQVPPPPPPP 620 Score = 36.7 bits (81), Expect = 0.65 Identities = 19/54 (35%), Positives = 19/54 (35%), Gaps = 9/54 (16%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXX---------GGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 597 PPPPPPPPPPPSAKSQVPPPPPPPPSVPKSTNNSAPPPPPPPPPPPGGKTGAPP 650 Score = 36.7 bits (81), Expect = 0.65 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 5/39 (12%) Frame = +1 Query: 433 PXGXXXPPPPPXXXKXXXPPPP-----XXGXXXPPPPPP 534 P PPPPP PPPP G PPPPPP Sbjct: 632 PPPPPPPPPPPGGKTGAPPPPPPPPGAKAGGPPPPPPPP 670 Score = 36.7 bits (81), Expect = 0.65 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = +3 Query: 423 GXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPP 530 G PP PPPPP PPPP GG PP P Sbjct: 647 GAPPP----PPPPPGAKAGGPPPPPPPPGGKAPPLP 678 Score = 34.3 bits (75), Expect = 3.5 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPP 534 PPPPP PP PPPPPP Sbjct: 594 PPPPPPPPPPPPPPSAKSQVPPPPPPPP 621 Score = 33.9 bits (74), Expect = 4.6 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 439 GXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPP 534 G PPPPP K PPPP PP P Sbjct: 647 GAPPPPPPPPGAKAGGPPPPPPPPGGKAPPLP 678 Score = 33.5 bits (73), Expect = 6.1 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -3 Query: 354 PPPXXGXKXXXXXXPPXKKXPPPPPXGGXGXP 259 PPP K PP PPPPP G G P Sbjct: 618 PPPPSVPKSTNNSAPPPPPPPPPPPGGKTGAP 649 Score = 33.5 bits (73), Expect = 6.1 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -1 Query: 404 PPPPPPGGXXXTPXGGXPPP 345 PPPPPPGG P PPP Sbjct: 637 PPPPPPGGKTGAPPPPPPPP 656 >UniRef50_Q9P6T1 Cluster: Putative uncharacterized protein 15E6.220; n=1; Neurospora crassa|Rep: Putative uncharacterized protein 15E6.220 - Neurospora crassa Length = 1992 Score = 44.0 bits (99), Expect = 0.004 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PPPPP PPPP PPPPPP A PP Sbjct: 46 PPPPPASPPPPPPPPPPPPPPPPPPPPPEPEPQPAPPPP 84 Score = 42.3 bits (95), Expect = 0.013 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PPPPP PPPP PPPPPP PP Sbjct: 44 PPPPPPPASPPPPPPPPPPPPPPPPPPPPPEPEPQPAPP 82 Score = 42.3 bits (95), Expect = 0.013 Identities = 16/35 (45%), Positives = 17/35 (48%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPP 534 P PPPPP + PPPP PPPPPP Sbjct: 1946 PTLAPPPPPPPPPPTEDPPPPPPPPPAEAPPPPPP 1980 Score = 41.9 bits (94), Expect = 0.017 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PPPPP PPPP PPPPP P PP Sbjct: 44 PPPPPPPASPPPPPPPPPPPPPPPPPPPPPEPEPQPAPP 82 Score = 41.9 bits (94), Expect = 0.017 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PPPPP PPPP PPPPP P PP Sbjct: 45 PPPPPPASPPPPPPPPPPPPPPPPPPPPPEPEPQPAPPP 83 Score = 41.9 bits (94), Expect = 0.017 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PPPPP PPPP PPPPPP PP Sbjct: 45 PPPPPPASPPPPPPPPPPPPPPPPPPPPPEPEPQPAPPP 83 Score = 41.1 bits (92), Expect = 0.030 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 PPPPP PPPP PPPPP P Sbjct: 1954 PPPPPPTEDPPPPPPPPPAEAPPPPPPTP 1982 Score = 40.7 bits (91), Expect = 0.040 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPP 534 PPPPP PPPP PPPPPP Sbjct: 42 PPPPPPPPPASPPPPPPPPPPPPPPPPP 69 Score = 40.7 bits (91), Expect = 0.040 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPP 534 PPPPP PPPP PPPPPP Sbjct: 43 PPPPPPPPASPPPPPPPPPPPPPPPPPP 70 Score = 40.7 bits (91), Expect = 0.040 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PP PPPP PPPPP P A PP Sbjct: 1942 PPRPPTLAPPPPPPPPPPTEDPPPPPPPPPAEAPPPPPP 1980 Score = 39.9 bits (89), Expect = 0.070 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPP 534 PP PPPPP PPPP PPPPP Sbjct: 1945 PPTLAPPPPPPPPPPTEDPPPPPPPPPAEAPPPPP 1979 Score = 39.5 bits (88), Expect = 0.093 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 PPPPP PPPP PPPPP P Sbjct: 43 PPPPPPPPASPPPPPPPPPPPPPPPPPPP 71 Score = 39.1 bits (87), Expect = 0.12 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPPL 537 PPPPP PPPP PPPP PL Sbjct: 1955 PPPPPTEDPPPPPPPPPAEAPPPPPPTPL 1983 Score = 38.7 bits (86), Expect = 0.16 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PPPPP PPPP PPPPP PP Sbjct: 46 PPPPPASPPPPPPPPPPPPPPPPPPPPPEPEPQPAPPPP 84 Score = 38.3 bits (85), Expect = 0.21 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 PP PPPPP PPPP PPPPP P Sbjct: 47 PPPPASPPPPPPPPPPPPPPPP------PPPPPEP 75 Score = 38.3 bits (85), Expect = 0.21 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPP 534 PP PPPPP PPPP P P PP Sbjct: 48 PPPASPPPPPPPPPPPPPPPPPPPPPEPEPQPAPP 82 Score = 38.3 bits (85), Expect = 0.21 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPP 534 PP PPPPP PPPP P PPP Sbjct: 49 PPASPPPPPPPPPPPPPPPPPPPPPEPEPQPAPPP 83 Score = 38.3 bits (85), Expect = 0.21 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PP PPPP PPPPPP PP Sbjct: 1942 PPRPPTLAPPPPPPPPPPTEDPPPPPPPPPAEAPPPPPP 1980 Score = 36.7 bits (81), Expect = 0.65 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 PP PPPPP PPP PPPP P Sbjct: 53 PPPPPPPPPPPPPPPPPPPPPEPEPQPAPPPPETP 87 Score = 33.1 bits (72), Expect = 8.1 Identities = 15/45 (33%), Positives = 15/45 (33%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP P P P PP PPPPP P PP Sbjct: 1925 PPAQAQAPATPTITSAAPPRPPTLAPPPPPPPPPPTEDPPPPPPP 1969 >UniRef50_Q7SCZ7 Cluster: Predicted protein; n=5; Pezizomycotina|Rep: Predicted protein - Neurospora crassa Length = 452 Score = 44.0 bits (99), Expect = 0.004 Identities = 20/39 (51%), Positives = 20/39 (51%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PPPPP PPPP G G PPPPP P A PP Sbjct: 2 PPPPPP------PPPPPPGMGGPPPPPPPPPGALPGRPP 34 Score = 39.1 bits (87), Expect = 0.12 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PPPPP PPPP G PPPPPP PP Sbjct: 2 PPPPPP------PPPPPPGMGGPPPPPPPPPGALPGRPP 34 Score = 37.5 bits (83), Expect = 0.37 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPP 530 PP PPPPP PPPP G P PP Sbjct: 2 PPPPPPPPPPPPGMGGPPPPPPPPPGALPGRPP 34 Score = 35.9 bits (79), Expect = 1.1 Identities = 17/46 (36%), Positives = 17/46 (36%), Gaps = 1/46 (2%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSP-PPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPP P PPP P PPP P PP Sbjct: 245 PPPSFAPPPPSSAAPSLPPAPPPPPPTAAPRPPPAPSRSQPPPPPP 290 Score = 35.5 bits (78), Expect = 1.5 Identities = 21/62 (33%), Positives = 21/62 (33%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXX 560 PP G PP PPPPP PPP PP PP P A Sbjct: 222 PPPPGSRKPSAAIHSSAPPSA--PPPPPSFAP---PPPSSAAPSLPPAPPPPPPTAAPRP 276 Query: 561 PP 566 PP Sbjct: 277 PP 278 Score = 35.5 bits (78), Expect = 1.5 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPP 531 PPPPP PP P PPPPP Sbjct: 265 PPPPPPTAAPRPPPAPSRSQPPPPPPP 291 Score = 35.1 bits (77), Expect = 2.0 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPP 530 P PPPPP PP P PPPPP Sbjct: 259 PSLPPAPPPPPPTAAPRPPPAPSRSQPPPPPPP 291 Score = 34.7 bits (76), Expect = 2.6 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPP 534 P PPP PPP PPPPPP Sbjct: 263 PAPPPPPPTAAPRPPPAPSRSQPPPPPP 290 Score = 34.7 bits (76), Expect = 2.6 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 454 PPPPXXXKXXXPPPPXXGXXXPPPPPP 534 PPPP PPP PPPPPP Sbjct: 265 PPPPPPTAAPRPPPAPSRSQPPPPPPP 291 Score = 33.1 bits (72), Expect = 8.1 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +1 Query: 433 PXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPP 534 P PPPPP P PPPPPP Sbjct: 317 PAAPPPPPPPPSAPPRSTASSPSHSAPAPPPPPP 350 >UniRef50_Q6FSY6 Cluster: Similar to sp|P47068 Saccharomyces cerevisiae YJL020c; n=1; Candida glabrata|Rep: Similar to sp|P47068 Saccharomyces cerevisiae YJL020c - Candida glabrata (Yeast) (Torulopsis glabrata) Length = 1039 Score = 44.0 bits (99), Expect = 0.004 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = +3 Query: 435 PXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 P G PPPPP PPPP PPPPP PP Sbjct: 676 PHGAPPPPPPPTHTAHPPPPPPTHAAHPPPPPPTAGHDGQAPPP 719 Score = 39.5 bits (88), Expect = 0.093 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPP 530 P PPPPP PPPP PPPPP Sbjct: 676 PHGAPPPPPPPTHTAHPPPPPPTHAAHPPPPPP 708 Score = 37.1 bits (82), Expect = 0.50 Identities = 19/54 (35%), Positives = 19/54 (35%), Gaps = 2/54 (3%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPX--GXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 PP G PP PPPPP PPPP G PPP P Sbjct: 668 PPPSDHSGPHGAPPPPPPPTHTAHPPPPPPTHAAHPPPPPPTAGHDGQAPPPLP 721 Score = 36.3 bits (80), Expect = 0.86 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPL 537 PP PPPPP PPPP PPPL Sbjct: 685 PPTHTAHPPPPPPTHAAHPPPPPPTAGHDGQAPPPL 720 Score = 36.3 bits (80), Expect = 0.86 Identities = 16/31 (51%), Positives = 16/31 (51%), Gaps = 2/31 (6%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXX--PPPPPPL 537 PPPPP PPPP G PPP PPL Sbjct: 693 PPPPPTHAAHPPPPPPTAGHDGQAPPPLPPL 723 Score = 35.9 bits (79), Expect = 1.1 Identities = 19/54 (35%), Positives = 19/54 (35%), Gaps = 2/54 (3%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXXPPPPPXXXXXXSPPPPXXGG--GXPPPPPXP 536 PP G P PPPPP PPPP G G PPP P Sbjct: 669 PPSDHSGPHGAPPPPPPPTHTAHPPPPPPTHAAHPPPPPPTAGHDGQAPPPLPP 722 Score = 34.7 bits (76), Expect = 2.6 Identities = 16/45 (35%), Positives = 17/45 (37%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 P G PPP +PPPP PPP P A PP Sbjct: 662 PMSGIPPPPSDHSGPHGAPPPPPPPTHTAHPPPPPPTHAAHPPPP 706 Score = 33.9 bits (74), Expect = 4.6 Identities = 17/46 (36%), Positives = 17/46 (36%), Gaps = 2/46 (4%) Frame = +3 Query: 435 PXGXXPPPPPXXXXXXS--PPPPXXGGGXPPPPPXPXXXAXXXXPP 566 P PPPP PPPP PPPP P A PP Sbjct: 662 PMSGIPPPPSDHSGPHGAPPPPPPPTHTAHPPPPPPTHAAHPPPPP 707 >UniRef50_Q24120 Cluster: Protein cappuccino; n=6; Drosophila melanogaster|Rep: Protein cappuccino - Drosophila melanogaster (Fruit fly) Length = 1059 Score = 44.0 bits (99), Expect = 0.004 Identities = 20/49 (40%), Positives = 20/49 (40%), Gaps = 4/49 (8%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXX----GGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP G PPPPP P PP Sbjct: 503 PPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPPAPIEGGGGIPPP 551 Score = 43.2 bits (97), Expect = 0.008 Identities = 18/45 (40%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPP PPPP G PPPPP P + PP Sbjct: 492 PPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPP 536 Score = 41.1 bits (92), Expect = 0.030 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 3/49 (6%) Frame = +1 Query: 430 PPXGXXXPPPPPXXX---KXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPPP PPPP PPPPPP PP Sbjct: 502 PPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPPAPIEGGGGIPP 550 Score = 40.7 bits (91), Expect = 0.040 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PPPPP PPPP PPPPPPL PP Sbjct: 488 PPPPPPLHAFVAPPPPPP--PPPPPPPPLANYGAPPPPP 524 Score = 40.7 bits (91), Expect = 0.040 Identities = 20/40 (50%), Positives = 20/40 (50%), Gaps = 2/40 (5%) Frame = +3 Query: 423 GXXPPXGXXPPPPPXXXXXXSPPPPXX--GGGXPPPPPXP 536 G PP PPPPP PPPP GGG PPPP P Sbjct: 518 GAPPPP---PPPPPGSGSAPPPPPPAPIEGGGGIPPPPPP 554 Score = 39.9 bits (89), Expect = 0.070 Identities = 17/45 (37%), Positives = 18/45 (40%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPPXXXXXG 584 PPPPP PP G PPPPP P + PP G Sbjct: 500 PPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPPAPIEG 544 Score = 38.3 bits (85), Expect = 0.21 Identities = 18/45 (40%), Positives = 19/45 (42%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPPXXXXXG 584 PPPPP +PPPP PPPPP A PP G Sbjct: 488 PPPPPPLHAFVAPPPPPPPP-PPPPPPLANYGAPPPPPPPPPGSG 531 Score = 36.3 bits (80), Expect = 0.86 Identities = 20/50 (40%), Positives = 21/50 (42%), Gaps = 2/50 (4%) Frame = +3 Query: 423 GXXPPXGXX--PPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 G P PPPPP +PPPP PPPPP P A PP Sbjct: 477 GEKPHAVAPPPPPPPPPLHAFVAPPPP-----PPPPPPPPPPLANYGAPP 521 >UniRef50_Q4RDJ1 Cluster: Chromosome undetermined SCAF16309, whole genome shotgun sequence; n=2; Tetraodontidae|Rep: Chromosome undetermined SCAF16309, whole genome shotgun sequence - Tetraodon nigroviridis (Green puffer) Length = 283 Score = 43.6 bits (98), Expect = 0.006 Identities = 21/49 (42%), Positives = 21/49 (42%), Gaps = 4/49 (8%) Frame = +3 Query: 450 PPPPPXXXXXXS----PPPPXXGGGXPPPPPXPXXXAXXXXPPXXXXXG 584 PPPPP S PPPP G G PPPPP P PP G Sbjct: 149 PPPPPTGVLDQSSTAPPPPPATGIGFPPPPPPPVPGGVSVPPPPPLAPG 197 Score = 37.5 bits (83), Expect = 0.37 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPP 530 PP P P PPPP G G PPPPP Sbjct: 222 PPPPPLPISPSNGISPPPPPPPMTGSGFPPPPP 254 Score = 34.7 bits (76), Expect = 2.6 Identities = 19/45 (42%), Positives = 19/45 (42%), Gaps = 7/45 (15%) Frame = +3 Query: 423 GXXPPXGXXPPPPPXXXXXXSPPPPXXGGG-------XPPPPPXP 536 G PP PPPPP PPPP G PPPPP P Sbjct: 234 GISPP----PPPPPMTGSGFPPPPPLNHSGSTGRLGRLPPPPPPP 274 Score = 34.3 bits (75), Expect = 3.5 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPP 531 PP P P PPPP G PPPPP Sbjct: 221 PPPPPPLPISPSNGISPPPPPPPMTGSGFPPPPP 254 Score = 34.3 bits (75), Expect = 3.5 Identities = 16/39 (41%), Positives = 17/39 (43%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PPPPP P P G PPPPPP+ PP Sbjct: 221 PPPPPPL-----PISPSNGISPPPPPPPMTGSGFPPPPP 254 Score = 33.5 bits (73), Expect = 6.1 Identities = 17/36 (47%), Positives = 17/36 (47%), Gaps = 3/36 (8%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGX--PPPPPX-PXXXA 548 PPPP PPPP GG PPPPP P A Sbjct: 165 PPPPATGIGFPPPPPPPVPGGVSVPPPPPLAPGGAA 200 >UniRef50_Q0S917 Cluster: Possible proline rich protein; n=1; Rhodococcus sp. RHA1|Rep: Possible proline rich protein - Rhodococcus sp. (strain RHA1) Length = 338 Score = 43.6 bits (98), Expect = 0.006 Identities = 21/49 (42%), Positives = 21/49 (42%) Frame = +3 Query: 384 PRGGGGGXXFXXXGXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPP 530 P GG G PP G PPPP PPP GG PPPPP Sbjct: 12 PEGGDQGGYPPQGNPPPPPGGYPPPPGNYPPPPQGPPP---GGYPPPPP 57 Score = 42.3 bits (95), Expect = 0.013 Identities = 18/35 (51%), Positives = 18/35 (51%) Frame = +3 Query: 423 GXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPP 527 G PP G PPPP PPPP GG PPPP Sbjct: 32 GYPPPPGNYPPPPQGPPPGGYPPPPP-GGNYPPPP 65 Score = 37.1 bits (82), Expect = 0.50 Identities = 21/64 (32%), Positives = 21/64 (32%), Gaps = 2/64 (3%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXXPPPPPXXXXXXSPPP--PXXGGGXPPPPPXPXXXAXX 554 PP GG G PP PPP PP P G PPPP P Sbjct: 53 PPPPPGGNYPPPPGGNYPPPSGGNYPPPSGGNYPPPPGNYPPPQGNYPPPPQGPPPGGYP 112 Query: 555 XXPP 566 PP Sbjct: 113 PPPP 116 Score = 36.3 bits (80), Expect = 0.86 Identities = 18/44 (40%), Positives = 19/44 (43%), Gaps = 4/44 (9%) Frame = -1 Query: 455 GGXXXPXGGXXXXXKXXPP----PPPPGGXXXTPXGGXPPPXXG 336 GG P G + PP PPPPGG P GG PP G Sbjct: 31 GGYPPPPGNYPPPPQGPPPGGYPPPPPGGNYPPPPGGNYPPPSG 74 Score = 34.7 bits (76), Expect = 2.6 Identities = 19/54 (35%), Positives = 19/54 (35%), Gaps = 3/54 (5%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSP---PPPXXGGGXPPPPPXPXXXAXXXXPPXXXXXG 584 PP G PPPP S PPP G PPP P PP G Sbjct: 56 PPGGNYPPPPGGNYPPPSGGNYPPPSGGNYPPPPGNYPPPQGNYPPPPQGPPPG 109 Score = 34.3 bits (75), Expect = 3.5 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPP 528 PP PPPP PPPP G PPPP Sbjct: 34 PPPPGNYPPPPQGPPPGGYPPPPP-GGNYPPPP 65 Score = 34.3 bits (75), Expect = 3.5 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -1 Query: 458 GGGXXXPXGGXXXXXKXXPPPPPPGGXXXTPXGGXPPP 345 GG P GG PPP GG P G PPP Sbjct: 58 GGNYPPPPGGNYPPPSGGNYPPPSGGNYPPPPGNYPPP 95 Score = 34.3 bits (75), Expect = 3.5 Identities = 16/39 (41%), Positives = 17/39 (43%), Gaps = 3/39 (7%) Frame = +1 Query: 430 PPXGXXXPPPP---PXXXKXXXPPPPXXGXXXPPPPPPL 537 PP G PPPP P PPP PPPPP+ Sbjct: 79 PPSGGNYPPPPGNYPPPQGNYPPPPQGPPPGGYPPPPPM 117 Score = 33.9 bits (74), Expect = 4.6 Identities = 22/80 (27%), Positives = 23/80 (28%) Frame = -1 Query: 464 GGGGGXXXPXGGXXXXXKXXPPPPPPGGXXXTPXGGXPPPXXGXKXXXXAXXXXXXXXXX 285 GG P GG PPPP G P G PPP G Sbjct: 4 GGYDPNDKPEGGDQGGYPPQGNPPPPPGGYPPPPGNYPPPPQGPPPGGYPPPPPGGNYPP 63 Query: 284 XPXGGXXPPXFXFFXKXXGG 225 P G PP + GG Sbjct: 64 PPGGNYPPPSGGNYPPPSGG 83 Score = 33.1 bits (72), Expect = 8.1 Identities = 22/67 (32%), Positives = 23/67 (34%) Frame = -1 Query: 536 RGGGGGGXSXPXXGGGGXXXXXXXGGGGGXXXPXGGXXXXXKXXPPPPPPGGXXXTPXGG 357 +G GG P GG GG P GG PPPPG P G Sbjct: 45 QGPPPGGYPPPPPGGNYPPPP-----GGNYPPPSGGNYPPPSGGNYPPPPGNYPP-PQGN 98 Query: 356 XPPPXXG 336 PPP G Sbjct: 99 YPPPPQG 105 >UniRef50_Q9C946 Cluster: Putative uncharacterized protein T7P1.21; n=1; Arabidopsis thaliana|Rep: Putative uncharacterized protein T7P1.21 - Arabidopsis thaliana (Mouse-ear cress) Length = 907 Score = 43.6 bits (98), Expect = 0.006 Identities = 19/41 (46%), Positives = 19/41 (46%), Gaps = 2/41 (4%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXG--GGXPPPPPXPXXXAXXXXPP 566 PPPPP PPPP G PPPPP P A PP Sbjct: 526 PPPPPRAAVAPPPPPPPPGTAAAPPPPPPPPGTQAAPPPPP 566 Score = 43.6 bits (98), Expect = 0.006 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PPPPP PPPP G PPPPP A PP Sbjct: 526 PPPPPRAAVAPPPPPPPPGTAAAPPPPPPPPGTQAAPPP 564 Score = 43.6 bits (98), Expect = 0.006 Identities = 20/42 (47%), Positives = 20/42 (47%), Gaps = 3/42 (7%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGG---GXPPPPPXPXXXAXXXXPP 566 PPPPP SPPP G G PPPPP P A PP Sbjct: 565 PPPPPMQNRAPSPPPMPMGNSGSGGPPPPPPPMPLANGATPP 606 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/48 (39%), Positives = 19/48 (39%) Frame = +3 Query: 423 GXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 G PP PP P PPPP PPPPP P A PP Sbjct: 505 GSAPPPPPPPPLPTTIAAPPPPPPPPRAAVAPPPPPPPPGTAAAPPPP 552 Score = 42.7 bits (96), Expect = 0.010 Identities = 19/40 (47%), Positives = 19/40 (47%), Gaps = 1/40 (2%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXX-PPPPPPLXXXXXAXXPP 567 PPPPP PPPP G PPPPPP A PP Sbjct: 539 PPPPPGTAAAPPPPPPPPGTQAAPPPPPPPPMQNRAPSPP 578 Score = 41.5 bits (93), Expect = 0.023 Identities = 29/111 (26%), Positives = 30/111 (27%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPPXXXXXGXXXXXXXXXXKXGXX 629 PPPPP PPPP G PPPP P P G Sbjct: 539 PPPPPGTAAAPPPPPPPPGTQAAPPPPPPPPMQNRAPSPPPMPMGNSGSGGPPPPPPPMP 598 Query: 630 XXXXKXXKXXXXXXXXXXGSXXXXPPPXXXXXAXGGAGGXXXXXXXXPPPP 782 G+ PPP A G AG PPPP Sbjct: 599 LANGATPPPPPPPMAMANGAAGPPPPPPRMGMANGAAG--------PPPPP 641 Score = 37.1 bits (82), Expect = 0.50 Identities = 17/42 (40%), Positives = 18/42 (42%), Gaps = 3/42 (7%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXX---PPPPPPLXXXXXAXXPP 567 PPPPP + PPP G PPPPPP PP Sbjct: 565 PPPPPMQNRAPSPPPMPMGNSGSGGPPPPPPPMPLANGATPP 606 Score = 34.7 bits (76), Expect = 2.6 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +2 Query: 431 PPXGXXXPPPPXXXXKXXXPPPXXXGXXXPPPPXPXXXXXXXXPPP 568 PP PPPP PPP PPPP P PPP Sbjct: 529 PPRAAVAPPPPP-------PPPGTAAAPPPPPPPPGTQAAPPPPPP 567 Score = 33.9 bits (74), Expect = 4.6 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +1 Query: 433 PXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 P PPPPP PPP PPPPPP A PP Sbjct: 502 PLKGSAPPPPP-------PPPLPTTIAAPPPPPPPPRAAVAPPPP 539 Score = 33.5 bits (73), Expect = 6.1 Identities = 19/51 (37%), Positives = 20/51 (39%), Gaps = 8/51 (15%) Frame = +1 Query: 439 GXXXPPPPPXXXKXXXPPPP-------XXGXXXPPPPPP-LXXXXXAXXPP 567 G PPPPP PPP G PPPPPP + A PP Sbjct: 588 GGPPPPPPPMPLANGATPPPPPPPMAMANGAAGPPPPPPRMGMANGAAGPP 638 >UniRef50_Q41645 Cluster: Extensin; n=1; Volvox carteri|Rep: Extensin - Volvox carteri Length = 464 Score = 43.6 bits (98), Expect = 0.006 Identities = 17/33 (51%), Positives = 17/33 (51%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPP 530 PP PPPPP SPPPP PPPPP Sbjct: 283 PPPVASPPPPPPPRVSPSPPPPQPVSSPPPPPP 315 Score = 43.2 bits (97), Expect = 0.008 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPP 534 PP PPPPP PPPP PPPPPP Sbjct: 282 PPPPVASPPPPPPPRVSPSPPPPQPVSSPPPPPPP 316 Score = 42.7 bits (96), Expect = 0.010 Identities = 20/48 (41%), Positives = 20/48 (41%), Gaps = 3/48 (6%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPP---PPXPXXXAXXXXPP 566 PP PP PP SPPPP PPP PP P A PP Sbjct: 332 PPPSPPPPSPPPPRPSPSPPPPRSSPSPPPPVVSPPPPPPRASPPPPP 379 Score = 42.3 bits (95), Expect = 0.013 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 PP PPPPP PPP PPPPP P Sbjct: 284 PPVASPPPPPPPRVSPSPPPPQPVSSPPPPPPPRP 318 Score = 41.5 bits (93), Expect = 0.023 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPP 534 PP PPPPP PPPP PPP PP Sbjct: 303 PPQPVSSPPPPPPPRPSPSPPPPRSSPSPPPPSPP 337 Score = 40.7 bits (91), Expect = 0.040 Identities = 20/45 (44%), Positives = 21/45 (46%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP SPPPP PPPPP P + PP Sbjct: 360 PPPVVSPPPPPPRA---SPPPPPASS--PPPPPRPPPPSPPPSPP 399 Score = 39.9 bits (89), Expect = 0.070 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 PPPPP SPPPP PPP P P Sbjct: 310 PPPPPPPRPSPSPPPPRSSPSPPPPSPPP 338 Score = 39.1 bits (87), Expect = 0.12 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP P PPP SPPPP PPP P PP Sbjct: 323 PPPRSSPSPPPPSPPPPSPPPPRPSPSPPPPRSSPSPPPPVVSPP 367 Score = 38.7 bits (86), Expect = 0.16 Identities = 18/46 (39%), Positives = 19/46 (41%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPPP PPPP PPP PP + PP Sbjct: 359 PPPPVVSPPPPPPRAS---PPPPPASSPPPPPRPPPPSPPPSPPPP 401 Score = 37.5 bits (83), Expect = 0.37 Identities = 15/36 (41%), Positives = 16/36 (44%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPL 537 PP PP PP PPPP PPPP P+ Sbjct: 272 PPPPPRVPPSPPPPVASPPPPPPPRVSPSPPPPQPV 307 Score = 36.7 bits (81), Expect = 0.65 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP P PPP PPPP PPPP PP Sbjct: 293 PPPRVSPSPPPPQPVSSPPPPPPPRPSPSPPPPRSSPSPPPPSPP 337 Score = 36.3 bits (80), Expect = 0.86 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP P PPP PPPP PPPP P PP Sbjct: 274 PPPRVPPSPPPPVASPPPPPPPRVSPS--PPPPQPVSSPPPPPPP 316 Score = 36.3 bits (80), Expect = 0.86 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXP 564 PP PPPPP PPPP PPP PP A P Sbjct: 368 PPPPRASPPPPP---ASSPPPPPRPPPPSPPPSPPPPATAAANPP 409 Score = 35.9 bits (79), Expect = 1.1 Identities = 19/62 (30%), Positives = 19/62 (30%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXX 560 PPR PP P PP SPPPP PPP P Sbjct: 324 PPRSSPSPPPPSPPPPSPPPPRPSPSPPPPRSSPSPPPPVVSPPPPPPRASPPPPPASSP 383 Query: 561 PP 566 PP Sbjct: 384 PP 385 Score = 35.9 bits (79), Expect = 1.1 Identities = 22/63 (34%), Positives = 22/63 (34%), Gaps = 1/63 (1%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPPP-PPXPXXXAXXX 557 PPR PP PPPPP PPPP PPP PP P A Sbjct: 352 PPRSSPSPPPPVVSPPPPPPRASPPPPPASSP---PPPPRPPPPSPPPSPPPPATAAANP 408 Query: 558 XPP 566 P Sbjct: 409 PSP 411 Score = 35.1 bits (77), Expect = 2.0 Identities = 19/48 (39%), Positives = 19/48 (39%), Gaps = 3/48 (6%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPP---PXPXXXAXXXXPP 566 PP PPPP SPPPP PPPP P P PP Sbjct: 265 PPLPKTSPPPP-PRVPPSPPPPVASPPPPPPPRVSPSPPPPQPVSSPP 311 Score = 35.1 bits (77), Expect = 2.0 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP P PPP PPPP PPPP PP Sbjct: 292 PPPPRVSPSPPPPQPVSSPPPPPPPRPSPSPPPPRSSPSPPPPSPP 337 Score = 34.7 bits (76), Expect = 2.6 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP P PPP PPPP P PPPP PP Sbjct: 273 PPPPRVPPSPPPPVAS---PPPPPPPRVSPSPPPPQPVSSPPPPPP 315 Score = 34.3 bits (75), Expect = 3.5 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPP 534 PP P PP PPPP P PPPP Sbjct: 291 PPPPPRVSPSPPPPQPVSSPPPPPPPRPSPSPPPP 325 Score = 34.3 bits (75), Expect = 3.5 Identities = 15/45 (33%), Positives = 15/45 (33%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 P PPPP PPPP PPP P PP Sbjct: 295 PRVSPSPPPPQPVSSPPPPPPPRPSPSPPPPRSSPSPPPPSPPPP 339 Score = 34.3 bits (75), Expect = 3.5 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPP 534 PP P PP PPPP PPPP P Sbjct: 312 PPPPPRPSPSPPPPRSSPSPPPPSPPPPSPPPPRP 346 Score = 33.9 bits (74), Expect = 4.6 Identities = 16/40 (40%), Positives = 16/40 (40%), Gaps = 5/40 (12%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPP-----PPP 534 PP P PPP PPPP PPP PPP Sbjct: 322 PPPPRSSPSPPPPSPPPPSPPPPRPSPSPPPPRSSPSPPP 361 Score = 33.9 bits (74), Expect = 4.6 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 2/37 (5%) Frame = +1 Query: 430 PPXGXXXPPP--PPXXXKXXXPPPPXXGXXXPPPPPP 534 PP PPP PP PPPP PP P P Sbjct: 377 PPPASSPPPPPRPPPPSPPPSPPPPATAAANPPSPAP 413 Score = 33.5 bits (73), Expect = 6.1 Identities = 15/46 (32%), Positives = 15/46 (32%) Frame = +2 Query: 431 PPXGXXXPPPPXXXXKXXXPPPXXXGXXXPPPPXPXXXXXXXXPPP 568 PP PPPP PPP PPP PPP Sbjct: 294 PPRVSPSPPPPQPVSSPPPPPPPRPSPSPPPPRSSPSPPPPSPPPP 339 Score = 33.1 bits (72), Expect = 8.1 Identities = 17/49 (34%), Positives = 17/49 (34%), Gaps = 3/49 (6%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXP---PPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPP P PPP PPPPP PP Sbjct: 343 PPRPSPSPPPPRSSPSPPPPVVSPPPPPPRASPPPPPASSPPPPPRPPP 391 >UniRef50_A2D765 Cluster: Putative uncharacterized protein; n=1; Trichomonas vaginalis G3|Rep: Putative uncharacterized protein - Trichomonas vaginalis G3 Length = 450 Score = 43.6 bits (98), Expect = 0.006 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPP 534 PP PPPPP PPPP PPPPPP Sbjct: 330 PPPRAAAPPPPPPPAAAAPPPPPPPMAAPPPPPPP 364 Score = 42.3 bits (95), Expect = 0.013 Identities = 16/36 (44%), Positives = 17/36 (47%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPL 537 PP P PPP PPPP PPPPPP+ Sbjct: 320 PPPPAAKPAPPPPRAAAPPPPPPPAAAAPPPPPPPM 355 Score = 41.9 bits (94), Expect = 0.017 Identities = 19/51 (37%), Positives = 19/51 (37%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPPXXXXXG 584 PP P PPP PPPP PPPPP P PP G Sbjct: 321 PPPAAKPAPPPPRAAAPPPPPPPAAAA-PPPPPPPMAAPPPPPPPSKSKSG 370 Score = 39.5 bits (88), Expect = 0.093 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +3 Query: 453 PPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PPPP PPPP G PPP P A PP Sbjct: 268 PPPPPVAAAAPPPPPAPGAAPPPPKPAAAPPAAKPAPP 305 Score = 39.5 bits (88), Expect = 0.093 Identities = 19/45 (42%), Positives = 20/45 (44%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP P PPP +PPPP PPPPP P A PP Sbjct: 312 PPPAAKPTPPPPAAKP-APPPPRAAA--PPPPPPPAAAAPPPPPP 353 Score = 38.3 bits (85), Expect = 0.21 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP P PPP K PPP PPPPPP PP Sbjct: 311 PPPPAAKPTPPPPAAK--PAPPPPRAAAPPPPPPPAAAAPPPPPPP 354 Score = 36.7 bits (81), Expect = 0.65 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 454 PPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PPPP PPPP G PPP P PP Sbjct: 268 PPPPPVAAAAPPPPPAPGAAPPPPKPAAAPPAAKPAPP 305 Score = 36.7 bits (81), Expect = 0.65 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = +2 Query: 416 KXXXXPPXGXXXPPPPXXXXKXXXPPPXXXGXXXPPPPXPXXXXXXXXPPP 568 K PP PPPP PPP PPPP P PPP Sbjct: 317 KPTPPPPAAKPAPPPP---RAAAPPPPPPPAAAAPPPPPPPMAAPPPPPPP 364 Score = 34.7 bits (76), Expect = 2.6 Identities = 16/45 (35%), Positives = 17/45 (37%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPP +PPPP P P P A PP Sbjct: 271 PPVAAAAPPPPPAPGA-APPPPKPAAAPPAAKPAPPKPAARPPPP 314 >UniRef50_P41484 Cluster: Proline-rich antigen; n=21; Mycobacterium|Rep: Proline-rich antigen - Mycobacterium leprae Length = 249 Score = 43.6 bits (98), Expect = 0.006 Identities = 18/34 (52%), Positives = 18/34 (52%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPP 531 PP G PPPPP PPPP G PPPPP Sbjct: 44 PPVGGSYPPPPPPGGSYPPPPPP--GGSYPPPPP 75 Score = 43.2 bits (97), Expect = 0.008 Identities = 18/35 (51%), Positives = 18/35 (51%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPP 534 PP G PPPPP PPPP G PPPP P Sbjct: 54 PPPGGSYPPPPPPGGSYP-PPPPSTGAYAPPPPGP 87 Score = 38.3 bits (85), Expect = 0.21 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +1 Query: 439 GXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPP 534 G PPP PPPP G PPPPPP Sbjct: 35 GSAYPPPTAPPVGGSYPPPPPPGGSYPPPPPP 66 Score = 34.7 bits (76), Expect = 2.6 Identities = 22/63 (34%), Positives = 24/63 (38%), Gaps = 1/63 (1%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXXPPPPPXXXXXXS-PPPPXXGGGXPPPPPXPXXXAXXX 557 PP G GG + G PPP S PPPP GG PP P P + Sbjct: 17 PPPGSSGG--YEPSFAPSELGSAYPPPTAPPVGGSYPPPPPPGGSYPP--PPPPGGSYPP 72 Query: 558 XPP 566 PP Sbjct: 73 PPP 75 >UniRef50_UPI00006A2591 Cluster: Wiskott-Aldrich syndrome protein (WASp).; n=1; Xenopus tropicalis|Rep: Wiskott-Aldrich syndrome protein (WASp). - Xenopus tropicalis Length = 451 Score = 43.2 bits (97), Expect = 0.008 Identities = 16/29 (55%), Positives = 16/29 (55%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 PPPPP PPP GG PPPPP P Sbjct: 337 PPPPPSRSTPPIPPPTARSGGPPPPPPPP 365 Score = 40.3 bits (90), Expect = 0.053 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXP 564 P G PPPPP PPP PPPPPP A P Sbjct: 329 PVRGSSAPPPPPPSRSTPPIPPPTARSGGPPPPPPPPPSIPAPPP 373 Score = 39.1 bits (87), Expect = 0.12 Identities = 15/36 (41%), Positives = 16/36 (44%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPL 537 PP PPPP P PP PPPPPP+ Sbjct: 350 PPTARSGGPPPPPPPPPSIPAPPPTSGPAPPPPPPV 385 Score = 38.3 bits (85), Expect = 0.21 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 P G P PPP PPPP PP PPP PP Sbjct: 317 PSRGRTGPLPPPPVRGSSAPPPPPPSRSTPPIPPPTARSGGPPPPP 362 Score = 37.9 bits (84), Expect = 0.28 Identities = 16/43 (37%), Positives = 17/43 (39%) Frame = +1 Query: 439 GXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 G PPPPP P P G P PPPP+ PP Sbjct: 298 GETAPPPPPPSRNAPPAPTPSRGRTGPLPPPPVRGSSAPPPPP 340 Score = 37.5 bits (83), Expect = 0.37 Identities = 16/36 (44%), Positives = 17/36 (47%), Gaps = 1/36 (2%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXX-PPPPXXGXXXPPPPPP 534 PP P P P + PPPP G PPPPPP Sbjct: 306 PPSRNAPPAPTPSRGRTGPLPPPPVRGSSAPPPPPP 341 Score = 36.7 bits (81), Expect = 0.65 Identities = 16/46 (34%), Positives = 17/46 (36%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PP PP + PPPP P PPP PP Sbjct: 339 PPPSRSTPPIPPPTARSGGPPPPPPPPPSIPAPPPTSGPAPPPPPP 384 Score = 36.3 bits (80), Expect = 0.86 Identities = 16/46 (34%), Positives = 17/46 (36%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPP + P PP PPPPP PP Sbjct: 328 PPVRGSSAPPPPPPSRSTPPIPPPTARSGGPPPPPPPPPSIPAPPP 373 Score = 33.9 bits (74), Expect = 4.6 Identities = 15/39 (38%), Positives = 16/39 (41%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PPPPP +P P G PPPP A PP Sbjct: 303 PPPPPSRNAPPAPTPSRGRTGPLPPPPVRGSSAPPPPPP 341 Score = 33.5 bits (73), Expect = 6.1 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = +3 Query: 423 GXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPP 530 G PP PPPPP PPP G PPPPP Sbjct: 356 GGPPPP---PPPPP----SIPAPPPTSGPAPPPPPP 384 Score = 33.5 bits (73), Expect = 6.1 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPP 534 PP P PPP PPPP G P P P Sbjct: 362 PPPPPSIPAPPPTSGPAPPPPPPVSGTQSIPSPTP 396 Score = 33.1 bits (72), Expect = 8.1 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +3 Query: 453 PPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PPPP PPPP P PPP PP Sbjct: 326 PPPPVRGSSAPPPPPPSRSTPPIPPPTARSGGPPPPPP 363 >UniRef50_Q10R38 Cluster: Transposon protein, putative, CACTA, En/Spm sub-class; n=2; Oryza sativa|Rep: Transposon protein, putative, CACTA, En/Spm sub-class - Oryza sativa subsp. japonica (Rice) Length = 209 Score = 43.2 bits (97), Expect = 0.008 Identities = 20/46 (43%), Positives = 21/46 (45%), Gaps = 1/46 (2%) Frame = +3 Query: 432 PPXGXXPPP-PPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPP P SPPPP G PPPPP P + PP Sbjct: 42 PPTEASPPPLAPPPSVTSSPPPPAAGPLMPPPPPPPSVTSSPPPPP 87 Score = 40.7 bits (91), Expect = 0.040 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPL 537 PP PPPP PPPP PPPPPL Sbjct: 53 PPPSVTSSPPPPAAGPLMPPPPPPPSVTSSPPPPPL 88 Score = 39.1 bits (87), Expect = 0.12 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPP 534 P G PPPPP PPPP PPPPPP Sbjct: 64 PAAGPLMPPPPPPPSVTSSPPPP---PLPPPPPPP 95 Score = 38.3 bits (85), Expect = 0.21 Identities = 18/46 (39%), Positives = 19/46 (41%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPPP PPPP PPP PP + PP Sbjct: 76 PPSVTSSPPPPPLPPP---PPPPAASPPPPPPSPPPPSPVKSSPPP 118 Score = 37.1 bits (82), Expect = 0.50 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 P PPPP PPPP PPPPP P Sbjct: 55 PSVTSSPPPPAAGPLMPPPPPPPSVTSSPPPPPLP 89 Score = 35.9 bits (79), Expect = 1.1 Identities = 18/49 (36%), Positives = 18/49 (36%), Gaps = 3/49 (6%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXK---XXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPP PPPP G PPPPPP PP Sbjct: 39 PPSPPTEASPPPLAPPPSVTSSPPPPAAGPLMPPPPPPPSVTSSPPPPP 87 Score = 35.5 bits (78), Expect = 1.5 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 P PPPPP PPPP PPP P P PP Sbjct: 77 PSVTSSPPPPPLPPP---PPPPAASPPPPPPSPPPPSPVKSSPPP 118 >UniRef50_A4S9A6 Cluster: Predicted protein; n=1; Ostreococcus lucimarinus CCE9901|Rep: Predicted protein - Ostreococcus lucimarinus CCE9901 Length = 4076 Score = 43.2 bits (97), Expect = 0.008 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXA 548 PP PPPPP SPPPP PPP P P A Sbjct: 88 PPPPPSPPPPPSPPPPPSPPPPSPPPSPPPPSPPPPPGA 126 Score = 39.5 bits (88), Expect = 0.093 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 PP PP PP SPPPP PPPP P Sbjct: 2071 PPPSPPPPSPPPSPPPPSPPPPSPPPPPSPPPPSP 2105 Score = 39.5 bits (88), Expect = 0.093 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPP PPPP PPPP P PP Sbjct: 2076 PPPSPPPSPPPPSPPPPSPPPPPSPPPPSPPPPSPPPPSPPPPSPP 2121 Score = 38.7 bits (86), Expect = 0.16 Identities = 20/47 (42%), Positives = 20/47 (42%), Gaps = 2/47 (4%) Frame = +3 Query: 432 PPXGXXP-PPPPXXXXXXSPPPPXXGGGXPPPP-PXPXXXAXXXXPP 566 PP P PPPP SPPPP PPPP P P PP Sbjct: 2081 PPSPPPPSPPPPSPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPP 2127 Score = 37.9 bits (84), Expect = 0.28 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 454 PPPPXXXKXXXPPPPXXGXXXPPPPPP 534 PPPP PPPP PPPPPP Sbjct: 1873 PPPPPSPPPPSPPPPSPPPPSPPPPPP 1899 Score = 37.5 bits (83), Expect = 0.37 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PPPPP SPPPP PPP P P PP Sbjct: 88 PPPPPSPPPPPSPPPPP---SPPPPSPPPSPPPPSPPPP 123 Score = 37.1 bits (82), Expect = 0.50 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 2/47 (4%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPP--PPXPXXXAXXXXPP 566 PP PPPP PPPP PPP PP P PP Sbjct: 2077 PPSPPPSPPPPSPPPPSPPPPPSPPPPSPPPPSPPPPSPPPPSPPPP 2123 Score = 36.7 bits (81), Expect = 0.65 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPP 527 PP P PPP SPPPP PPPP Sbjct: 2097 PPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPP 2128 Score = 36.3 bits (80), Expect = 0.86 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPL 537 PP PPP P P PP P PPPP+ Sbjct: 2094 PPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPM 2129 Score = 35.9 bits (79), Expect = 1.1 Identities = 17/46 (36%), Positives = 18/46 (39%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PP PP PPPP PP PPP + PP Sbjct: 2070 PPPPSPPPPSPPPSPPPPSPPPP--SPPPPPSPPPPSPPPPSPPPP 2113 Score = 35.5 bits (78), Expect = 1.5 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPP 534 PP PP PP PP P P PPPP Sbjct: 84 PPPSPPPPPSPPPPPSPPPPPSPPPPSPPPSPPPP 118 Score = 35.1 bits (77), Expect = 2.0 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PPPPP PPPP PP PPP PP Sbjct: 88 PPPPPSPPPPPSPPPPPS--PPPPSPPPSPPPPSPPPPP 124 Score = 35.1 bits (77), Expect = 2.0 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPPP 530 PPPPP SPPPP PPPPP Sbjct: 1873 PPPPPS-PPPPSPPPPSPPPPSPPPPP 1898 Score = 34.7 bits (76), Expect = 2.6 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 454 PPPPXXXKXXXPPPPXXGXXXPPPPPP 534 PPPP PP P PPPPPP Sbjct: 1669 PPPPSPPPPSPPPSPPPPSPSPPPPPP 1695 Score = 33.5 bits (73), Expect = 6.1 Identities = 15/45 (33%), Positives = 16/45 (35%) Frame = +1 Query: 433 PXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 P PPP P PP P PP PPP + PP Sbjct: 2084 PPPPSPPPPSPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPP 2128 Score = 33.1 bits (72), Expect = 8.1 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +2 Query: 452 PPPPXXXXKXXXPPPXXXGXXXPPPPXPXXXXXXXXPPP 568 PPP PPP PPPP P PPP Sbjct: 84 PPPSPPPPPSPPPPPSPPPPPSPPPPSPPPSPPPPSPPP 122 Score = 33.1 bits (72), Expect = 8.1 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPPP 530 PP PP SPPPP PPPPP Sbjct: 1671 PPSPPPPSPPPSPPPPSP--SPPPPPP 1695 >UniRef50_A2EVR8 Cluster: Putative uncharacterized protein; n=1; Trichomonas vaginalis G3|Rep: Putative uncharacterized protein - Trichomonas vaginalis G3 Length = 434 Score = 43.2 bits (97), Expect = 0.008 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP G PPPPP PPP GGG PPPP PP Sbjct: 311 PPPGALPPPPPPPP----PPPKAPGGGSLPPPPPAASPGIAAPPP 351 Score = 36.7 bits (81), Expect = 0.65 Identities = 17/38 (44%), Positives = 17/38 (44%), Gaps = 2/38 (5%) Frame = +3 Query: 423 GXXPPXGXXPPPPPXXXXXXS--PPPPXXGGGXPPPPP 530 G PP PPPPP S PPPP G PPP Sbjct: 314 GALPPPPPPPPPPPKAPGGGSLPPPPPAASPGIAAPPP 351 >UniRef50_Q7SF15 Cluster: Putative uncharacterized protein NCU07438.1; n=1; Neurospora crassa|Rep: Putative uncharacterized protein NCU07438.1 - Neurospora crassa Length = 636 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/34 (55%), Positives = 19/34 (55%) Frame = +3 Query: 435 PXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 P G PPPPP PPPP GG PPPPP P Sbjct: 504 PSGGAPPPPP-------PPPPGGMGGVPPPPPPP 530 Score = 41.9 bits (94), Expect = 0.017 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +3 Query: 435 PXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 P PPPPP PP P GG PPPPP P PP Sbjct: 487 PAAHAPPPPPPM-----PPMPAPSGGAPPPPPPPPPGGMGGVPP 525 Score = 41.5 bits (93), Expect = 0.023 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPP 534 PPPPP PPPP PPPPPP Sbjct: 449 PPPPPLPATQAPPPPPLPATSAPPPPPP 476 Score = 40.7 bits (91), Expect = 0.040 Identities = 19/46 (41%), Positives = 19/46 (41%), Gaps = 1/46 (2%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGG-GXPPPPPXPXXXAXXXXPP 566 PP P P P PPPP GG G PPPP P PP Sbjct: 494 PPPPMPPMPAPSGGAPPPPPPPPPGGMGGVPPPPPPPPPGGMPPPP 539 Score = 40.3 bits (90), Expect = 0.053 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 435 PXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPP 530 P PPPPP PPPP PPPPP Sbjct: 444 PTSNAPPPPPLPATQAPPPPPLPATSAPPPPP 475 Score = 40.3 bits (90), Expect = 0.053 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = +3 Query: 423 GXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 G PP PPPPP PPPP G PPPP P Sbjct: 506 GGAPPP--PPPPPPGGMGGVPPPPPPPPPGGMPPPPAP 541 Score = 39.5 bits (88), Expect = 0.093 Identities = 16/38 (42%), Positives = 17/38 (44%) Frame = +3 Query: 453 PPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PPPP +PPPP PP PP P A PP Sbjct: 460 PPPPPLPATSAPPPPPPAPPAPPAPPLPAAHAPPPPPP 497 Score = 39.1 bits (87), Expect = 0.12 Identities = 15/36 (41%), Positives = 16/36 (44%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPL 537 PP PPPP P PP PPPPPP+ Sbjct: 463 PPLPATSAPPPPPPAPPAPPAPPLPAAHAPPPPPPM 498 Score = 38.3 bits (85), Expect = 0.21 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 P PP PPPP PPPPP P A PP Sbjct: 438 PQAPPLPTSNAPPPPPLPATQAPPPPPLPATSAPPPPPP 476 Score = 37.5 bits (83), Expect = 0.37 Identities = 15/37 (40%), Positives = 16/37 (43%) Frame = +1 Query: 457 PPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PPP + PPPP PPPPPP PP Sbjct: 374 PPPFTGQRSVPPPPPSRSSVPPPPPPRNSAAQPPLPP 410 Score = 37.1 bits (82), Expect = 0.50 Identities = 16/45 (35%), Positives = 17/45 (37%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 P PPPPP +PP P PPPP P PP Sbjct: 466 PATSAPPPPPPAPPAPPAPPLPAAHAPPPPPPMPPMPAPSGGAPP 510 Score = 37.1 bits (82), Expect = 0.50 Identities = 19/53 (35%), Positives = 19/53 (35%), Gaps = 7/53 (13%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXX-------GXXXPPPPPPLXXXXXAXXPP 567 PP PP PP PPPP G PPPPPP PP Sbjct: 474 PPPAPPAPPAPPLPAAHAPPPPPPMPPMPAPSGGAPPPPPPPPPGGMGGVPPP 526 Score = 36.3 bits (80), Expect = 0.86 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXP 563 PPPPP PPPP PP PP A P Sbjct: 384 PPPPPSRSSVPPPPPPRNSAAQPPLPPKAPGPAPPLPP 421 Score = 36.3 bits (80), Expect = 0.86 Identities = 17/46 (36%), Positives = 18/46 (39%), Gaps = 1/46 (2%) Frame = +1 Query: 433 PXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPP-PPLXXXXXAXXPP 567 P PPPPP PP P PPPP PP+ PP Sbjct: 466 PATSAPPPPPPAPPAPPAPPLPAAHAPPPPPPMPPMPAPSGGAPPP 511 Score = 35.9 bits (79), Expect = 1.1 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +3 Query: 456 PPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PPP PPPP PPPPP A PP Sbjct: 374 PPPFTGQRSVPPPPPSRSSVPPPPPPRNSAAQPPLPP 410 Score = 35.5 bits (78), Expect = 1.5 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +1 Query: 433 PXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 P PP P PPPP PPPPPL PP Sbjct: 431 PTRSPAPPQAPPLPTSNAPPPPPLPATQAPPPPPLPATSAPPPPP 475 Score = 35.5 bits (78), Expect = 1.5 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPP 531 PP PPPP PPPP PP PP Sbjct: 452 PPLPATQAPPPPPLPATSAPPPPPPAPPAPPAPP 485 Score = 35.1 bits (77), Expect = 2.0 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -1 Query: 404 PPPPPPGGXXXTPXGGXPPPXXG 336 PPPPPPGG P PPP G Sbjct: 512 PPPPPPGGMGGVPPPPPPPPPGG 534 Score = 34.7 bits (76), Expect = 2.6 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 P G PPPP PPPP PP PP PP Sbjct: 376 PFTGQRSVPPPPPSRSSVPPPPPPRNSAAQPPLPPKAPGPAPPLPP 421 Score = 34.3 bits (75), Expect = 3.5 Identities = 17/38 (44%), Positives = 17/38 (44%), Gaps = 3/38 (7%) Frame = +1 Query: 430 PPXGXXXPP-PPPXXXKXXXPPPPXXG--XXXPPPPPP 534 PP PP P P PPPP G PPPPPP Sbjct: 492 PPPPPPMPPMPAPSGGAPPPPPPPPPGGMGGVPPPPPP 529 Score = 33.9 bits (74), Expect = 4.6 Identities = 19/50 (38%), Positives = 19/50 (38%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPP 530 PP G PP G PPP PPPP GG PPP P Sbjct: 499 PPMPAPSGGAPPPPPPPPPGGMGGVPPP-------PPPPPPGGMPPPPAP 541 Score = 33.1 bits (72), Expect = 8.1 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -1 Query: 404 PPPPPPGGXXXTPXGGXPPP 345 PPPPPP P GG PPP Sbjct: 492 PPPPPPMPPMPAPSGGAPPP 511 >UniRef50_A2QUG1 Cluster: Similarity to the N. crassa protein. Additionally; n=5; Trichocomaceae|Rep: Similarity to the N. crassa protein. Additionally - Aspergillus niger Length = 578 Score = 43.2 bits (97), Expect = 0.008 Identities = 20/51 (39%), Positives = 22/51 (43%), Gaps = 5/51 (9%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXX-----PPPPPPLXXXXXAXXPP 567 PP G PPPPP + PPPP PPPPPP + PP Sbjct: 486 PPGGPAPPPPPPPNYQGTWPPPPPPAMNLGAAHPPPPPPPHAAHQGSHFPP 536 Score = 37.9 bits (84), Expect = 0.28 Identities = 18/47 (38%), Positives = 19/47 (40%), Gaps = 1/47 (2%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPP-PXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPP + PPP G PPPPPP PP Sbjct: 422 PPAPRSIPPPPEYHHQPQYPPPHNAYGNTAPPPPPPPVGYHAPPPPP 468 Score = 37.5 bits (83), Expect = 0.37 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 2/44 (4%) Frame = +3 Query: 411 FXXXGXXPPXGXXPPPPPXXXXXXSPPPP--XXGGGXPPPPPXP 536 F G PP PPPP PPPP G PPPPP P Sbjct: 485 FPPGGPAPPP---PPPPNYQGTWPPPPPPAMNLGAAHPPPPPPP 525 Score = 34.3 bits (75), Expect = 3.5 Identities = 16/40 (40%), Positives = 17/40 (42%), Gaps = 1/40 (2%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPP-LXXXXXAXXPP 567 PP PPPP G PPPPPP + A PP Sbjct: 442 PPHNAYGNTAPPPPPPPVGYHAPPPPPPQMGYPSAAGVPP 481 >UniRef50_Q8N8S7 Cluster: Protein enabled homolog; n=9; Tetrapoda|Rep: Protein enabled homolog - Homo sapiens (Human) Length = 591 Score = 43.2 bits (97), Expect = 0.008 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPP 534 PP G PPP P PPPP PPPPPP Sbjct: 332 PPPGPPPPPPLPSTGPPPPPPPPPLPNQVPPPPPP 366 Score = 38.7 bits (86), Expect = 0.16 Identities = 17/37 (45%), Positives = 17/37 (45%), Gaps = 2/37 (5%) Frame = +3 Query: 432 PPXGXXPPPP--PXXXXXXSPPPPXXGGGXPPPPPXP 536 PP PPPP P PPPP PPPPP P Sbjct: 331 PPPPGPPPPPPLPSTGPPPPPPPPPLPNQVPPPPPPP 367 Score = 36.7 bits (81), Expect = 0.65 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = +1 Query: 454 PPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PPPP PP P G PPPPPPL PP Sbjct: 331 PPPPGPPPP--PPLPSTGPPPPPPPPPLPNQVPPPPPP 366 Score = 35.5 bits (78), Expect = 1.5 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 P G PPPPP PPPP PP PP P Sbjct: 343 PSTGPPPPPPPPPLPNQVPPPPP----PPPAPPLP 373 Score = 33.5 bits (73), Expect = 6.1 Identities = 18/46 (39%), Positives = 19/46 (41%), Gaps = 1/46 (2%) Frame = +1 Query: 433 PXGXXXPPP-PPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 P PPP PP + PP G PPPPPPL PP Sbjct: 310 PLAPPPPPPLPPGPAQASVALPPPPG---PPPPPPLPSTGPPPPPP 352 >UniRef50_UPI0000DB6BDB Cluster: PREDICTED: similar to prickle CG11084-PA, isoform A; n=1; Apis mellifera|Rep: PREDICTED: similar to prickle CG11084-PA, isoform A - Apis mellifera Length = 880 Score = 42.7 bits (96), Expect = 0.010 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = +3 Query: 441 GXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 G PPPP PPPP G PPPPP P Sbjct: 534 GPPPPPPSFLRTGRRPPPPSEGSSSPPPPPPP 565 Score = 39.5 bits (88), Expect = 0.093 Identities = 17/37 (45%), Positives = 17/37 (45%), Gaps = 2/37 (5%) Frame = +1 Query: 430 PPXGXXXPPPPP--XXXKXXXPPPPXXGXXXPPPPPP 534 P PPPPP PPPP G PPPPPP Sbjct: 528 PSDSSAGPPPPPPSFLRTGRRPPPPSEGSSSPPPPPP 564 >UniRef50_A4QN64 Cluster: Zgc:162320 protein; n=8; Danio rerio|Rep: Zgc:162320 protein - Danio rerio (Zebrafish) (Brachydanio rerio) Length = 412 Score = 42.7 bits (96), Expect = 0.010 Identities = 19/38 (50%), Positives = 19/38 (50%) Frame = +3 Query: 423 GXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 G PP G P P P PPPP GGG PP PP P Sbjct: 180 GPPPPPGPPPAPGP---PPPPPPPPPSGGGAPPAPPPP 214 Score = 41.9 bits (94), Expect = 0.017 Identities = 20/52 (38%), Positives = 20/52 (38%), Gaps = 1/52 (1%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSP-PPPXXGGGXPPPPPXPXXXAXXXXPPXXXXXG 584 PP PPP P P PPP G PPPPP P PP G Sbjct: 167 PPPPSAPPPAPASGPPPPPGPPPAPGPPPPPPPPPPSGGGAPPAPPPPSGGG 218 Score = 37.9 bits (84), Expect = 0.28 Identities = 19/51 (37%), Positives = 19/51 (37%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPPXXXXXG 584 P PPPPP PPPP PPPPP A PP G Sbjct: 175 PAPASGPPPPPGPPPAPGPPPP------PPPPPPSGGGAPPAPPPPSGGGG 219 Score = 37.1 bits (82), Expect = 0.50 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 PP PPP PP P G PPPPP P Sbjct: 166 PPPPPSAPPPAPASGPPPPPGPPPAPGPPPPPPPP 200 >UniRef50_A4T9C9 Cluster: Integral membrane protein-like protein; n=1; Mycobacterium gilvum PYR-GCK|Rep: Integral membrane protein-like protein - Mycobacterium gilvum PYR-GCK Length = 335 Score = 42.7 bits (96), Expect = 0.010 Identities = 18/32 (56%), Positives = 18/32 (56%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPP 527 PP G PPPPP PPPP GG PPPP Sbjct: 13 PPQGGYPPPPPSEGGY--PPPPPEGGYPPPPP 42 Score = 40.7 bits (91), Expect = 0.040 Identities = 18/36 (50%), Positives = 18/36 (50%) Frame = +3 Query: 423 GXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPP 530 G PP PPPP PPPP GG PPPPP Sbjct: 9 GYPPPPQGGYPPPPPSEGGYPPPPPE--GGYPPPPP 42 Score = 37.9 bits (84), Expect = 0.28 Identities = 20/48 (41%), Positives = 20/48 (41%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPPP 524 PP GG PP G PPPP PPPP GG PPP Sbjct: 32 PPEGGYPPPPPAGGYQQPPPGGAYPPPPGPGGY--PPPPGQGGYPPPP 77 Score = 37.5 bits (83), Expect = 0.37 Identities = 22/56 (39%), Positives = 23/56 (41%), Gaps = 7/56 (12%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPX---GXXPPPPPXXXXXXSP----PPPXXGGGXPPPP 527 PP+GG G PP G PPPP P PPP GG PPPP Sbjct: 13 PPQGGYPPPPPSEGGYPPPPPEGGYPPPPPAGGYQQPPPGGAYPPPPGPGGYPPPP 68 Score = 36.7 bits (81), Expect = 0.65 Identities = 24/59 (40%), Positives = 24/59 (40%), Gaps = 7/59 (11%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPX-GXXPPPPPXXXXXXSPPPPXXG------GGXPPPPPXP 536 PP GG PP G PPPPP PPPP G GG PPPP P Sbjct: 5 PPPGGYPPPPQGGYPPPPPSEGGYPPPPPEGGYP--PPPPAGGYQQPPPGGAYPPPPGP 61 Score = 35.9 bits (79), Expect = 1.1 Identities = 24/65 (36%), Positives = 24/65 (36%), Gaps = 3/65 (4%) Frame = -1 Query: 521 GGXSXPXXGGGGXXXXXXXGGGGGXXXPXGGXXXXXKXX--PPPPPPGGXXXTP-XGGXP 351 GG P GG GG P GG PPPP PGG P GG P Sbjct: 16 GGYPPPPPSEGGYPPPPPEGGYP-PPPPAGGYQQPPPGGAYPPPPGPGGYPPPPGQGGYP 74 Query: 350 PPXXG 336 PP G Sbjct: 75 PPPGG 79 Score = 35.1 bits (77), Expect = 2.0 Identities = 19/48 (39%), Positives = 19/48 (39%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPPP 524 PP GG G PP G PPP PP GGG PPP Sbjct: 49 PPPGGAYPPPPGPGGYPPPPGQGGYPPPPGGYGM--PPAGFGGGYPPP 94 Score = 34.7 bits (76), Expect = 2.6 Identities = 21/57 (36%), Positives = 21/57 (36%) Frame = -1 Query: 506 PXXGGGGXXXXXXXGGGGGXXXPXGGXXXXXKXXPPPPPPGGXXXTPXGGXPPPXXG 336 P GG GG P GG PPPPP GG P GG PP G Sbjct: 11 PPPPQGGYPPPPPSEGGYPPPPPEGGY-------PPPPPAGGYQQPPPGGAYPPPPG 60 Score = 33.9 bits (74), Expect = 4.6 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPP 525 PP G PPPP PPPP G PPP Sbjct: 49 PPPGGAYPPPP---GPGGYPPPPGQGGYPPPP 77 >UniRef50_Q7XMC9 Cluster: OSJNBb0018A10.6 protein; n=11; Oryza sativa|Rep: OSJNBb0018A10.6 protein - Oryza sativa (Rice) Length = 909 Score = 42.7 bits (96), Expect = 0.010 Identities = 16/34 (47%), Positives = 17/34 (50%) Frame = +3 Query: 435 PXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 P G PPPPP +PPPP P PPP P Sbjct: 464 PSGPPPPPPPPAPSPPAPPPPPPAPSPPAPPPPP 497 Score = 40.3 bits (90), Expect = 0.053 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 2/47 (4%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGG--GXPPPPPXPXXXAXXXXPP 566 PP PPP P PPPP PPPPP P A PP Sbjct: 452 PPAPPPPPPVPSPSGPPPPPPPPAPSPPAPPPPPPAPSPPAPPPPPP 498 Score = 39.9 bits (89), Expect = 0.070 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 P PPPPP PPPP PP PP P PP Sbjct: 450 PSPPAPPPPPPVPSPSGPPPPPPPPAPSPPAPPPPPPAPSPPAPP 494 Score = 39.1 bits (87), Expect = 0.12 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +1 Query: 433 PXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 P PPPPP PPPP PP PPP PP Sbjct: 450 PSPPAPPPPPPVPSPSGPPPPPPPPAPSPPAPPPPPPAPSPPAPP 494 Score = 38.3 bits (85), Expect = 0.21 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 2/46 (4%) Frame = +3 Query: 435 PXGXXPPPPPXXXXXXSPPPPXXGG--GXPPPPPXPXXXAXXXXPP 566 P PP PP PPPP G PPPPP P PP Sbjct: 439 PSPPAPPSPPAPSPPAPPPPPPVPSPSGPPPPPPPPAPSPPAPPPP 484 Score = 38.3 bits (85), Expect = 0.21 Identities = 16/45 (35%), Positives = 17/45 (37%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 P P PP PPPP PPPPP P + PP Sbjct: 439 PSPPAPPSPPAPSPPAPPPPPPVPSPSGPPPPPPPPAPSPPAPPP 483 Score = 37.1 bits (82), Expect = 0.50 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 1/46 (2%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGG-XPPPPPXPXXXAXXXXPP 566 PP PP P PP P G PPPPP P A PP Sbjct: 441 PPAPPSPPAPSPPAPPPPPPVPSPSGPPPPPPPPAPSPPAPPPPPP 486 Score = 34.7 bits (76), Expect = 2.6 Identities = 15/45 (33%), Positives = 15/45 (33%) Frame = +1 Query: 433 PXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 P PP P PP P PPPPPP PP Sbjct: 441 PPAPPSPPAPSPPAPPPPPPVPSPSGPPPPPPPPAPSPPAPPPPP 485 Score = 34.3 bits (75), Expect = 3.5 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = +3 Query: 423 GXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXA 548 G PP P PP PPPP PPPPP P A Sbjct: 466 GPPPPPPPPAPSPP----APPPPPPAPSPPAPPPPPPPCPPA 503 >UniRef50_Q010M7 Cluster: Predicted membrane protein; n=3; Eukaryota|Rep: Predicted membrane protein - Ostreococcus tauri Length = 1449 Score = 42.7 bits (96), Expect = 0.010 Identities = 19/46 (41%), Positives = 20/46 (43%), Gaps = 1/46 (2%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPP-PPXPXXXAXXXXPP 566 PP PPPPP +PPPP PPP PP P PP Sbjct: 850 PPPAPSPPPPPNPPPAPTPPPPPSPPPSPPPSPPPPPSPPPPPSPP 895 Score = 41.9 bits (94), Expect = 0.017 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP S PPP P PPP P PP Sbjct: 820 PPTPPSPPPPPSPPPPPSSPPPPSPSPPPSPPPAPSPPPPPNPPP 864 Score = 41.1 bits (92), Expect = 0.030 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PP PP SPPPP PPPPP P PP Sbjct: 787 PPPSPPPPLPPSPPPPPSPPPPPPPPS-PPPPPNPPTPPSPPPPP 830 Score = 41.1 bits (92), Expect = 0.030 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PP PP SPPPP P PPP P PP Sbjct: 796 PPSPPPPPSPPPPPPPPSPPPPPNPPTPPSPPPPPSPPPPPSSPP 840 Score = 41.1 bits (92), Expect = 0.030 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP SPPPP P PP P PP Sbjct: 808 PPPPPSPPPPPNPPTPPSPPPPPSPPPPPSSPPPPSPSPPPSPPP 852 Score = 41.1 bits (92), Expect = 0.030 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP SP PP P PPP P PP Sbjct: 826 PPPPPSPPPPPSSPPPPSPSPPPSPPPAPSPPPPPNPPPAPTPPP 870 Score = 40.3 bits (90), Expect = 0.053 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPP P PPP PPPPP P PP Sbjct: 840 PPPSPSPPPSPPPAPSPPPPPNPPPAPTPPPPPSPPPSPPPSPPP 884 Score = 39.1 bits (87), Expect = 0.12 Identities = 18/45 (40%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP +PP P PPPPP P PP Sbjct: 802 PPSPPPPPPPPSPPPPPNPPTPPS----PPPPPSPPPPPSSPPPP 842 Score = 38.7 bits (86), Expect = 0.16 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPPP PPPP P PPP PP Sbjct: 807 PPPPPPSPPPPPNPPTPPSPPPPPSPPPPPSSPPPPSPSPPPSPPP 852 Score = 38.7 bits (86), Expect = 0.16 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PP PP SPPPP P P P P PP Sbjct: 814 PPPPPNPPTPPSPPPPPSPPPPPSSPPPPSPSPPPSPPPAPSPPP 858 Score = 38.7 bits (86), Expect = 0.16 Identities = 16/46 (34%), Positives = 17/46 (36%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPP PPP PP PPP + PP Sbjct: 862 PPPAPTPPPPPSPPPSPPPSPPPPPSPPPPPSPPPSPSPPPSSNPP 907 Score = 37.5 bits (83), Expect = 0.37 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPP SPPP P PPP P PP Sbjct: 832 PPPPPSSPPPPSPSPPPSPPPAPSPPPPPNPPPAPTPPPPPSPPP 876 Score = 36.3 bits (80), Expect = 0.86 Identities = 17/47 (36%), Positives = 19/47 (40%), Gaps = 2/47 (4%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPP--PXPXXXAXXXXPP 566 PP PP PP +PP P PPPP P P + PP Sbjct: 805 PPPPPPPPSPPPPPNPPTPPSPPPPPSPPPPPSSPPPPSPSPPPSPP 851 Score = 35.9 bits (79), Expect = 1.1 Identities = 19/50 (38%), Positives = 19/50 (38%), Gaps = 4/50 (8%) Frame = +1 Query: 430 PPXGXXXPP---PPPXXXKXXXPPPPXXGXXXP-PPPPPLXXXXXAXXPP 567 PP PP PPP PPPP P PPPPP PP Sbjct: 834 PPPSSPPPPSPSPPPSPPPAPSPPPPPNPPPAPTPPPPPSPPPSPPPSPP 883 Score = 35.9 bits (79), Expect = 1.1 Identities = 17/47 (36%), Positives = 18/47 (38%), Gaps = 1/47 (2%) Frame = +1 Query: 430 PPXGXXXPPP-PPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPP PP PP P PPPP P + PP Sbjct: 839 PPPPSPSPPPSPPPAPSPPPPPNPPPAPTPPPPPSPPPSPPPSPPPP 885 Score = 35.9 bits (79), Expect = 1.1 Identities = 17/45 (37%), Positives = 18/45 (40%) Frame = +1 Query: 433 PXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 P PPPPP PPPP PP PPP + PP Sbjct: 850 PPPAPSPPPPPNPPPAPTPPPPPS---PPPSPPPSPPPPPSPPPP 891 Score = 35.1 bits (77), Expect = 2.0 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPP PPP PP PP P PP Sbjct: 792 PPPLPPSPPPPPSPPPPPPPPSPPPPPNPPTPPSPPPPPSPPPPP 836 Score = 35.1 bits (77), Expect = 2.0 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP P PPP P PP PPP PP PP Sbjct: 841 PPSPSPPPSPPPAPSPPPPPNPPPAPTPPPPPSPPPSPPPSPPPPP 886 Score = 35.1 bits (77), Expect = 2.0 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPP P PPP P PPPP PP Sbjct: 851 PPAPSPPPPPNPPPAPTPPPPPSPPPSPPPSPPPPPSPPPPPSPPP 896 Score = 34.3 bits (75), Expect = 3.5 Identities = 15/46 (32%), Positives = 16/46 (34%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PP PP PPP P PPP + PP Sbjct: 868 PPPPPSPPPSPPPSPPPPPSPPPPPSPPPSPSPPPSSNPPLSSPPP 913 Score = 33.9 bits (74), Expect = 4.6 Identities = 15/46 (32%), Positives = 16/46 (34%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PP P PP P PP PPP + PP Sbjct: 856 PPPPPNPPPAPTPPPPPSPPPSPPPSPPPPPSPPPPPSPPPSPSPP 901 Score = 33.9 bits (74), Expect = 4.6 Identities = 21/46 (45%), Positives = 21/46 (45%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PP P PP P PPPP P PP Sbjct: 918 PPLSSPPPPSSPPPPSPPLPPSPPLPPNPPPPPSPSPXXXXXXXPP 963 Score = 33.5 bits (73), Expect = 6.1 Identities = 15/45 (33%), Positives = 16/45 (35%) Frame = +1 Query: 433 PXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 P P PPP PPPP PP PP + PP Sbjct: 791 PPPPLPPSPPPPPSPPPPPPPPSPPPPPNPPTPPSPPPPPSPPPP 835 Score = 33.5 bits (73), Expect = 6.1 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +1 Query: 433 PXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 P PPPPP PPP PP PPP PP Sbjct: 820 PPTPPSPPPPPSPPPPPSSPPP-PSPSPPPSPPPAPSPPPPPNPP 863 Score = 33.1 bits (72), Expect = 8.1 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPP 534 PP PP PPPP PPPPPP Sbjct: 788 PPSPPPPLPPSPPPPPSP---PPPPPPP 812 Score = 33.1 bits (72), Expect = 8.1 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP SPPP PPP PP Sbjct: 882 PPPPPSPPPPPSPPPSPSPPPSSNPPLSSPPPLSSPPPLSSPPPP 926 >UniRef50_A2YNB7 Cluster: Putative uncharacterized protein; n=1; Oryza sativa (indica cultivar-group)|Rep: Putative uncharacterized protein - Oryza sativa subsp. indica (Rice) Length = 444 Score = 42.7 bits (96), Expect = 0.010 Identities = 27/74 (36%), Positives = 27/74 (36%), Gaps = 4/74 (5%) Frame = -1 Query: 566 GGXXAXXXXXRGGGGGGXSXPXXGGGGXXXXXXXGGGGGXXXP----XGGXXXXXKXXPP 399 GG A GGGG P GGGG GGGGG P GG PP Sbjct: 102 GGGGARPPGGGGGGGPPSLPPGAGGGGGARPPAPGGGGGGGAPRRVLGGGGGGGALARPP 161 Query: 398 PPPPGGXXXTPXGG 357 GG P GG Sbjct: 162 GGGRGGALGRPPGG 175 Score = 42.3 bits (95), Expect = 0.013 Identities = 20/46 (43%), Positives = 20/46 (43%) Frame = -1 Query: 566 GGXXAXXXXXRGGGGGGXSXPXXGGGGXXXXXXXGGGGGXXXPXGG 429 GG GGGGG P GGGG GGGGG P GG Sbjct: 166 GGALGRPPGGGGGGGGPGRAPGGGGGGGGPGRAPGGGGGGGGPGGG 211 Score = 40.3 bits (90), Expect = 0.053 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = -2 Query: 565 GGXXXXAXXXGXGGGGGXPPPXXGGGGXXFXXXXGGGGGXXP 440 GG G GGGGG P GGGG GGGGG P Sbjct: 177 GGGGGPGRAPGGGGGGGGPGRAPGGGGGGGGPGGGGGGGGAP 218 Score = 38.7 bits (86), Expect = 0.16 Identities = 21/62 (33%), Positives = 22/62 (35%) Frame = -1 Query: 566 GGXXAXXXXXRGGGGGGXSXPXXGGGGXXXXXXXGGGGGXXXPXGGXXXXXKXXPPPPPP 387 GG GGGGG + P GG G GGGGG P P P Sbjct: 140 GGGAPRRVLGGGGGGGALARPPGGGRGGALGRPPGGGGGGGGPGRAPGGGGGGGGPGRAP 199 Query: 386 GG 381 GG Sbjct: 200 GG 201 Score = 38.3 bits (85), Expect = 0.21 Identities = 20/51 (39%), Positives = 20/51 (39%) Frame = -2 Query: 583 PXXXXXGGXXXXAXXXGXGGGGGXPPPXXGGGGXXFXXXXGGGGGXXPXGG 431 P GG G GGGG P GGGG GGGGG GG Sbjct: 160 PPGGGRGGALGRPPGGGGGGGGPGRAPGGGGGGGGPGRAPGGGGGGGGPGG 210 Score = 38.3 bits (85), Expect = 0.21 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = -2 Query: 565 GGXXXXAXXXGXGGGGGXPPPXXGGGGXXFXXXXGGGGG 449 GG G GGGGG P GGGG GGGGG Sbjct: 190 GGGGGPGRAPGGGGGGGGPGGGGGGGGAPERVIGGGGGG 228 Score = 37.1 bits (82), Expect = 0.50 Identities = 24/70 (34%), Positives = 24/70 (34%), Gaps = 2/70 (2%) Frame = -2 Query: 583 PXXXXXGGXXXXAXXXGXGGGGGX--PPPXXGGGGXXFXXXXGGGGGXXPXGGXXPXFXK 410 P GG G GGGGG PP G GG GGGGG P Sbjct: 133 PAPGGGGGGGAPRRVLGGGGGGGALARPPGGGRGGALGRPPGGGGGGGGPGRAPGGGGGG 192 Query: 409 XXPPPPPRGG 380 P P GG Sbjct: 193 GGPGRAPGGG 202 Score = 36.7 bits (81), Expect = 0.65 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = -2 Query: 583 PXXXXXGGXXXXAXXXGXGGGGGXPPPXXGGGGXXFXXXXGGGGG 449 P GG G GGG P P GGGG GGGGG Sbjct: 109 PGGGGGGGPPSLPPGAGGGGGARPPAPGGGGGGGAPRRVLGGGGG 153 Score = 36.3 bits (80), Expect = 0.86 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = -1 Query: 566 GGXXAXXXXXRGGGGGGXSXPXXGGGGXXXXXXXGGGGGXXXPXGG 429 GG GGGGG P GGGG GGGG GG Sbjct: 179 GGGPGRAPGGGGGGGGPGRAPGGGGGGGGPGGGGGGGGAPERVIGG 224 Score = 36.3 bits (80), Expect = 0.86 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = -1 Query: 566 GGXXAXXXXXRGGGGGGXSXPXXGGGGXXXXXXXGGGGG 450 GG GGGGGG GGGG GGGGG Sbjct: 189 GGGGGGPGRAPGGGGGGGGPGGGGGGGGAPERVIGGGGG 227 Score = 35.9 bits (79), Expect = 1.1 Identities = 26/62 (41%), Positives = 26/62 (41%), Gaps = 6/62 (9%) Frame = -2 Query: 547 AXXXGXGGGGGXP--PPXXGGGGXXFXXXX--GGGGG--XXPXGGXXPXFXKXXPPPPPR 386 A G GGGGG P PP GGGG GGGGG GG PP R Sbjct: 106 ARPPGGGGGGGPPSLPPGAGGGGGARPPAPGGGGGGGAPRRVLGGGGGGGALARPPGGGR 165 Query: 385 GG 380 GG Sbjct: 166 GG 167 Score = 35.5 bits (78), Expect = 1.5 Identities = 21/54 (38%), Positives = 21/54 (38%) Frame = -1 Query: 527 GGGGXSXPXXGGGGXXXXXXXGGGGGXXXPXGGXXXXXKXXPPPPPPGGXXXTP 366 GGGG P GGGG GGGG P G PP P GG P Sbjct: 93 GGGGAPGPL-GGGGARPPGGGGGGGPPSLPPGAGGGGGAR-PPAPGGGGGGGAP 144 Score = 34.7 bits (76), Expect = 2.6 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = -1 Query: 566 GGXXAXXXXXRGGGGGGXSXPXXGGGGXXXXXXXGGGGGXXXP 438 GG GGGGGG GGG GGGGG P Sbjct: 176 GGGGGGPGRAPGGGGGGGGPGRAPGGGGGGGGPGGGGGGGGAP 218 Score = 34.7 bits (76), Expect = 2.6 Identities = 16/35 (45%), Positives = 17/35 (48%) Frame = -1 Query: 533 GGGGGGXSXPXXGGGGXXXXXXXGGGGGXXXPXGG 429 GGGG G + GGGG GGGGG GG Sbjct: 178 GGGGPGRAPGGGGGGGGPGRAPGGGGGGGGPGGGG 212 Score = 34.3 bits (75), Expect = 3.5 Identities = 19/50 (38%), Positives = 19/50 (38%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPP 530 PP GGG G PP G PP PP GGG PP P Sbjct: 91 PPGGGGAPGPLGGGGARPPGGGGGGGPPSL-----PPGAGGGGGARPPAP 135 Score = 34.3 bits (75), Expect = 3.5 Identities = 20/59 (33%), Positives = 20/59 (33%) Frame = -1 Query: 533 GGGGGGXSXPXXGGGGXXXXXXXGGGGGXXXPXGGXXXXXKXXPPPPPPGGXXXTPXGG 357 GGGGGG P G G G G GG PP P GG GG Sbjct: 303 GGGGGGHGAPELGFSGGGGGGGGGEIAGTVDLRGGGGGAGGVFPPTPDLGGGGGGGGGG 361 Score = 33.9 bits (74), Expect = 4.6 Identities = 17/34 (50%), Positives = 17/34 (50%), Gaps = 2/34 (5%) Frame = -2 Query: 535 GXGGGGGXPPPXXGGGG--XXFXXXXGGGGGXXP 440 G GGGG PP GGGG GGGGG P Sbjct: 99 GPLGGGGARPPGGGGGGGPPSLPPGAGGGGGARP 132 Score = 33.5 bits (73), Expect = 6.1 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = -1 Query: 566 GGXXAXXXXXRGGGGGGXSXPXXGGGGXXXXXXXGGGGGXXXPXGGXXXXXKXXPPPPPP 387 GG A GG GG P GGGG GGGG G P Sbjct: 152 GGGGALARPPGGGRGGALGRPPGGGGGGGGPGRAPGGGGGGGGPGRAPGGGGGGGGPGGG 211 Query: 386 GGXXXTP 366 GG P Sbjct: 212 GGGGGAP 218 Score = 33.5 bits (73), Expect = 6.1 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = -1 Query: 566 GGXXAXXXXXRGGGGGGXSXPXXGGGGXXXXXXXGGGGG 450 GG GGGGGG GGG GGGGG Sbjct: 191 GGGGPGRAPGGGGGGGGPGGGGGGGGAPERVIGGGGGGG 229 Score = 33.1 bits (72), Expect = 8.1 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = -2 Query: 583 PXXXXXGGXXXXAXXXGXGGGGGXPPPXXGGGGXXFXXXXGGGGG 449 P GG GGGGG P GGGG GGGG Sbjct: 182 PGRAPGGGGGGGGPGRAPGGGGGGGGPGGGGGGGGAPERVIGGGG 226 >UniRef50_A7STU3 Cluster: Predicted protein; n=1; Nematostella vectensis|Rep: Predicted protein - Nematostella vectensis Length = 1164 Score = 42.7 bits (96), Expect = 0.010 Identities = 19/35 (54%), Positives = 19/35 (54%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 P G PPPPP PPPP GG PPPPP P Sbjct: 569 PMAGMPPPPPP-------PPPPGFPGGAPPPPPPP 596 Score = 38.7 bits (86), Expect = 0.16 Identities = 17/35 (48%), Positives = 18/35 (51%) Frame = +3 Query: 423 GXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPP 527 G PP PPPPP +PPPP G PPPP Sbjct: 572 GMPPPP---PPPPPPGFPGGAPPPPPPPFGAPPPP 603 Score = 35.1 bits (77), Expect = 2.0 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPP 528 PPPPP PPPP PPPP Sbjct: 578 PPPPPPGFPGGAPPPPPPPFGAPPPP 603 Score = 33.1 bits (72), Expect = 8.1 Identities = 14/28 (50%), Positives = 15/28 (53%) Frame = +3 Query: 435 PXGXXPPPPPXXXXXXSPPPPXXGGGXP 518 P G PPPPP +PPPP GG P Sbjct: 586 PGGAPPPPPPPFG---APPPPALNGGPP 610 >UniRef50_A6R7X5 Cluster: Putative uncharacterized protein; n=1; Ajellomyces capsulatus NAm1|Rep: Putative uncharacterized protein - Ajellomyces capsulatus NAm1 Length = 1481 Score = 42.7 bits (96), Expect = 0.010 Identities = 21/44 (47%), Positives = 21/44 (47%), Gaps = 5/44 (11%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXX---GG--GXPPPPPXPXXXA 548 PP PPPPP PPPP GG G PPPPP P A Sbjct: 1392 PPTAPPPPPPPAFSAAAPPPPPPPPPVGGAPGGPPPPPPPAGDA 1435 Score = 33.9 bits (74), Expect = 4.6 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 P PPPPP PP PPPPP P A PP Sbjct: 1373 PSMPPPPPPPPVPAPFADAPPT-----APPPPPPPAFSAAAPPPP 1412 Score = 33.9 bits (74), Expect = 4.6 Identities = 18/50 (36%), Positives = 19/50 (38%) Frame = +3 Query: 435 PXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPPXXXXXG 584 P PPPPP +PPPP PPP P A PP G Sbjct: 1392 PPTAPPPPPPPAFSAAAPPPP--------PPPPPVGGAPGGPPPPPPPAG 1433 Score = 33.1 bits (72), Expect = 8.1 Identities = 17/51 (33%), Positives = 17/51 (33%), Gaps = 6/51 (11%) Frame = +3 Query: 432 PPXGXXPPPP------PXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PP P P PPP PPPPP P PP Sbjct: 1376 PPPPPPPPVPAPFADAPPTAPPPPPPPAFSAAAPPPPPPPPPVGGAPGGPP 1426 >UniRef50_Q8IV90 Cluster: Wiskott-Aldrich syndrome protein family member 4; n=37; Euteleostomi|Rep: Wiskott-Aldrich syndrome protein family member 4 - Homo sapiens (Human) Length = 625 Score = 42.7 bits (96), Expect = 0.010 Identities = 21/53 (39%), Positives = 21/53 (39%), Gaps = 1/53 (1%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXXPPPPPXXXXXXSPPPPXXGG-GXPPPPPXP 536 PP G G PP PPPPP PPP G G PPPP P Sbjct: 429 PPAPPLGSPPSSKPGFAPPPAPPPPPPPMIGIPPPPPPIGFGSPGTPPPPSSP 481 Score = 37.1 bits (82), Expect = 0.50 Identities = 16/46 (34%), Positives = 17/46 (36%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP G P PPPP PPPPPP+ PP Sbjct: 432 PPLGSPPSSKPGFAPPPAPPPPPPPMIGIPPPPPPIGFGSPGTPPP 477 Score = 35.9 bits (79), Expect = 1.1 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP G P PP PP P P PPPP PP Sbjct: 465 PPIGFGSPGTPPPPSSPSFPPHPDFAAPPPLPPPPAADYPTLPPPP 510 Score = 35.9 bits (79), Expect = 1.1 Identities = 15/39 (38%), Positives = 16/39 (41%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PPPP +PPPP PPPPP PP Sbjct: 507 PPPPLSQPTRGAPPPPPPPPPGPPPPPFTGADGQPAVPP 545 Score = 34.3 bits (75), Expect = 3.5 Identities = 15/30 (50%), Positives = 15/30 (50%), Gaps = 2/30 (6%) Frame = +3 Query: 453 PPPPXXXXXXSPPPPXXGG--GXPPPPPXP 536 PPPP PPPP G PPPPP P Sbjct: 496 PPPPAADYPTLPPPPLSQPTRGAPPPPPPP 525 Score = 34.3 bits (75), Expect = 3.5 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PPPP PPPP PPPPP PP Sbjct: 507 PPPPLSQPTRGAPPPPPPPPPGPPPPPFTGADGQPAVPP 545 Score = 33.9 bits (74), Expect = 4.6 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PP P PPPP PPPP A PP Sbjct: 477 PPSSPSFPPHPDFAAPPPLPPPPAADYPTLPPPPLSQPTRGAPPPP 522 Score = 33.1 bits (72), Expect = 8.1 Identities = 17/40 (42%), Positives = 17/40 (42%), Gaps = 5/40 (12%) Frame = +1 Query: 430 PPXGXXXP-PPPPXXXKXXXPPP----PXXGXXXPPPPPP 534 P P PPPP PPP P G PPPPPP Sbjct: 487 PDFAAPPPLPPPPAADYPTLPPPPLSQPTRGAPPPPPPPP 526 Score = 33.1 bits (72), Expect = 8.1 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 P G PPPPP PPPP G P P P Sbjct: 514 PTRGAPPPPPP--PPPGPPPPPFTGADGQPAVPPP 546 >UniRef50_Q03209 Cluster: 61 kDa protein; n=6; Nucleopolyhedrovirus|Rep: 61 kDa protein - Autographa californica nuclear polyhedrosis virus (AcMNPV) Length = 543 Score = 42.7 bits (96), Expect = 0.010 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPPP PPP PPPPPL PP Sbjct: 273 PPSASPPPPPPPPPPPAPPAPPPMVDLSSAPPPPPLVDLPSEMLPP 318 Score = 37.1 bits (82), Expect = 0.50 Identities = 15/39 (38%), Positives = 17/39 (43%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PPPPP +PPP PPPPP + PP Sbjct: 281 PPPPPPPPAPPAPPPMVDLSSAPPPPPLVDLPSEMLPPP 319 Score = 35.9 bits (79), Expect = 1.1 Identities = 16/46 (34%), Positives = 17/46 (36%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 P PPPPP PPP PPPPP + PP Sbjct: 274 PSASPPPPPPPPPPPAPPAPPPMVDLSSAPPPPPLVDLPSEMLPPP 319 >UniRef50_Q0GNC1 Cluster: Inverted formin-2; n=13; Euteleostomi|Rep: Inverted formin-2 - Mus musculus (Mouse) Length = 1273 Score = 42.7 bits (96), Expect = 0.010 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPP 534 P G PPPPP PP P G PPPPPP Sbjct: 462 PGSGTTSPPPPPPPPPPLPPPLPGSGTISPPPPPP 496 Score = 38.7 bits (86), Expect = 0.16 Identities = 18/36 (50%), Positives = 18/36 (50%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPL 537 P G PPPPP PP P G PPPPPPL Sbjct: 484 PGSGTISPPPPPPP-----PPLPGTGAVSPPPPPPL 514 Score = 37.9 bits (84), Expect = 0.28 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 PPPPP PP P G PPPPP P Sbjct: 469 PPPPPPPPPPLPPPLPGSGTISPPPPPPP 497 Score = 37.9 bits (84), Expect = 0.28 Identities = 16/31 (51%), Positives = 16/31 (51%), Gaps = 2/31 (6%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXX--GGGXPPPPPXP 536 PPPPP PPPP G PPPPP P Sbjct: 528 PPPPPLPGMCPVPPPPPLPRAGQIPPPPPLP 558 Score = 36.7 bits (81), Expect = 0.65 Identities = 20/55 (36%), Positives = 20/55 (36%), Gaps = 9/55 (16%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXX---------PPPPXXGXXXPPPPPPLXXXXXAXXPP 567 P G PPPPP PPPP G PPPPPL PP Sbjct: 501 PGTGAVSPPPPPPLPSLPDSHKTQPPPPPPPPLPGMCPVPPPPPLPRAGQIPPPP 555 Score = 35.9 bits (79), Expect = 1.1 Identities = 23/62 (37%), Positives = 23/62 (37%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXX 560 PP G G PP PPP SPPPP PPPPP P A Sbjct: 458 PPPLPGSGTTSPPPPPPPPPPL--PPPLPGSGTISPPPP------PPPPPLPGTGAVSPP 509 Query: 561 PP 566 PP Sbjct: 510 PP 511 Score = 35.5 bits (78), Expect = 1.5 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPP P PPPP PP PPPL PP Sbjct: 451 PPPPPPLPPPLPGSGTTSPPPPPPP---PPPLPPPLPGSGTISPPP 493 Score = 35.5 bits (78), Expect = 1.5 Identities = 17/51 (33%), Positives = 18/51 (35%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPPXXXXXG 584 PP PPP P PPPP PPP P + PP G Sbjct: 452 PPPPPLPPPLPGSGTTSPPPPPPPPPPLPPPLPGSGTISPPPPPPPPPLPG 502 Score = 34.7 bits (76), Expect = 2.6 Identities = 15/30 (50%), Positives = 15/30 (50%), Gaps = 1/30 (3%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXP-PPPPPL 537 PPPPP PPPP PPPPPL Sbjct: 528 PPPPPLPGMCPVPPPPPLPRAGQIPPPPPL 557 Score = 33.5 bits (73), Expect = 6.1 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 PPPPP PP P G PPPPP P Sbjct: 451 PPPPPPLP----PPLPGSGTTSPPPPPPP 475 Score = 33.1 bits (72), Expect = 8.1 Identities = 19/55 (34%), Positives = 19/55 (34%), Gaps = 7/55 (12%) Frame = +3 Query: 423 GXXPPXGXXPPPPPXXXXXXSPPP-------PXXGGGXPPPPPXPXXXAXXXXPP 566 G P PPPP SPPP P PPPPP P PP Sbjct: 487 GTISPPPPPPPPPLPGTGAVSPPPPPPLPSLPDSHKTQPPPPPPPPLPGMCPVPP 541 >UniRef50_Q6P9Q4 Cluster: FH1/FH2 domain-containing protein 1; n=2; Mus musculus|Rep: FH1/FH2 domain-containing protein 1 - Mus musculus (Mouse) Length = 1197 Score = 42.7 bits (96), Expect = 0.010 Identities = 20/46 (43%), Positives = 20/46 (43%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 P PPPPP PPPP G PPPPPPL PP Sbjct: 581 PSLSGGPPPPPP-------PPPPITGSCPPPPPPPLPPPATGSCPP 619 Score = 40.3 bits (90), Expect = 0.053 Identities = 21/52 (40%), Positives = 21/52 (40%), Gaps = 4/52 (7%) Frame = +3 Query: 423 GXXPPXGXXPPPPPXXXXXXSPPPPXXG----GGXPPPPPXPXXXAXXXXPP 566 G PP PPPPP PPPP G PPPPP P PP Sbjct: 585 GGPPPP--PPPPPPITGSCPPPPPPPLPPPATGSCPPPPPPPPPPIIGSCPP 634 Score = 40.3 bits (90), Expect = 0.053 Identities = 19/46 (41%), Positives = 20/46 (43%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPPP PPP G PPPPPP + PP Sbjct: 595 PPITGSCPPPPPPPL-----PPPATGSCPPPPPPPPPPIIGSCPPP 635 Score = 37.1 bits (82), Expect = 0.50 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 P G PPPPP PPP PPPPP P PP Sbjct: 596 PITGSCPPPPPPPL----PPPATGSCPPPPPPPPPPIIGSCPPPP 636 Score = 35.9 bits (79), Expect = 1.1 Identities = 23/67 (34%), Positives = 23/67 (34%) Frame = +1 Query: 337 PXXGGGXPPXGVXSXXXXXXXXXXFXXXXXXPPXGXXXPPPPPXXXKXXXPPPPXXGXXX 516 P GG PP P G PPPPP PPPP G Sbjct: 581 PSLSGGPPPPPPPPPPITGSCPPPPPPPLPPPATGSCPPPPPP-------PPPPIIGSC- 632 Query: 517 PPPPPPL 537 PPPPPL Sbjct: 633 -PPPPPL 638 Score = 35.9 bits (79), Expect = 1.1 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 4/43 (9%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXX----PPPPPPLXXXXXAXXPP 567 PPPPP PPPP PPPPPP PP Sbjct: 592 PPPPPITGSCPPPPPPPLPPPATGSCPPPPPPPPPPIIGSCPP 634 >UniRef50_UPI0000F2C731 Cluster: PREDICTED: hypothetical protein; n=1; Monodelphis domestica|Rep: PREDICTED: hypothetical protein - Monodelphis domestica Length = 443 Score = 42.3 bits (95), Expect = 0.013 Identities = 22/56 (39%), Positives = 22/56 (39%) Frame = -1 Query: 533 GGGGGGXSXPXXGGGGXXXXXXXGGGGGXXXPXGGXXXXXKXXPPPPPPGGXXXTP 366 GGGG G S GGGG GGGGG GG PP P G P Sbjct: 193 GGGGSGGSGGGSGGGGGGGGGGGGGGGGGGGGSGGGAVASLIFPPTPCCSGEQPPP 248 Score = 34.7 bits (76), Expect = 2.6 Identities = 18/48 (37%), Positives = 18/48 (37%) Frame = -2 Query: 535 GXGGGGGXPPPXXGGGGXXFXXXXGGGGGXXPXGGXXPXFXKXXPPPP 392 G GGG G GGGG GGGGG G PP P Sbjct: 192 GGGGGSGGSGGGSGGGGGGGGGGGGGGGGGGGGSGGGAVASLIFPPTP 239 >UniRef50_UPI0000DB6FAC Cluster: PREDICTED: similar to Protein cappuccino; n=1; Apis mellifera|Rep: PREDICTED: similar to Protein cappuccino - Apis mellifera Length = 1007 Score = 42.3 bits (95), Expect = 0.013 Identities = 20/49 (40%), Positives = 20/49 (40%), Gaps = 5/49 (10%) Frame = +3 Query: 435 PXGXXPPPPPXXXXXXSPPPPXX-----GGGXPPPPPXPXXXAXXXXPP 566 P PPPPP PPPP GG PPPPP P PP Sbjct: 453 PLAASPPPPPPPPPPPPPPPPTQSSAAGGGPPPPPPPPPPPTPMIGVPP 501 Score = 40.3 bits (90), Expect = 0.053 Identities = 18/38 (47%), Positives = 18/38 (47%), Gaps = 3/38 (7%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPP---PXXGGGXPPPPPXP 536 P PPPPP PPP GGG PPPPP P Sbjct: 453 PLAASPPPPPPPPPPPPPPPPTQSSAAGGGPPPPPPPP 490 Score = 38.3 bits (85), Expect = 0.21 Identities = 20/46 (43%), Positives = 20/46 (43%), Gaps = 8/46 (17%) Frame = +3 Query: 423 GXXPPXGXXPPPPPXXXXXXSPPPP-----XXGGG---XPPPPPXP 536 G PP PPPPP PPPP GG PPPPP P Sbjct: 480 GGGPPPPPPPPPPPTPMIGVPPPPPPPPPSVFAGGQQQQPPPPPPP 525 Score = 37.1 bits (82), Expect = 0.50 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 6/45 (13%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXX------GXXXPPPPPPLXXXXXAXXPP 567 PPPPP PPPP G PPPPPP PP Sbjct: 458 PPPPPPPPPPPPPPPPTQSSAAGGGPPPPPPPPPPPTPMIGVPPP 502 Score = 37.1 bits (82), Expect = 0.50 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 2/47 (4%) Frame = +3 Query: 432 PPXGXXPPPPP--XXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 463 PPPPPPPPPPPTQSSAAGGGPPPPP----PPPPPPTPMIGVPPPPPP 505 Score = 36.7 bits (81), Expect = 0.65 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = +1 Query: 439 GXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPP 534 G PPPPP PP P G PPPPPP Sbjct: 480 GGGPPPPPPPPP----PPTPMIGVPPPPPPPP 507 Score = 35.1 bits (77), Expect = 2.0 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 3/49 (6%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXK---XXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPPP PPPP PPPPPP PP Sbjct: 461 PPPPPPPPPPPPPTQSSAAGGGPPPP-----PPPPPPPTPMIGVPPPPP 504 Score = 34.7 bits (76), Expect = 2.6 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP G P SPPPP PPPPP A PP Sbjct: 440 PPLGRLSFTLPPSPLAASPPPPPPPPPPPPPPPPTQSSAAGGGPP 484 Score = 34.7 bits (76), Expect = 2.6 Identities = 16/39 (41%), Positives = 17/39 (43%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PPPPP PPPP PPPPP + PP Sbjct: 488 PPPPPPTPMIGVPPPP------PPPPPSVFAGGQQQQPP 520 Score = 33.1 bits (72), Expect = 8.1 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 454 PPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP P PPPP PPPPPP PP Sbjct: 450 PPSPLAASPPPPPPPPP---PPPPPPPTQSSAAGGGPP 484 >UniRef50_UPI0000499326 Cluster: actin binding protein; n=1; Entamoeba histolytica HM-1:IMSS|Rep: actin binding protein - Entamoeba histolytica HM-1:IMSS Length = 986 Score = 42.3 bits (95), Expect = 0.013 Identities = 16/29 (55%), Positives = 16/29 (55%) Frame = +3 Query: 441 GXXPPPPPXXXXXXSPPPPXXGGGXPPPP 527 G PPPPP PPPP G G PPPP Sbjct: 527 GVPPPPPPPGMPGAPPPPPPMGKGMPPPP 555 Score = 39.1 bits (87), Expect = 0.12 Identities = 18/38 (47%), Positives = 18/38 (47%), Gaps = 2/38 (5%) Frame = +3 Query: 423 GXXPPXGXXPPPP--PXXXXXXSPPPPXXGGGXPPPPP 530 G P G PPPP P PPPP G PPPPP Sbjct: 508 GTQPIPGVPPPPPGVPGATGVPPPPPPPGMPGAPPPPP 545 Score = 38.7 bits (86), Expect = 0.16 Identities = 18/43 (41%), Positives = 18/43 (41%), Gaps = 4/43 (9%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXG----GGXPPPPPXPXXXAXXXXPP 566 PPPPP PPP G G PPPPP P PP Sbjct: 503 PPPPPGTQPIPGVPPPPPGVPGATGVPPPPPPPGMPGAPPPPP 545 Score = 38.3 bits (85), Expect = 0.21 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPP 528 PPPPP PPPP G PPPP Sbjct: 530 PPPPPPGMPGAPPPPPPMGKGMPPPP 555 Score = 36.3 bits (80), Expect = 0.86 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = +3 Query: 435 PXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 P PPPPP PPP G P PP P PP Sbjct: 511 PIPGVPPPPPGVPGATGVPPPPPPPGMPGAPPPPPPMGKGMPPP 554 Score = 35.9 bits (79), Expect = 1.1 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPP 534 P G PPP PPPP G PPPPP Sbjct: 511 PIPGVPPPPPGVPGATGVPPPPPPPGMPGAPPPPP 545 Score = 35.9 bits (79), Expect = 1.1 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +1 Query: 433 PXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPL 537 P PPPPP PPPP PPPP L Sbjct: 523 PGATGVPPPPPPPGMPGAPPPPPPMGKGMPPPPGL 557 Score = 34.7 bits (76), Expect = 2.6 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 PPPPP PPPP G PPP P Sbjct: 531 PPPPPGMPGAPPPPPPMGKGMPPPPGLAP 559 Score = 34.3 bits (75), Expect = 3.5 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 3/42 (7%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXP---PPPPPLXXXXXAXXPP 567 PPPPP PPP G PPPPP A PP Sbjct: 503 PPPPPGTQPIPGVPPPPPGVPGATGVPPPPPPPGMPGAPPPP 544 >UniRef50_Q4SIS2 Cluster: Chromosome 21 SCAF14577, whole genome shotgun sequence; n=4; Clupeocephala|Rep: Chromosome 21 SCAF14577, whole genome shotgun sequence - Tetraodon nigroviridis (Green puffer) Length = 1307 Score = 42.3 bits (95), Expect = 0.013 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPP PPPP G PPPPP L PP Sbjct: 849 PPLCIPRFPPPPPMLGSCPPPPPLIGIMRPPPPPLLNAPIPVPPPP 894 Score = 40.3 bits (90), Expect = 0.053 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PPPPP PPPP G PPPPPL PP Sbjct: 846 PPPPPLCIPRFPPPPPMLGSC--PPPPPLIGIMRPPPPP 882 Score = 39.9 bits (89), Expect = 0.070 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPPP 530 PPPPP PPPP G PPPPP Sbjct: 845 PPPPPPLCIPRFPPPPPMLGSCPPPPP 871 Score = 39.9 bits (89), Expect = 0.070 Identities = 17/36 (47%), Positives = 17/36 (47%), Gaps = 1/36 (2%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXP-PPPPXP 536 P G PPPPP PPPP P PPPP P Sbjct: 861 PMLGSCPPPPPLIGIMRPPPPPLLNAPIPVPPPPEP 896 Score = 37.9 bits (84), Expect = 0.28 Identities = 22/56 (39%), Positives = 22/56 (39%), Gaps = 8/56 (14%) Frame = +3 Query: 423 GXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPP--------PXPXXXAXXXXPP 566 G PP PPPPP PPPP G PPPP P P A PP Sbjct: 841 GDLPP----PPPPPLCIPRFPPPPPMLGSCPPPPPLIGIMRPPPPPLLNAPIPVPP 892 Score = 37.5 bits (83), Expect = 0.37 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +1 Query: 439 GXXXPPPPPXXXKXXXPPPPXXGXXXPPPPP 531 G PPPPP PPPP PPPPP Sbjct: 841 GDLPPPPPPPLCIPRFPPPPPMLGSCPPPPP 871 >UniRef50_Q62CV6 Cluster: Hemagglutinin domain protein; n=8; Burkholderia|Rep: Hemagglutinin domain protein - Burkholderia mallei (Pseudomonas mallei) Length = 373 Score = 42.3 bits (95), Expect = 0.013 Identities = 20/47 (42%), Positives = 20/47 (42%), Gaps = 2/47 (4%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPP--PPXPXXXAXXXXPP 566 PP PPPPP SPPPP PPP PP P PP Sbjct: 91 PPPPPPPPPPPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPTTTPP 137 Score = 40.7 bits (91), Expect = 0.040 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPP 534 PP PPPPP PPPP PPPP P Sbjct: 90 PPPPPPPPPPPPPPPPPPSPPPPSPPPPSPPPPSP 124 Score = 39.1 bits (87), Expect = 0.12 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +1 Query: 433 PXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 P PPPPP PPPP PPPP P PP Sbjct: 86 PNKVPPPPPPPPPPPPPPPPPPSPPPPSPPPPSPPPPSPPPPSPP 130 Score = 39.1 bits (87), Expect = 0.12 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPPP PP P PP PPP PP Sbjct: 92 PPPPPPPPPPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPTTTPP 137 Score = 33.9 bits (74), Expect = 4.6 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PPPPP PPPP PP PP P PP Sbjct: 90 PPPPPPPPPPPPPPPP------PPSPPPPSPPPPSPPPP 122 >UniRef50_A1UKQ7 Cluster: Putative uncharacterized protein; n=3; Mycobacterium|Rep: Putative uncharacterized protein - Mycobacterium sp. (strain KMS) Length = 317 Score = 42.3 bits (95), Expect = 0.013 Identities = 19/38 (50%), Positives = 19/38 (50%), Gaps = 5/38 (13%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSP-----PPPXXGGGXPPPPP 530 PP G PPPPP P PPP GG PPPPP Sbjct: 15 PPQGGYPPPPPPGGYPPPPTQGGYPPPHPGGYPPPPPP 52 Score = 36.7 bits (81), Expect = 0.65 Identities = 15/24 (62%), Positives = 15/24 (62%), Gaps = 1/24 (4%) Frame = -1 Query: 404 PPPPPPGGXXXTP-XGGXPPPXXG 336 PPPPPPGG P GG PPP G Sbjct: 21 PPPPPPGGYPPPPTQGGYPPPHPG 44 Score = 36.7 bits (81), Expect = 0.65 Identities = 17/36 (47%), Positives = 17/36 (47%), Gaps = 5/36 (13%) Frame = +3 Query: 432 PPXGXXPPP-----PPXXXXXXSPPPPXXGGGXPPP 524 PP G PPP PP PPPP GG PPP Sbjct: 25 PPGGYPPPPTQGGYPPPHPGGYPPPPPPQGGYPPPP 60 Score = 36.3 bits (80), Expect = 0.86 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 5/39 (12%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXP-----PPPXXGXXXPPPPP 531 PP PPPPP P PPP G PPPPP Sbjct: 14 PPPQGGYPPPPPPGGYPPPPTQGGYPPPHPGGYPPPPPP 52 Score = 34.7 bits (76), Expect = 2.6 Identities = 19/49 (38%), Positives = 19/49 (38%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPP 527 PP GG G PP PPP PPPP G PPPP Sbjct: 14 PPPQGGYPPPPPPGGYPPPPTQGGYPPPHPGGYPPPPPPQG--GYPPPP 60 Score = 34.3 bits (75), Expect = 3.5 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPPP 530 PPPPP PPP GG PPPPP Sbjct: 5 PPPPPGNY-----PPPPQGGYPPPPPP 26 Score = 34.3 bits (75), Expect = 3.5 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -1 Query: 401 PPPPPGGXXXTPXGGXPPP 345 PPPPPG P GG PPP Sbjct: 5 PPPPPGNYPPPPQGGYPPP 23 Score = 33.9 bits (74), Expect = 4.6 Identities = 19/50 (38%), Positives = 19/50 (38%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPP 530 PP G G PP PPP PP P GG PPPPP Sbjct: 5 PPPPPGNYPPPPQGGYPPPPPPGGYPPPPTQGGYPPPHP---GGYPPPPP 51 >UniRef50_Q9SXE7 Cluster: T3P18.6; n=2; core eudicotyledons|Rep: T3P18.6 - Arabidopsis thaliana (Mouse-ear cress) Length = 297 Score = 42.3 bits (95), Expect = 0.013 Identities = 26/69 (37%), Positives = 26/69 (37%), Gaps = 4/69 (5%) Frame = -2 Query: 583 PXXXXXGGXXXXAXXXGXGGGGGXPPPXXG-GGGXXFXXXXGGGGGXXPXGGXXPXFXKX 407 P GG G GGG PPP G GGG GGGGG P P Sbjct: 41 PQHGGGGGGGSKPPPHHGGKGGGKPPPHGGKGGGPPHHGGGGGGGGKSPPVVRPPPVVVR 100 Query: 406 XPP---PPP 389 PP PPP Sbjct: 101 PPPIIRPPP 109 Score = 39.5 bits (88), Expect = 0.093 Identities = 24/64 (37%), Positives = 24/64 (37%), Gaps = 1/64 (1%) Frame = -1 Query: 533 GGGGGGXSXPXXGG-GGXXXXXXXGGGGGXXXPXGGXXXXXKXXPPPPPPGGXXXTPXGG 357 GGGGG P GG GG G GGG GG K P PP P Sbjct: 46 GGGGGSKPPPHHGGKGGGKPPPHGGKGGGPPHHGGGGGGGGKSPPVVRPPPVVVRPPPII 105 Query: 356 XPPP 345 PPP Sbjct: 106 RPPP 109 Score = 38.3 bits (85), Expect = 0.21 Identities = 25/75 (33%), Positives = 26/75 (34%), Gaps = 1/75 (1%) Frame = -1 Query: 566 GGXXAXXXXXRGGGGGGXSXPXXG-GGGXXXXXXXGGGGGXXXPXGGXXXXXKXXPPPPP 390 GG + GG GGG P G GGG GGGGG P PP Sbjct: 47 GGGGSKPPPHHGGKGGGKPPPHGGKGGGPPHHGGGGGGGGKSPPVVRPPPVVVRPPPIIR 106 Query: 389 PGGXXXTPXGGXPPP 345 P P PPP Sbjct: 107 PPPVVYPPPIVRPPP 121 >UniRef50_Q01AC1 Cluster: Meltrins, fertilins and related Zn-dependent metalloproteinases of the ADAMs family; n=2; Ostreococcus tauri|Rep: Meltrins, fertilins and related Zn-dependent metalloproteinases of the ADAMs family - Ostreococcus tauri Length = 872 Score = 42.3 bits (95), Expect = 0.013 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPP P PPPP PPPPP A PP Sbjct: 517 PPSPPPSPPPSPPPPSPPSPPPPSPSPPPSPPPPPSPPPGSAARPP 562 Score = 42.3 bits (95), Expect = 0.013 Identities = 18/44 (40%), Positives = 19/44 (43%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXP 563 PP P PPP SPPPP PPPPP P + P Sbjct: 561 PPSPPPPSPPPPSPPPPSPPPPPSPPPSPPPPPSPPPPSPPPPP 604 Score = 39.9 bits (89), Expect = 0.070 Identities = 22/63 (34%), Positives = 22/63 (34%), Gaps = 1/63 (1%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXXPP-PPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXX 557 PP G PP PP PPP SPPPP PP PP P Sbjct: 553 PPPGSAARPPSPPPPSPPPPSPPPPSPPPPPSPPPSPPPPP--SPPPPSPPPPPVVVVPS 610 Query: 558 XPP 566 PP Sbjct: 611 SPP 613 Score = 39.1 bits (87), Expect = 0.12 Identities = 16/45 (35%), Positives = 18/45 (40%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXP 564 PP P PPP PPPP PPPPP+ + P Sbjct: 570 PPPSPPPPSPPPPPSPPPSPPPPPSPPPPSPPPPPVVVVPSSPPP 614 Score = 37.5 bits (83), Expect = 0.37 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP P PPP PP P PPPP P PP Sbjct: 507 PPPSPPPSPPPPSPPPSPPPSPPPPSPPSPPPPSPSPPPSPPPPP 551 Score = 37.5 bits (83), Expect = 0.37 Identities = 18/49 (36%), Positives = 18/49 (36%), Gaps = 4/49 (8%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXX----GGGXPPPPPXPXXXAXXXXPP 566 PP PPPP SPPPP PP PP P PP Sbjct: 529 PPPSPPSPPPPSPSPPPSPPPPPSPPPGSAARPPSPPPPSPPPPSPPPP 577 Score = 37.5 bits (83), Expect = 0.37 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPP P PP P PP PP P PP Sbjct: 543 PPPSPPPPPSPPPGSAARPPSPPPPSPPPPSPPPPSPPPPPSPPP 587 Score = 37.5 bits (83), Expect = 0.37 Identities = 16/46 (34%), Positives = 17/46 (36%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP G PP P P PP PP PPP + PP Sbjct: 553 PPPGSAARPPSPPPPSPPPPSPPPPSPPPPPSPPPSPPPPPSPPPP 598 Score = 37.5 bits (83), Expect = 0.37 Identities = 16/46 (34%), Positives = 17/46 (36%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PP PP PPP P PPPP + PP Sbjct: 569 PPPPSPPPPSPPPPPSPPPSPPPPPSPPPPSPPPPPVVVVPSSPPP 614 Score = 36.7 bits (81), Expect = 0.65 Identities = 16/44 (36%), Positives = 17/44 (38%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXP 563 PP PP PP SPPP PP PP P + P Sbjct: 502 PPSPSPPPSPPPSPPPPSPPPSPPPSPPPPSPPSPPPPSPSPPP 545 Score = 36.7 bits (81), Expect = 0.65 Identities = 18/47 (38%), Positives = 19/47 (40%), Gaps = 2/47 (4%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXX--SPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PP PP SPPPP PPPP P + PP Sbjct: 544 PPSPPPPPSPPPGSAARPPSPPPPSPPPPSPPPPSPPPPPSPPPSPP 590 Score = 35.9 bits (79), Expect = 1.1 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 1/36 (2%) Frame = +3 Query: 432 PPXGXXPPPP-PXXXXXXSPPPPXXGGGXPPPPPXP 536 PP PP P P SPPPP PP PP P Sbjct: 496 PPVSSPPPSPSPPPSPPPSPPPPSPPPSPPPSPPPP 531 Score = 35.9 bits (79), Expect = 1.1 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = +3 Query: 435 PXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 P PPP P SPPPP PP P P PP Sbjct: 511 PPPSPPPPSPPPSPPPSPPPPSPPSPPPPSPSPPPSPPPPPSPP 554 Score = 35.1 bits (77), Expect = 2.0 Identities = 17/48 (35%), Positives = 18/48 (37%), Gaps = 2/48 (4%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPP--PXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPP P PPP P PP PPP + PP Sbjct: 530 PPSPPSPPPPSPSPPPSPPPPPSPPPGSAARPPSPPPPSPPPPSPPPP 577 Score = 34.3 bits (75), Expect = 3.5 Identities = 17/47 (36%), Positives = 17/47 (36%), Gaps = 1/47 (2%) Frame = +1 Query: 430 PPXGXXXPPPP-PXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPP P PPPP PP P P PP Sbjct: 508 PPSPPPSPPPPSPPPSPPPSPPPPSPPSPPPPSPSPPPSPPPPPSPP 554 Score = 34.3 bits (75), Expect = 3.5 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +3 Query: 435 PXGXXPPPPPXXXXXXSPPPPXXGGGXPPPP 527 P PPPPP SPPP PPPP Sbjct: 595 PPPPSPPPPPVVVVPSSPPPVLVNDMYPPPP 625 Score = 33.9 bits (74), Expect = 4.6 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = +3 Query: 435 PXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 P PPP P SP PP PPP P P A PP Sbjct: 524 PPPSPPPPSPPSPPPPSPSPPP--SPPPPPSPPPGSAARPPSPP 565 Score = 33.1 bits (72), Expect = 8.1 Identities = 15/45 (33%), Positives = 15/45 (33%) Frame = +1 Query: 433 PXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 P PPP P PPP PPP PP PP Sbjct: 501 PPPSPSPPPSPPPSPPPPSPPPSPPPSPPPPSPPSPPPPSPSPPP 545 Score = 33.1 bits (72), Expect = 8.1 Identities = 15/45 (33%), Positives = 15/45 (33%) Frame = +1 Query: 433 PXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 P PPP P PPP PP PPP PP Sbjct: 505 PSPPPSPPPSPPPPSPPPSPPPSPPPPSPPSPPPPSPSPPPSPPP 549 Score = 33.1 bits (72), Expect = 8.1 Identities = 15/45 (33%), Positives = 15/45 (33%) Frame = +1 Query: 433 PXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 P PPP P PP P PP PPP PP Sbjct: 543 PPPSPPPPPSPPPGSAARPPSPPPPSPPPPSPPPPSPPPPPSPPP 587 Score = 33.1 bits (72), Expect = 8.1 Identities = 15/46 (32%), Positives = 16/46 (34%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP P PPP PPP P PPP+ PP Sbjct: 580 PPPPSPPPSPPPPPSPPPPSPPPPPVVVVPSSPPPVLVNDMYPPPP 625 >UniRef50_A7RXK9 Cluster: Predicted protein; n=2; Nematostella vectensis|Rep: Predicted protein - Nematostella vectensis Length = 534 Score = 42.3 bits (95), Expect = 0.013 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPP 531 PP PPPPP PPP G PPPPP Sbjct: 318 PPPSRGAPPPPPSRGSAPPPPPARMGTAPPPPPP 351 Score = 42.3 bits (95), Expect = 0.013 Identities = 19/45 (42%), Positives = 21/45 (46%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP +PPPP G PPPP P + PP Sbjct: 319 PPSRGAPPPPPSRGS--APPPPPARMGTAPPPPPPSRSSQRPPPP 361 Score = 42.3 bits (95), Expect = 0.013 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = +3 Query: 423 GXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPP 530 G PP PPP PPPP GG PPPPP Sbjct: 364 GAPPPPSMGMAPPPVGGAAPPPPPPPPVGGPPPPPP 399 Score = 40.7 bits (91), Expect = 0.040 Identities = 19/45 (42%), Positives = 20/45 (44%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPP +PPPP G PPPPP A PP Sbjct: 310 PPSRGAAPPPPSRG---APPPPPSRGSAPPPPPARMGTAPPPPPP 351 Score = 40.3 bits (90), Expect = 0.053 Identities = 25/70 (35%), Positives = 25/70 (35%), Gaps = 9/70 (12%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPX--GXXPPPPPXXXXXXSPPP-------PXXGGGXPPPPPX 533 PP G G PP G PPPPP PPP P G PPPPP Sbjct: 358 PPPPSRGAPPPPSMGMAPPPVGGAAPPPPPPPPVGGPPPPPPPIEGRPPSSLGNPPPPPP 417 Query: 534 PXXXAXXXXP 563 P A P Sbjct: 418 PGRGAPPPGP 427 Score = 39.9 bits (89), Expect = 0.070 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPP PPP G PPPPP P PP Sbjct: 359 PPPSRGAPPPPSMGMA---PPPVGGAAPPPPPPPPVGGPPPPPPP 400 Score = 39.5 bits (88), Expect = 0.093 Identities = 27/78 (34%), Positives = 27/78 (34%), Gaps = 10/78 (12%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPX-----GXXPPPPPXXXXXXSPPPPXXGGGXPPPP-----P 530 PP G G PP G PPPPP PPPP G PPPP P Sbjct: 318 PPPSRGAPPPPPSRGSAPPPPPARMGTAPPPPPPSRSSQRPPPPSRGA--PPPPSMGMAP 375 Query: 531 XPXXXAXXXXPPXXXXXG 584 P A PP G Sbjct: 376 PPVGGAAPPPPPPPPVGG 393 Score = 38.3 bits (85), Expect = 0.21 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPP 531 PP PPP PPPP G PPPPP Sbjct: 367 PPPSMGMAPPPVGGAAPPPPPPPPVGGPPPPPPP 400 Score = 35.9 bits (79), Expect = 1.1 Identities = 15/33 (45%), Positives = 16/33 (48%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPP 528 PP PPPP + PPPP G PPPP Sbjct: 309 PPPSRGAAPPPPS--RGAPPPPPSRGSAPPPPP 339 Score = 35.9 bits (79), Expect = 1.1 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 2/52 (3%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXX--PPPPPXXXXXXSPPPPXXGGGXPPPPP 530 PP G PP PPPPP PPPP PPPP Sbjct: 310 PPSRGAAPPPPSRGAPPPPPSRGSAPPPPPARMGTAPPPPPPSRSSQRPPPP 361 Score = 35.5 bits (78), Expect = 1.5 Identities = 19/45 (42%), Positives = 20/45 (44%), Gaps = 6/45 (13%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPP------PPPPLXXXXXAXXPP 567 PPPPP + PPPP G PP PPPP A PP Sbjct: 307 PPPPPS--RGAAPPPPSRGAPPPPPSRGSAPPPPPARMGTAPPPP 349 Score = 35.5 bits (78), Expect = 1.5 Identities = 16/40 (40%), Positives = 18/40 (45%), Gaps = 4/40 (10%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXX----PPPPXXGXXXPPPPPPL 537 PP G PPPPP + PPPP PPP P+ Sbjct: 389 PPVGGPPPPPPPIEGRPPSSLGNPPPPPPPGRGAPPPGPM 428 >UniRef50_A7RW05 Cluster: Predicted protein; n=1; Nematostella vectensis|Rep: Predicted protein - Nematostella vectensis Length = 994 Score = 42.3 bits (95), Expect = 0.013 Identities = 21/50 (42%), Positives = 21/50 (42%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPP 530 PP G G G G PP PPP PPPP G G PPPP Sbjct: 589 PPPGAGQGW-----GQPPPGAGQGGPPPPGAGQEGPPPPGAGQGGGPPPP 633 Score = 40.7 bits (91), Expect = 0.040 Identities = 20/62 (32%), Positives = 21/62 (33%) Frame = +1 Query: 346 GGGXPPXGVXSXXXXXXXXXXFXXXXXXPPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPP 525 GGG PP G P G PPPP + PPPP G P Sbjct: 530 GGGPPPPGAGQGGGPPPPGAGQGWGQPPPGAGQGGGPPPPGAGQGGGPPPPGAGQGWGQP 589 Query: 526 PP 531 PP Sbjct: 590 PP 591 Score = 39.5 bits (88), Expect = 0.093 Identities = 23/62 (37%), Positives = 24/62 (38%) Frame = -2 Query: 565 GGXXXXAXXXGXGGGGGXPPPXXGGGGXXFXXXXGGGGGXXPXGGXXPXFXKXXPPPPPR 386 GG G G GGG PPP G GG G G G P G + PPPP Sbjct: 516 GGQGWGQPPPGAGQGGGPPPPGAGQGGGPPPPGAGQGWGQPPPGA-----GQGGGPPPPG 570 Query: 385 GG 380 G Sbjct: 571 AG 572 Score = 39.5 bits (88), Expect = 0.093 Identities = 22/58 (37%), Positives = 22/58 (37%), Gaps = 8/58 (13%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXXPP--------PPPXXXXXXSPPPPXXGGGXPPPPP 530 PP G G G G G PP PPP PPPP G G PPPP Sbjct: 523 PPPGAGQGGGPPPPGAGQGGGPPPPGAGQGWGQPPPGAGQGGGPPPPGAGQGGGPPPP 580 Score = 39.5 bits (88), Expect = 0.093 Identities = 21/62 (33%), Positives = 22/62 (35%) Frame = +1 Query: 346 GGGXPPXGVXSXXXXXXXXXXFXXXXXXPPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPP 525 GGG PP G P G PPPP + PPPP G PP Sbjct: 574 GGGPPPPGAGQGWGQPPPGAGQGWGQPPPGAGQGGPPPPGAGQEG--PPPPGAGQGGGPP 631 Query: 526 PP 531 PP Sbjct: 632 PP 633 Score = 39.5 bits (88), Expect = 0.093 Identities = 22/51 (43%), Positives = 22/51 (43%), Gaps = 1/51 (1%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPX-GXXPPPPPXXXXXXSPPPPXXGGGXPPPPP 530 PP G G G G PP G PPPP PPPP G G PPP Sbjct: 600 PPPGAGQG------GPPPPGAGQEGPPPPGAGQGGGPPPPGAGQGWGLPPP 644 Score = 38.3 bits (85), Expect = 0.21 Identities = 25/72 (34%), Positives = 25/72 (34%), Gaps = 7/72 (9%) Frame = -1 Query: 530 GGGGGXSXPXXGGGGXXXXXXXGGGGGXXXPXGGXXXXXKXXPP-------PPPPGGXXX 372 GGG G P G G G G G P G PP PPPPG Sbjct: 515 GGGQGWGQPPPGAGQGGGPPPPGAGQGGGPPPPGAGQGWGQPPPGAGQGGGPPPPGAG-- 572 Query: 371 TPXGGXPPPXXG 336 GG PPP G Sbjct: 573 -QGGGPPPPGAG 583 Score = 37.5 bits (83), Expect = 0.37 Identities = 19/62 (30%), Positives = 20/62 (32%) Frame = +1 Query: 346 GGGXPPXGVXSXXXXXXXXXXFXXXXXXPPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPP 525 G G PP G P G PPP + PPPP G PP Sbjct: 519 GWGQPPPGAGQGGGPPPPGAGQGGGPPPPGAGQGWGQPPPGAGQGGGPPPPGAGQGGGPP 578 Query: 526 PP 531 PP Sbjct: 579 PP 580 Score = 37.5 bits (83), Expect = 0.37 Identities = 19/62 (30%), Positives = 20/62 (32%) Frame = +1 Query: 346 GGGXPPXGVXSXXXXXXXXXXFXXXXXXPPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPP 525 GGG PP G P G PPPP + PPP G P Sbjct: 541 GGGPPPPGAGQGWGQPPPGAGQGGGPPPPGAGQGGGPPPPGAGQGWGQPPPGAGQGWGQP 600 Query: 526 PP 531 PP Sbjct: 601 PP 602 Score = 37.5 bits (83), Expect = 0.37 Identities = 21/52 (40%), Positives = 21/52 (40%), Gaps = 2/52 (3%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXX--PPPPPXXXXXXSPPPPXXGGGXPPPPP 530 PP G G G G PP PPPP PPPP G G PPP Sbjct: 545 PPPGAGQGW-----GQPPPGAGQGGGPPPPGAGQGGGPPPPGAGQGWGQPPP 591 Score = 37.1 bits (82), Expect = 0.50 Identities = 22/56 (39%), Positives = 22/56 (39%), Gaps = 4/56 (7%) Frame = -2 Query: 535 GXGGGGGXPPPXXGGGGXXFXXXXGGGGGXXP----XGGXXPXFXKXXPPPPPRGG 380 G G GGG PPP G G G G G P GG P PPPP G Sbjct: 570 GAGQGGGPPPPGAGQGWGQPPPGAGQGWGQPPPGAGQGGPPPPGAGQEGPPPPGAG 625 Score = 35.1 bits (77), Expect = 2.0 Identities = 19/47 (40%), Positives = 20/47 (42%), Gaps = 2/47 (4%) Frame = +3 Query: 396 GGGXXFXXXGXXPPXGXX--PPPPPXXXXXXSPPPPXXGGGXPPPPP 530 GGG + G PP PPPP PPPP G G PPP Sbjct: 515 GGGQGW---GQPPPGAGQGGGPPPPGAGQGGGPPPPGAGQGWGQPPP 558 Score = 35.1 bits (77), Expect = 2.0 Identities = 25/78 (32%), Positives = 25/78 (32%), Gaps = 13/78 (16%) Frame = -1 Query: 530 GGGGGXSXPXXGGGGXXXXXXXGGGGGXXXPXGGXXXXXKXXPP------PPPPGGXXXT 369 G G G P G G G G G P G PP PPPPG Sbjct: 559 GAGQGGGPPPPGAGQGGGPPPPGAGQGWGQPPPGAGQGWGQPPPGAGQGGPPPPGAGQEG 618 Query: 368 P-------XGGXPPPXXG 336 P GG PPP G Sbjct: 619 PPPPGAGQGGGPPPPGAG 636 Score = 34.7 bits (76), Expect = 2.6 Identities = 20/52 (38%), Positives = 21/52 (40%) Frame = -2 Query: 535 GXGGGGGXPPPXXGGGGXXFXXXXGGGGGXXPXGGXXPXFXKXXPPPPPRGG 380 G G G G PPP G GG G GGG P G + PPP G Sbjct: 548 GAGQGWGQPPPGAGQGGGPPPPGAGQGGGPPPPGA-----GQGWGQPPPGAG 594 Score = 34.7 bits (76), Expect = 2.6 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPP 531 PP PPPP + PPPP G PPP Sbjct: 611 PPGAGQEGPPPPGAGQGGGPPPPGAGQGWGLPPP 644 Score = 34.3 bits (75), Expect = 3.5 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPP 531 P G PPP + PPPP G PPPP Sbjct: 514 PGGGQGWGQPPPGAGQGGGPPPPGAGQGGGPPPP 547 Score = 34.3 bits (75), Expect = 3.5 Identities = 27/103 (26%), Positives = 28/103 (27%) Frame = +2 Query: 260 GXPXPPXGGGGGXFXFGGXXXXXFFXPXXGGGXPPXXXXXXXXXXXXXXXFXKXXXXPPX 439 G P P G G G G P G G P + PP Sbjct: 543 GPPPPGAGQGWGQPPPGAGQGGGPPPPGAGQGGGPPPPGAGQGWGQPPPGAGQGWGQPPP 602 Query: 440 GXXXPPPPXXXXKXXXPPPXXXGXXXPPPPXPXXXXXXXXPPP 568 G PP PPP G PPP P PPP Sbjct: 603 GAGQGGPPPPGAGQEGPPPPGAGQGGGPPP-PGAGQGWGLPPP 644 >UniRef50_A0E1N2 Cluster: Chromosome undetermined scaffold_73, whole genome shotgun sequence; n=2; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_73, whole genome shotgun sequence - Paramecium tetraurelia Length = 442 Score = 42.3 bits (95), Expect = 0.013 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPPP PPP PPPPPP PP Sbjct: 124 PPVQNLPPPPPPPQQNVLPPPPKPQQNVMPPPPPPPQQNVMPPPPP 169 Score = 41.9 bits (94), Expect = 0.017 Identities = 18/46 (39%), Positives = 19/46 (41%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPPP + PPPP PPPPP PP Sbjct: 123 PPPVQNLPPPPPPPQQNVLPPPPKPQQNVMPPPPPPPQQNVMPPPP 168 Score = 39.5 bits (88), Expect = 0.093 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPP PPPP PPPP P PP Sbjct: 113 PPPKPASQPPPPPVQNLPPPPPPPQQNVLPPPPKPQQNVMPPPPPP 158 Score = 39.5 bits (88), Expect = 0.093 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPPP PPPP PPP P PP Sbjct: 114 PPKPASQPPPPPVQNLPPPPPPPQQNVLPPPPKPQQNVMPPPPPPP 159 Score = 37.9 bits (84), Expect = 0.28 Identities = 16/29 (55%), Positives = 16/29 (55%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 PPPPP PPPP G PPPPP P Sbjct: 74 PPPPPPP-----PPPPPPKGAPPPPPPRP 97 Score = 37.5 bits (83), Expect = 0.37 Identities = 19/52 (36%), Positives = 20/52 (38%), Gaps = 7/52 (13%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGG-------GXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP G PP PP P + PP Sbjct: 74 PPPPPPPPPPPPPKGAPPPPPPRPPGPPAAKPTSNPPNPPPPKPASQPPPPP 125 Score = 37.1 bits (82), Expect = 0.50 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPP 534 PP PP PPPP PPPPPP Sbjct: 109 PPNPPPPKPASQPPPPPVQNLPPPPPPP 136 Score = 35.9 bits (79), Expect = 1.1 Identities = 16/38 (42%), Positives = 17/38 (44%), Gaps = 2/38 (5%) Frame = +3 Query: 423 GXXPPXGXXPPPPPXXXXXXSP--PPPXXGGGXPPPPP 530 G PP PP PP +P PPP PPPPP Sbjct: 88 GAPPPPPPRPPGPPAAKPTSNPPNPPPPKPASQPPPPP 125 Score = 35.5 bits (78), Expect = 1.5 Identities = 17/47 (36%), Positives = 18/47 (38%), Gaps = 1/47 (2%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPP-PPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PP PP PP PP PPPPP+ PP Sbjct: 90 PPPPPPRPPGPPAAKPTSNPPNPPPPKPASQPPPPPVQNLPPPPPPP 136 Score = 35.5 bits (78), Expect = 1.5 Identities = 16/37 (43%), Positives = 17/37 (45%), Gaps = 2/37 (5%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXK--XXXPPPPXXGXXXPPPPPP 534 PP PPPP + PPPP PPPPPP Sbjct: 134 PPPQQNVLPPPPKPQQNVMPPPPPPPQQNVMPPPPPP 170 Score = 35.1 bits (77), Expect = 2.0 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 435 PXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPP 530 P P PPP PPPP PPPPP Sbjct: 105 PTSNPPNPPPPKPASQPPPPPVQNLPPPPPPP 136 >UniRef50_Q6CDQ5 Cluster: Similarity; n=2; Saccharomycetales|Rep: Similarity - Yarrowia lipolytica (Candida lipolytica) Length = 664 Score = 42.3 bits (95), Expect = 0.013 Identities = 20/48 (41%), Positives = 20/48 (41%) Frame = +3 Query: 423 GXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 G P G PPPP PPP GG PPPPP P PP Sbjct: 532 GAAPSFGSAAPPPPPG------PPPAMSGGPPPPPPPPGDFGVTPGPP 573 Score = 39.5 bits (88), Expect = 0.093 Identities = 21/56 (37%), Positives = 21/56 (37%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXA 548 PP G F PP G PPP PPPP G P PPP P A Sbjct: 527 PPPPPGAAPSFGSAAPPPPPG--PPPAMSGGPPPPPPPPGDFGVTPGPPPPPTGDA 580 Score = 39.1 bits (87), Expect = 0.12 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = +3 Query: 435 PXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXA 548 P G PPPPP P P GG PPPPP P A Sbjct: 501 PGGVPPPPPPPPPG----PGPAAAGGPPPPPPPPPGAA 534 Score = 38.3 bits (85), Expect = 0.21 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 PPPPP P P GG PPPPP P Sbjct: 484 PPPPPPPPASSRPVPGVPGGVPPPPPPPP 512 Score = 38.3 bits (85), Expect = 0.21 Identities = 21/63 (33%), Positives = 21/63 (33%), Gaps = 9/63 (14%) Frame = +3 Query: 423 GXXPPXGXXPPPPPXXXXXXSPPP---------PXXGGGXPPPPPXPXXXAXXXXPPXXX 575 G PP PPP P PPP P G PPPPP P PP Sbjct: 502 GGVPPPPPPPPPGPGPAAAGGPPPPPPPPPGAAPSFGSAAPPPPPGPPPAMSGGPPPPPP 561 Query: 576 XXG 584 G Sbjct: 562 PPG 564 Score = 36.7 bits (81), Expect = 0.65 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = +2 Query: 431 PPXGXXXPPPPXXXXKXXXPPPXXXGXXXPPPPXPXXXXXXXXPPP 568 P G PPPP PPP G PPPP P PPP Sbjct: 535 PSFGSAAPPPPPG------PPPAMSGGPPPPPPPPGDFGVTPGPPP 574 Score = 36.3 bits (80), Expect = 0.86 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PPPPP P P PPPPPP A PP Sbjct: 486 PPPPPPASSRPVPGVPGGVPPPPPPPPPGPGPAAAGGPP 524 Score = 33.9 bits (74), Expect = 4.6 Identities = 16/41 (39%), Positives = 16/41 (39%), Gaps = 3/41 (7%) Frame = +3 Query: 423 GXXPPXGXXPPPPP---XXXXXXSPPPPXXGGGXPPPPPXP 536 G P G PPPPP PPPP PPP P Sbjct: 421 GGTPAAGGPPPPPPPRDGATPLSRPPPPPSRSAIPPPAAAP 461 Score = 33.5 bits (73), Expect = 6.1 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -1 Query: 404 PPPPPPGGXXXTPXGGXPPP 345 PPPPPP G GG PPP Sbjct: 507 PPPPPPPGPGPAAAGGPPPP 526 >UniRef50_A7EUH8 Cluster: Putative uncharacterized protein; n=1; Sclerotinia sclerotiorum 1980|Rep: Putative uncharacterized protein - Sclerotinia sclerotiorum 1980 Length = 1723 Score = 42.3 bits (95), Expect = 0.013 Identities = 17/39 (43%), Positives = 18/39 (46%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PPPPP +P P GG PPPPP P PP Sbjct: 1008 PPPPPPPPGMNAPVAPGFGGPPPPPPPPPPPGMPGMPPP 1046 Score = 39.5 bits (88), Expect = 0.093 Identities = 18/35 (51%), Positives = 18/35 (51%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 P G PPPPP PPPP G PPPPP P Sbjct: 1023 PGFGGPPPPPP------PPPPPGMPGMPPPPPPPP 1051 Score = 38.3 bits (85), Expect = 0.21 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PPPPP P P G PPPPPP PP Sbjct: 1008 PPPPPPPPGMNAPVAPGFGGPPPPPPPPPPPGMPGMPPP 1046 Score = 37.9 bits (84), Expect = 0.28 Identities = 21/52 (40%), Positives = 21/52 (40%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 PP G G PP PPPPP PPPP PPPPP P Sbjct: 1012 PPPPGMNAPVAPGFGGPPPP---PPPPPPPGMPGMPPPP------PPPPPPP 1054 Score = 36.3 bits (80), Expect = 0.86 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = +1 Query: 439 GXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPP 534 G PPPPP PPPP PPPPPP Sbjct: 1024 GFGGPPPPP-----PPPPPPGMPGMPPPPPPP 1050 Score = 34.7 bits (76), Expect = 2.6 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PPPPP P G PPPPPP PP Sbjct: 1009 PPPPPPPGMNAPVAPGFGGPPPPPPPPPPPGMPGMPPPP 1047 >UniRef50_A7ER22 Cluster: Predicted protein; n=1; Sclerotinia sclerotiorum 1980|Rep: Predicted protein - Sclerotinia sclerotiorum 1980 Length = 420 Score = 42.3 bits (95), Expect = 0.013 Identities = 16/34 (47%), Positives = 17/34 (50%) Frame = +3 Query: 435 PXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 P PPPPP +PPPP PPPPP P Sbjct: 117 PTAPPPPPPPPFSFPPAPPPPPPPFSFPPPPPLP 150 Score = 35.1 bits (77), Expect = 2.0 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPPL 537 PPPPP PPP PPPPPL Sbjct: 121 PPPPPPPFSFPPAPPPPPPPFSFPPPPPL 149 >UniRef50_A6QTR5 Cluster: Adenylyl cyclase-associated protein; n=1; Ajellomyces capsulatus NAm1|Rep: Adenylyl cyclase-associated protein - Ajellomyces capsulatus NAm1 Length = 500 Score = 42.3 bits (95), Expect = 0.013 Identities = 22/51 (43%), Positives = 22/51 (43%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPPXXXXXG 584 P PPPPP PPPP G G PPPPP P A PP G Sbjct: 223 PTGSTLPPPPPP------PPPPTAGAGGPPPPPPP--PAGGAAPPKAVSTG 265 Score = 33.1 bits (72), Expect = 8.1 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +3 Query: 423 GXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPP 527 G P PPPPP PPPP G PP Sbjct: 225 GSTLPPPPPPPPPPTAGAGGPPPPPPPPAGGAAPP 259 >UniRef50_Q68DA7 Cluster: Formin-1; n=14; Theria|Rep: Formin-1 - Homo sapiens (Human) Length = 1419 Score = 42.3 bits (95), Expect = 0.013 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPL 537 PP P PPP PPP G PPPPPPL Sbjct: 895 PPVSAGPPLPPPPPPPPPLPPPSSAGPPPPPPPPPL 930 Score = 41.5 bits (93), Expect = 0.023 Identities = 16/35 (45%), Positives = 17/35 (48%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 PP PPPPP + P P GG PP PP P Sbjct: 915 PPSSAGPPPPPPPPPLPNSPAPPNPGGPPPAPPPP 949 Score = 38.3 bits (85), Expect = 0.21 Identities = 17/35 (48%), Positives = 17/35 (48%), Gaps = 2/35 (5%) Frame = +3 Query: 432 PPXGXX--PPPPPXXXXXXSPPPPXXGGGXPPPPP 530 PP PPPPP SP PP GG P PPP Sbjct: 914 PPPSSAGPPPPPPPPPLPNSPAPPNPGGPPPAPPP 948 Score = 37.5 bits (83), Expect = 0.37 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 P PPPPP SP PP GG PPP P PP Sbjct: 916 PSSAGPPPPPPPPPLPNSPAPPNPGG---PPPAPPPPGLAPPPPP 957 Score = 34.7 bits (76), Expect = 2.6 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 PPPPP PPP G PPPPP P Sbjct: 906 PPPPPPPL-----PPPSSAGPPPPPPPPP 929 Score = 34.3 bits (75), Expect = 3.5 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PP PP PPPP P PP P PP Sbjct: 905 PPPPPPPPLPPPSSAGPPPPPPPPPLPNSPAPPNPGGPPPAPPPP 949 Score = 33.9 bits (74), Expect = 4.6 Identities = 19/53 (35%), Positives = 19/53 (35%), Gaps = 7/53 (13%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXG-------XXXPPPPPPLXXXXXAXXPP 567 PP PPP P P PP PPPPPPL A PP Sbjct: 871 PPASIPPPPPLPSGLGSLSPAPPMPPVSAGPPLPPPPPPPPPLPPPSSAGPPP 923 Score = 33.1 bits (72), Expect = 8.1 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PP PP PPPP P PP A PP Sbjct: 904 PPPPPPPPPLPPPSSAGPPPPPPPPPLPNSPAPPNPGGPPPAPPPP 949 >UniRef50_UPI00015B541C Cluster: PREDICTED: hypothetical protein; n=1; Nasonia vitripennis|Rep: PREDICTED: hypothetical protein - Nasonia vitripennis Length = 661 Score = 41.9 bits (94), Expect = 0.017 Identities = 16/34 (47%), Positives = 17/34 (50%) Frame = +3 Query: 435 PXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 P PPPPP +PPPP PPPPP P Sbjct: 61 PPSPPPPPPPVTYNYPAPPPPPPPPPPPPPPPPP 94 Score = 37.9 bits (84), Expect = 0.28 Identities = 18/48 (37%), Positives = 19/48 (39%), Gaps = 2/48 (4%) Frame = +1 Query: 430 PPXGXXXPP--PPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PP PP PPPP PPPPPP + PP Sbjct: 470 PPSTPSLPPSRPPSSPSPPPPPPPPPPPRPPPPPPPPSQPPPTSLTPP 517 Score = 37.9 bits (84), Expect = 0.28 Identities = 18/40 (45%), Positives = 18/40 (45%), Gaps = 5/40 (12%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPP-----XXGGGXPPPPPXP 536 PP PPPPP SPPPP PPPPP P Sbjct: 525 PPPPPPPPPPPVTYNYPSPPPPPSLPVTYNYPSPPPPPPP 564 Score = 37.1 bits (82), Expect = 0.50 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPP 534 PP PPP PPPP PPPPPP Sbjct: 61 PPSPPPPPPPVTYNYPAPPPPPPPPPPPPPPPPPP 95 Score = 37.1 bits (82), Expect = 0.50 Identities = 18/49 (36%), Positives = 18/49 (36%), Gaps = 4/49 (8%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPP----PPXPXXXAXXXXPP 566 PP PPPPP PPPP PPP PP PP Sbjct: 481 PPSSPSPPPPPPPPPPPRPPPPPPPPSQPPPTSLTPPVTYSYPSPPPPP 529 Score = 35.9 bits (79), Expect = 1.1 Identities = 19/50 (38%), Positives = 21/50 (42%), Gaps = 4/50 (8%) Frame = +1 Query: 430 PPXGXXXPPP----PPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPP PP PPPP PPPPPP+ + PP Sbjct: 502 PPPPPSQPPPTSLTPPVTYSYPSPPPP-----PPPPPPPVTYNYPSPPPP 546 Score = 35.1 bits (77), Expect = 2.0 Identities = 17/46 (36%), Positives = 18/46 (39%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP P PPP PPPP PPPPP + PP Sbjct: 69 PPVTYNYPAPPPPPPPPPPPPPPP-----PPPPPRVSTPAPTYLPP 109 Score = 34.7 bits (76), Expect = 2.6 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 PP PPPPP S PP PPPP P Sbjct: 496 PPRPPPPPPPPSQPPPTSLTPPVTYSYPSPPPPPP 530 Score = 33.9 bits (74), Expect = 4.6 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP P PPP PPP PPPPP L PP Sbjct: 516 PPVTYSYPSPPPPPPPP--PPPVTYNYPSPPPPPSLPVTYNYPSPP 559 Score = 33.5 bits (73), Expect = 6.1 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PPPPP P PP PPPPP P PP Sbjct: 64 PPPPPPPVTYNYPAPP------PPPPPPPPPPPPPPPPP 96 Score = 33.5 bits (73), Expect = 6.1 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +2 Query: 452 PPPPXXXXKXXXPPPXXXGXXXPPPPXPXXXXXXXXPPP 568 PPPP PPP PPPP P P P Sbjct: 66 PPPPPVTYNYPAPPPPPPPPPPPPPPPPPPPPRVSTPAP 104 Score = 33.1 bits (72), Expect = 8.1 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PPPPP P PP PPPPPP PP Sbjct: 64 PPPPPPPVTYNYPAPP------PPPPPPPPPPPPPPPPP 96 >UniRef50_A2RV11 Cluster: FNBP4 protein; n=7; Danio rerio|Rep: FNBP4 protein - Danio rerio (Zebrafish) (Brachydanio rerio) Length = 769 Score = 41.9 bits (94), Expect = 0.017 Identities = 18/36 (50%), Positives = 19/36 (52%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPL 537 PP PPPPP + PPPP PPPPPPL Sbjct: 601 PPLPPEHPPPPP--TEQPPPPPPPPESPPPPPPPPL 634 Score = 36.7 bits (81), Expect = 0.65 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 PP PP P PPPP PPPPP P Sbjct: 598 PPLPPLPPEHPPPPPTEQPPPPPPPPESPPPPPPP 632 Score = 35.5 bits (78), Expect = 1.5 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PP PPP PPPPP P PP Sbjct: 595 PPQPPLPPLPPEHPPPPPTEQPPPPPPPPESPPPPPPPP 633 Score = 34.7 bits (76), Expect = 2.6 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PP PPP PPPPPP PP Sbjct: 595 PPQPPLPPLPPEHPPPPPTEQPPPPPPPPESPPPPPPPP 633 Score = 33.9 bits (74), Expect = 4.6 Identities = 17/46 (36%), Positives = 17/46 (36%), Gaps = 2/46 (4%) Frame = +3 Query: 453 PPPPXXXXXXSPP--PPXXGGGXPPPPPXPXXXAXXXXPPXXXXXG 584 PPPP PP PP PPPPP P PP G Sbjct: 593 PPPPQPPLPPLPPEHPPPPPTEQPPPPPPPPESPPPPPPPPLEDDG 638 >UniRef50_A1L2E9 Cluster: Putative uncharacterized protein; n=3; Danio rerio|Rep: Putative uncharacterized protein - Danio rerio (Zebrafish) (Brachydanio rerio) Length = 428 Score = 41.9 bits (94), Expect = 0.017 Identities = 21/50 (42%), Positives = 21/50 (42%), Gaps = 2/50 (4%) Frame = +3 Query: 423 GXXPPXGXXPPPPPXXXXXXSPPPPXXGGGX--PPPPPXPXXXAXXXXPP 566 G PP PPPPP PPPP G PPPPP P PP Sbjct: 346 GVPPPP---PPPPPGNMGVPPPPPPPPPGNMCIPPPPPPPPGYTGSSLPP 392 Score = 41.1 bits (92), Expect = 0.030 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 2/41 (4%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXG--XXXPPPPPPLXXXXXAXXPP 567 PPPPP PPPP G PPPPPP PP Sbjct: 311 PPPPPGNMSVPPPPPPPPGNMGVLPPPPPPRPGNMGVPPPP 351 Score = 40.7 bits (91), Expect = 0.040 Identities = 25/75 (33%), Positives = 25/75 (33%), Gaps = 7/75 (9%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPX--GXXPPPPPXXXXXXS-----PPPPXXGGGXPPPPPXPX 539 PP G PP G PPPPP PPPP G PPPPP P Sbjct: 310 PPPPPPGNMSVPPPPPPPPGNMGVLPPPPPPRPGNMGVPPPPPPPPPGNMGVPPPPPPPP 369 Query: 540 XXAXXXXPPXXXXXG 584 PP G Sbjct: 370 PGNMCIPPPPPPPPG 384 Score = 40.3 bits (90), Expect = 0.053 Identities = 21/51 (41%), Positives = 21/51 (41%), Gaps = 3/51 (5%) Frame = +3 Query: 423 GXXPPXGXXPPPPPXXXXXXSPPPPXXG---GGXPPPPPXPXXXAXXXXPP 566 G PP PPPPP PPPP G PPP P P A PP Sbjct: 360 GVPPPP---PPPPPGNMCIPPPPPPPPGYTGSSLPPPAPPPPQNASMAPPP 407 Score = 39.9 bits (89), Expect = 0.070 Identities = 19/46 (41%), Positives = 20/46 (43%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP G PPPP PPPP PPPPPP + PP Sbjct: 354 PPPGNMGVPPPP-------PPPPPGNMCIPPPPPPPPGYTGSSLPP 392 Score = 39.9 bits (89), Expect = 0.070 Identities = 19/46 (41%), Positives = 20/46 (43%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPPP PPPP PPPPPP + PP Sbjct: 355 PPGNMGVPPPPP-------PPPPGNMCIPPPPPPPPGYTGSSLPPP 393 Score = 38.7 bits (86), Expect = 0.16 Identities = 22/51 (43%), Positives = 22/51 (43%), Gaps = 3/51 (5%) Frame = +3 Query: 441 GXXPPPPPXXXXXXSPPPPXX--GGGX-PPPPPXPXXXAXXXXPPXXXXXG 584 G PPPPP SPPPP GG PPPPP P PP G Sbjct: 270 GDAPPPPPPP----SPPPPGSVYGGSLVPPPPPPPGTNTTMTAPPPPPPPG 316 Score = 38.7 bits (86), Expect = 0.16 Identities = 24/71 (33%), Positives = 24/71 (33%), Gaps = 9/71 (12%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXX----PPPPPXXXXXXS-----PPPPXXGGGXPPPPPX 533 PP G PP G PPPPP S PPPP PPPPP Sbjct: 351 PPPPPPGNMGVPPPPPPPPPGNMCIPPPPPPPPGYTGSSLPPPAPPPPQNASMAPPPPPP 410 Query: 534 PXXXAXXXXPP 566 P PP Sbjct: 411 PPLGGKFLPPP 421 Score = 38.3 bits (85), Expect = 0.21 Identities = 18/48 (37%), Positives = 19/48 (39%), Gaps = 3/48 (6%) Frame = +3 Query: 450 PPPPPXXXXXXS---PPPPXXGGGXPPPPPXPXXXAXXXXPPXXXXXG 584 PPPPP + PPPP PPPPP P PP G Sbjct: 296 PPPPPGTNTTMTAPPPPPPPGNMSVPPPPPPPPGNMGVLPPPPPPRPG 343 Score = 38.3 bits (85), Expect = 0.21 Identities = 19/50 (38%), Positives = 19/50 (38%), Gaps = 4/50 (8%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXX----PPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPPP PPPP G PPPPP PP Sbjct: 314 PPGNMSVPPPPPPPPGNMGVLPPPPPPRPGNMGVPPPPPPPPPGNMGVPP 363 Score = 37.9 bits (84), Expect = 0.28 Identities = 20/52 (38%), Positives = 20/52 (38%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 PP G G PP PPP PPPP G PPPPP P Sbjct: 380 PPPPGYTGSSLPPPAPPPPQNASMAPPPP------PPPPLGGKFLPPPPPPP 425 Score = 37.1 bits (82), Expect = 0.50 Identities = 19/53 (35%), Positives = 19/53 (35%), Gaps = 7/53 (13%) Frame = +1 Query: 430 PPXGXXXPPPPPXXX-------KXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPPP PPPP PPPPPP PP Sbjct: 369 PPGNMCIPPPPPPPPGYTGSSLPPPAPPPPQNASMAPPPPPPPPLGGKFLPPP 421 Score = 36.7 bits (81), Expect = 0.65 Identities = 22/56 (39%), Positives = 23/56 (41%), Gaps = 8/56 (14%) Frame = +3 Query: 423 GXXPPXGXXP-PPPPXXXXXXS---PPPPXXGGG----XPPPPPXPXXXAXXXXPP 566 G PP P PPPP S PPPP G PPPPP P + PP Sbjct: 270 GDAPPPPPPPSPPPPGSVYGGSLVPPPPPPPGTNTTMTAPPPPPPPGNMSVPPPPP 325 Score = 36.7 bits (81), Expect = 0.65 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 2/41 (4%) Frame = +1 Query: 451 PPPPPXXXKXXX--PPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PPPPP PPPP G PPPPP PP Sbjct: 296 PPPPPGTNTTMTAPPPPPPPGNMSVPPPPPPPPGNMGVLPP 336 Score = 36.7 bits (81), Expect = 0.65 Identities = 20/49 (40%), Positives = 20/49 (40%), Gaps = 6/49 (12%) Frame = +1 Query: 439 GXXXPPPPPXXXKXXXPPPPXX-----GXXXPPP-PPPLXXXXXAXXPP 567 G PPPPP PPPP G PPP PPP A PP Sbjct: 360 GVPPPPPPPPPGNMCIPPPPPPPPGYTGSSLPPPAPPPPQNASMAPPPP 408 Score = 35.9 bits (79), Expect = 1.1 Identities = 16/32 (50%), Positives = 16/32 (50%), Gaps = 3/32 (9%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGX---PPPPPXP 536 PPPP PPPP GG PPPPP P Sbjct: 395 PPPPQNASMAPPPPPPPPLGGKFLPPPPPPPP 426 >UniRef50_Q0ILB7 Cluster: ORF1629; n=1; Leucania separata nuclear polyhedrosis virus|Rep: ORF1629 - Leucania separata nuclear polyhedrosis virus (LsNPV) Length = 589 Score = 41.9 bits (94), Expect = 0.017 Identities = 15/29 (51%), Positives = 17/29 (58%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPPL 537 PPPPP + PPPP PPPPPP+ Sbjct: 255 PPPPPMPVESGSPPPPPPPPPPPPPPPPV 283 Score = 37.5 bits (83), Expect = 0.37 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = +3 Query: 435 PXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 P PPPPP SPPPP PPPPP P Sbjct: 250 PIPPPPPPPPMPVESGSPPPP------PPPPPPP 277 Score = 35.9 bits (79), Expect = 1.1 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 P PPP PPPP PPPP P PP Sbjct: 244 PAPPPQPIPPPPPPPPMPVESGSPPPPPPPPPPPPPPPP 282 Score = 35.1 bits (77), Expect = 2.0 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 P PPP PPPP PPPPP PP Sbjct: 244 PAPPPQPIPPPPPPPPMPVESGSPPPPPPPPPPPPPPPP 282 >UniRef50_Q8PPF4 Cluster: Putative uncharacterized protein XAC0732; n=2; Xanthomonas|Rep: Putative uncharacterized protein XAC0732 - Xanthomonas axonopodis pv. citri Length = 266 Score = 41.9 bits (94), Expect = 0.017 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = +1 Query: 439 GXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPP 534 G PPPPP PPPP PPPPPP Sbjct: 229 GFAPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 260 Score = 40.7 bits (91), Expect = 0.040 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPP 534 PPPPP PPPP PPPPPP Sbjct: 234 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 261 Score = 35.9 bits (79), Expect = 1.1 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPP 530 PP PPPPP PPPP PPPPP Sbjct: 235 PPPPPPPPPPPPPPPPPPPPPP------PPPPP 261 >UniRef50_Q828N1 Cluster: Putative secreted protein; n=5; Streptomyces|Rep: Putative secreted protein - Streptomyces avermitilis Length = 303 Score = 41.9 bits (94), Expect = 0.017 Identities = 23/51 (45%), Positives = 24/51 (47%), Gaps = 1/51 (1%) Frame = -1 Query: 530 GGGGGXSXPXXGGGGXXXXXXXGGGGGXXXPXGGXXXXXKXXP-PPPPPGG 381 GGGGG + P GGGG GGGGG P GG P P PGG Sbjct: 198 GGGGGTTPP--GGGGGGTTPPGGGGGGTTPPGGGGGTTPPGTPGHPGQPGG 246 Score = 37.5 bits (83), Expect = 0.37 Identities = 23/56 (41%), Positives = 24/56 (42%) Frame = -1 Query: 527 GGGGXSXPXXGGGGXXXXXXXGGGGGXXXPXGGXXXXXKXXPPPPPPGGXXXTPXG 360 GGG + P GGGG GGGGG P GG PP GG TP G Sbjct: 189 GGGHATTPPGGGGG--TTPPGGGGGGTTPPGGGGGG------TTPPGGGGGTTPPG 236 Score = 35.9 bits (79), Expect = 1.1 Identities = 17/32 (53%), Positives = 18/32 (56%) Frame = -1 Query: 533 GGGGGGXSXPXXGGGGXXXXXXXGGGGGXXXP 438 GGGGGG + P GGGG GGGGG P Sbjct: 207 GGGGGGTTPPGGGGGG---TTPPGGGGGTTPP 235 Score = 33.5 bits (73), Expect = 6.1 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = -2 Query: 535 GXGGGGGXPPPXXGGGGXXFXXXXGGGGGXXPXG 434 G GGGG PP GGG GGGGG P G Sbjct: 207 GGGGGGTTPPGGGGGG----TTPPGGGGGTTPPG 236 >UniRef50_Q2INY4 Cluster: Putative uncharacterized protein precursor; n=1; Anaeromyxobacter dehalogenans 2CP-C|Rep: Putative uncharacterized protein precursor - Anaeromyxobacter dehalogenans (strain 2CP-C) Length = 244 Score = 41.9 bits (94), Expect = 0.017 Identities = 16/35 (45%), Positives = 17/35 (48%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPP 534 P PPPPP + PPPP PPPPPP Sbjct: 106 PVEAAAPPPPPPPPYRPAPPPPPPEYRPAPPPPPP 140 >UniRef50_Q9FF15 Cluster: Arabidopsis thaliana genomic DNA, chromosome 5, P1 clone:MXM12; n=2; Arabidopsis thaliana|Rep: Arabidopsis thaliana genomic DNA, chromosome 5, P1 clone:MXM12 - Arabidopsis thaliana (Mouse-ear cress) Length = 721 Score = 41.9 bits (94), Expect = 0.017 Identities = 15/28 (53%), Positives = 16/28 (57%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPP 534 PPPPP + PPP G PPPPPP Sbjct: 25 PPPPPPMRRSAPSPPPMSGRVPPPPPPP 52 Score = 39.1 bits (87), Expect = 0.12 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 PPPPP PPP G PPPPP P Sbjct: 25 PPPPPPMRRSAPSPPPMSGRVPPPPPPPP 53 Score = 38.7 bits (86), Expect = 0.16 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = +3 Query: 441 GXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 G P P SPPPP GG PPPPP P Sbjct: 624 GPYPLPRLVRVGSPSPPPPSMSGGAPPPPPPP 655 Score = 38.3 bits (85), Expect = 0.21 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPPL 537 PPPPP PPP PPPPPP+ Sbjct: 26 PPPPPMRRSAPSPPPMSGRVPPPPPPPPM 54 Score = 33.1 bits (72), Expect = 8.1 Identities = 17/50 (34%), Positives = 19/50 (38%), Gaps = 4/50 (8%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXX----GXXXPPPPPPLXXXXXAXXPP 567 PP P P P + P PP G PPPPPP+ PP Sbjct: 618 PPRLVCGPYPLPRLVRVGSPSPPPPSMSGGAPPPPPPPPMLVASRTAPPP 667 >UniRef50_O48809 Cluster: T3P18.1; n=9; Eukaryota|Rep: T3P18.1 - Arabidopsis thaliana (Mouse-ear cress) Length = 786 Score = 41.9 bits (94), Expect = 0.017 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 P PPPPP SPPPP PPP P P PP Sbjct: 482 PSVRAYPPPPPLSPPPPSPPPPYIYSSPPPPSPSPPPPYIYSSPP 526 Score = 36.3 bits (80), Expect = 0.86 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 1/39 (2%) Frame = +3 Query: 453 PPPPXXXXXXSPPPPXX-GGGXPPPPPXPXXXAXXXXPP 566 P PP SPPPP PPPPP P A PP Sbjct: 556 PSPPYYQYTSSPPPPTYYATQSPPPPPPPTYYAVQSPPP 594 Score = 35.5 bits (78), Expect = 1.5 Identities = 16/42 (38%), Positives = 17/42 (40%), Gaps = 3/42 (7%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXX---GXXXPPPPPPLXXXXXAXXPP 567 PPPP PPPP PPPPPP+ PP Sbjct: 567 PPPPTYYATQSPPPPPPPTYYAVQSPPPPPPVYYPPVTASPP 608 Score = 34.7 bits (76), Expect = 2.6 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PPPPP PPPP PPP P PP Sbjct: 488 PPPPPLSPPPPSPPPPYIYSSPPPPSPSPPPPYIYSSPP 526 Score = 33.9 bits (74), Expect = 4.6 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +2 Query: 452 PPPPXXXXKXXXPPPXXXGXXXPPPPXPXXXXXXXXPPP 568 PPPP PPP PP P P PPP Sbjct: 489 PPPPLSPPPPSPPPPYIYSSPPPPSPSPPPPYIYSSPPP 527 Score = 33.1 bits (72), Expect = 8.1 Identities = 17/44 (38%), Positives = 17/44 (38%), Gaps = 5/44 (11%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPP-----XXGGGXPPPPPXPXXXAXXXXPP 566 PPPPP SPPPP PPPPP PP Sbjct: 580 PPPPPTYYAVQSPPPPPPVYYPPVTASPPPPPVYYTPVIQSPPP 623 >UniRef50_O23374 Cluster: P140mDia like protein; n=2; Arabidopsis thaliana|Rep: P140mDia like protein - Arabidopsis thaliana (Mouse-ear cress) Length = 645 Score = 41.9 bits (94), Expect = 0.017 Identities = 16/35 (45%), Positives = 17/35 (48%) Frame = +1 Query: 433 PXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPL 537 P G PPPPP PPPP PPPPP + Sbjct: 304 PPGRSAPPPPPAAAPPPQPPPPPPPKPQPPPPPKI 338 Score = 41.1 bits (92), Expect = 0.030 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPP 530 PP PPPPP PPPP PPPPP Sbjct: 304 PPGRSAPPPPPAAAPPPQPPPPPPPKPQPPPPP 336 Score = 35.1 bits (77), Expect = 2.0 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPP 534 PP PP PP PPP PPP PP Sbjct: 312 PPPAAAPPPQPPPPPPPKPQPPPPPKIARPPPAPP 346 >UniRef50_A4S3R1 Cluster: Predicted protein; n=2; Ostreococcus|Rep: Predicted protein - Ostreococcus lucimarinus CCE9901 Length = 700 Score = 41.9 bits (94), Expect = 0.017 Identities = 19/48 (39%), Positives = 20/48 (41%) Frame = +3 Query: 423 GXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 G PP PPPPP PPP G P PPP P + PP Sbjct: 616 GTTPPPAPTPPPPPSSRNIPPSPPPSV-GKPPKPPPPPRSISPPKKPP 662 Score = 39.9 bits (89), Expect = 0.070 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +1 Query: 433 PXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 P PPPPP PPP G PPPPP PP Sbjct: 619 PPPAPTPPPPPSSRNIPPSPPPSVGKPPKPPPPPRSISPPKKPPP 663 Score = 38.3 bits (85), Expect = 0.21 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPPXXXXXG 584 PP PPPP SPPP PPPPP PP G Sbjct: 620 PPAPTPPPPPSSRNIPPSPPPSVGKPPKPPPPPRSISPPKKPPPPPPPNKG 670 Score = 35.9 bits (79), Expect = 1.1 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +2 Query: 431 PPXGXXXPPPPXXXXKXXXPPPXXXGXXXPPPPXPXXXXXXXXPPP 568 PP PPPP PPP PPPP PPP Sbjct: 619 PPPAPTPPPPPSSRNIPPSPPPSVGKPPKPPPPPRSISPPKKPPPP 664 Score = 34.7 bits (76), Expect = 2.6 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 PP PPPPP PP PP PP P Sbjct: 535 PPPPPPPPPPPPPPPGGHAPPDENAAPSPPNPPNP 569 >UniRef50_Q9NGX2 Cluster: Diaphanous protein; n=3; Entamoeba histolytica|Rep: Diaphanous protein - Entamoeba histolytica Length = 1209 Score = 41.9 bits (94), Expect = 0.017 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 PPPPP PPPP PPPPP P Sbjct: 588 PPPPPGASSIPPPPPPPGASSVPPPPPPP 616 Score = 41.5 bits (93), Expect = 0.023 Identities = 22/56 (39%), Positives = 22/56 (39%), Gaps = 4/56 (7%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPX----GXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 PP G G PP G PPPPP PPPP G PPPP P Sbjct: 614 PPPGMPGMPGMPGMPPPPPPPGMPGMPPPPPPPGMPGMPPPPPGMPGMPPPPPGMP 669 Score = 41.5 bits (93), Expect = 0.023 Identities = 20/50 (40%), Positives = 20/50 (40%), Gaps = 2/50 (4%) Frame = +3 Query: 423 GXXPPXGXXP--PPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 G PP P PPPP PPPP G PPPP P PP Sbjct: 660 GMPPPPPGMPGMPPPPPGMPGMPPPPPGMPGMPPPPPGMPGMPGMPGMPP 709 Score = 40.7 bits (91), Expect = 0.040 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 PPPPP PPPP G PPPP P Sbjct: 587 PPPPPPGASSIPPPPPPPGASSVPPPPPP 615 Score = 40.7 bits (91), Expect = 0.040 Identities = 23/61 (37%), Positives = 23/61 (37%), Gaps = 10/61 (16%) Frame = +3 Query: 432 PPXGXX---PPPPPXXXXXXSPPPPXXG-------GGXPPPPPXPXXXAXXXXPPXXXXX 581 PP G PPPPP PPPP G G PPPPP P PP Sbjct: 590 PPPGASSIPPPPPPPGASSVPPPPPPPGMPGMPGMPGMPPPPPPPGMPGMPPPPPPPGMP 649 Query: 582 G 584 G Sbjct: 650 G 650 Score = 40.3 bits (90), Expect = 0.053 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPP 534 PPPPP PPPP G PPPPP Sbjct: 629 PPPPPPGMPGMPPPPPPPGMPGMPPPPP 656 Score = 40.3 bits (90), Expect = 0.053 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPP 531 PP PPPPP PPPP PPPPP Sbjct: 633 PPGMPGMPPPPPPPGMPGMPPPPPGMPGMPPPPP 666 Score = 39.5 bits (88), Expect = 0.093 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPP 530 PP G PPP PPPP G PPPPP Sbjct: 644 PPPGMPGMPPPPPGMPGMPPPPPGMPGMPPPPP 676 Score = 39.5 bits (88), Expect = 0.093 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPP 530 PP G PPP PPPP G PPPPP Sbjct: 654 PPPGMPGMPPPPPGMPGMPPPPPGMPGMPPPPP 686 Score = 38.7 bits (86), Expect = 0.16 Identities = 18/40 (45%), Positives = 18/40 (45%), Gaps = 2/40 (5%) Frame = +3 Query: 423 GXXPPXGXXP--PPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 G PP P PPPP PPPP G PPPP P Sbjct: 650 GMPPPPPGMPGMPPPPPGMPGMPPPPPGMPGMPPPPPGMP 689 Score = 38.3 bits (85), Expect = 0.21 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 PP PPPP PPPP G PPPP P Sbjct: 645 PPGMPGMPPPPPGMPGMPPPPPGMPGMPPPPPGMP 679 Score = 37.9 bits (84), Expect = 0.28 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP P P PPPP G PPPPP P PP Sbjct: 612 PPPPPGMPGMPGMPGMPPPPPPPGMPGMPPPPPPPGMPGMPPPPP 656 Score = 37.1 bits (82), Expect = 0.50 Identities = 19/50 (38%), Positives = 19/50 (38%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPP 530 PP G G G G PPP PPPP G PPPPP Sbjct: 683 PPPPGMPGMPPPPPGMPGMPGMPGMPPPPPGMPGMPPPPPGMPGMPPPPP 732 Score = 36.3 bits (80), Expect = 0.86 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 4/39 (10%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPP----XXGXXXPPPPPP 534 PP G PPPP PPPP G PPPPP Sbjct: 674 PPPGMPGMPPPPPGMPGMPPPPPGMPGMPGMPGMPPPPP 712 Score = 35.9 bits (79), Expect = 1.1 Identities = 17/46 (36%), Positives = 18/46 (39%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPPP P P G PPPPP + PP Sbjct: 603 PPGASSVPPPPPPPGMPGMPGMP--GMPPPPPPPGMPGMPPPPPPP 646 Score = 35.9 bits (79), Expect = 1.1 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = +3 Query: 441 GXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 G PPPPP PPPP G P PP P PP Sbjct: 626 GMPPPPPPPGMPGMPPPPPPPG--MPGMPPPPPGMPGMPPPP 665 Score = 35.1 bits (77), Expect = 2.0 Identities = 18/48 (37%), Positives = 18/48 (37%), Gaps = 2/48 (4%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPP--PPPPLXXXXXAXXPP 567 PP PPPPP PPP G P PPPP PP Sbjct: 675 PPGMPGMPPPPPGMPGMPPPPPGMPGMPGMPGMPPPPPGMPGMPPPPP 722 Score = 34.3 bits (75), Expect = 3.5 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = +3 Query: 486 PPPPXXGGGXPPPPPXPXXXAXXXXPPXXXXXG 584 PPPP PPPPP P + PP G Sbjct: 588 PPPPPGASSIPPPPPPPGASSVPPPPPPPGMPG 620 Score = 34.3 bits (75), Expect = 3.5 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPP 530 PP G G PP G PPP PPPP G G P P Sbjct: 693 PPPPGMPGMPGMPGMPPPPPGMPGMPPPPPGMPGMPPPPPGGFGFRPAAP 742 Score = 33.5 bits (73), Expect = 6.1 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +1 Query: 439 GXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPP 534 G PPPP PPPP G PPPPP Sbjct: 703 GMPGMPPPPPGMPGMPPPPP--GMPGMPPPPP 732 >UniRef50_Q54TI7 Cluster: WH2 domain-containing protein; n=1; Dictyostelium discoideum AX4|Rep: WH2 domain-containing protein - Dictyostelium discoideum AX4 Length = 459 Score = 41.9 bits (94), Expect = 0.017 Identities = 22/62 (35%), Positives = 22/62 (35%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXX 560 PP G GG PP PPP P PPPP GG P P P Sbjct: 322 PPNPGTGGGP-----TQPPMNRPPPPGPNGGPMNRPPPPGPNGGPPQPMNRPPPPGSNGG 376 Query: 561 PP 566 PP Sbjct: 377 PP 378 Score = 38.3 bits (85), Expect = 0.21 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 435 PXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPP 530 P G P PP PPPP GG PP PP Sbjct: 269 PTGNSPQRPPTQPPMNRPPPPGPNGGGPPQPP 300 Score = 38.3 bits (85), Expect = 0.21 Identities = 26/76 (34%), Positives = 26/76 (34%), Gaps = 8/76 (10%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXXPPPPPXXXXXXSPPPPXXG-GGXP-------PPPPXP 536 PP GGG PP PP P PPPP G GG P PPPP P Sbjct: 288 PPGPNGGGPPQPPISRPPPPNPGGPPQP---PISRPPPPNPGTGGGPTQPPMNRPPPPGP 344 Query: 537 XXXAXXXXPPXXXXXG 584 PP G Sbjct: 345 NGGPMNRPPPPGPNGG 360 Score = 33.9 bits (74), Expect = 4.6 Identities = 21/62 (33%), Positives = 21/62 (33%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXX 560 PP G GG PP G PP PPPP GG P P P Sbjct: 340 PPPGPNGGPM----NRPPPPGPNGGPPQPMNR---PPPPGSNGGPPQPMSRPPPPGQPNM 392 Query: 561 PP 566 PP Sbjct: 393 PP 394 Score = 33.1 bits (72), Expect = 8.1 Identities = 22/70 (31%), Positives = 22/70 (31%), Gaps = 8/70 (11%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXXPPPPPXXXXXX--SPPPPXXGGGXPP------PPPXP 536 PP G GG PP PP P PP GG PP PPP P Sbjct: 369 PPPGSNGGPPQPMSRPPPPGQPNMPPRPVSTINGVGGAPPTQPNGGPPPKPQRPGPPPVP 428 Query: 537 XXXAXXXXPP 566 PP Sbjct: 429 GAPRPMTTPP 438 >UniRef50_Q54ND2 Cluster: RhoGEF domain-containing protein; n=1; Dictyostelium discoideum AX4|Rep: RhoGEF domain-containing protein - Dictyostelium discoideum AX4 Length = 1377 Score = 41.9 bits (94), Expect = 0.017 Identities = 22/51 (43%), Positives = 22/51 (43%), Gaps = 3/51 (5%) Frame = +3 Query: 423 GXXPPX---GXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 G PP G PPPPP PPPP GG PPPP P PP Sbjct: 40 GLPPPTNMGGQLPPPPPTNMGGQLPPPPTNLGGQLPPPP-PNNIGQLPPPP 89 Score = 35.1 bits (77), Expect = 2.0 Identities = 17/37 (45%), Positives = 17/37 (45%), Gaps = 3/37 (8%) Frame = +1 Query: 430 PPXGXX--XPPPPPXXXKXXXPPPP-XXGXXXPPPPP 531 PP PPPPP PPPP G PPPPP Sbjct: 43 PPTNMGGQLPPPPPTNMGGQLPPPPTNLGGQLPPPPP 79 Score = 35.1 bits (77), Expect = 2.0 Identities = 16/45 (35%), Positives = 17/45 (37%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPP PPP GG PPPP + PP Sbjct: 78 PPNNIGQLPPPPTNIGQLPPPNNIGGQLPPPPLLTTNASTGGPPP 122 Score = 33.9 bits (74), Expect = 4.6 Identities = 17/40 (42%), Positives = 17/40 (42%), Gaps = 7/40 (17%) Frame = +1 Query: 439 GXXXPPPPPXXXKXXXPPPPXXGXXXPP-------PPPPL 537 G PPPPP PPP G PP PPPPL Sbjct: 71 GGQLPPPPPNNIGQLPPPPTNIGQLPPPNNIGGQLPPPPL 110 Score = 33.9 bits (74), Expect = 4.6 Identities = 19/50 (38%), Positives = 19/50 (38%), Gaps = 8/50 (16%) Frame = +3 Query: 441 GXXPPPPPXXXXXXSPPPPXXG--------GGXPPPPPXPXXXAXXXXPP 566 G PPPPP PPP G GG PPPP A PP Sbjct: 72 GQLPPPPPNNIGQLPPPPTNIGQLPPPNNIGGQLPPPPLLTTNASTGGPP 121 >UniRef50_Q2M175 Cluster: GA21777-PA; n=2; pseudoobscura subgroup|Rep: GA21777-PA - Drosophila pseudoobscura (Fruit fly) Length = 1967 Score = 41.9 bits (94), Expect = 0.017 Identities = 22/51 (43%), Positives = 22/51 (43%), Gaps = 1/51 (1%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXXPPPPPXXXXXXSPP-PPXXGGGXPPPPP 530 PP GGGG PP G PP PP PP G G PPPPP Sbjct: 1310 PPHYGGGGHM--GMRGPPPNGAPQPPHLRGMPGPGPPGPPPPGAGGPPPPP 1358 Score = 34.3 bits (75), Expect = 3.5 Identities = 16/36 (44%), Positives = 17/36 (47%) Frame = +3 Query: 423 GXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPP 530 G P G PPPP +P P GG PPPPP Sbjct: 1426 GPGPGPGSLQPPPPNA----NPSLPLRGGSVPPPPP 1457 >UniRef50_A0D550 Cluster: Chromosome undetermined scaffold_38, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_38, whole genome shotgun sequence - Paramecium tetraurelia Length = 493 Score = 41.9 bits (94), Expect = 0.017 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 364 PPPPPPPPPPPPKGAPPPPPPPPP----PPPPPGPPPPGQLPPPP 404 Score = 39.9 bits (89), Expect = 0.070 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PPPPP K PPPP PPPPPP PP Sbjct: 368 PPPPPPPPKGAPPPPPPP----PPPPPPPGPPPPGQLPP 402 Score = 36.3 bits (80), Expect = 0.86 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPP 534 PPPPP PPPP PPPPPP Sbjct: 364 PPPPPPPP----PPPPKGAPPPPPPPPP 387 Score = 35.9 bits (79), Expect = 1.1 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PPPPP PPP G PPPPPP PP Sbjct: 366 PPPPPP-------PPPPKGAPPPPPPPPPPPPPPGPPPP 397 >UniRef50_Q7SEJ7 Cluster: Predicted protein; n=1; Neurospora crassa|Rep: Predicted protein - Neurospora crassa Length = 190 Score = 41.9 bits (94), Expect = 0.017 Identities = 24/63 (38%), Positives = 24/63 (38%), Gaps = 1/63 (1%) Frame = -1 Query: 530 GGGGGXSXPXXGGGGXXXXXXXGGGG-GXXXPXGGXXXXXKXXPPPPPPGGXXXTPXGGX 354 GGGGG P GGGG G GG G P G PP P P G Sbjct: 102 GGGGGQVDPGYGGGGYGGGDPSGYGGYGGSDPSGSGYGGGGSVPPNPMPRPNPNPFAGDN 161 Query: 353 PPP 345 PPP Sbjct: 162 PPP 164 Score = 36.3 bits (80), Expect = 0.86 Identities = 21/52 (40%), Positives = 21/52 (40%), Gaps = 2/52 (3%) Frame = -2 Query: 535 GXGGGGGXPPPXXGGGGXXFXXXXGGGG--GXXPXGGXXPXFXKXXPPPPPR 386 G GGGGG P GGGG G GG G P G P P PR Sbjct: 100 GYGGGGGQVDPGYGGGGYGGGDPSGYGGYGGSDPSGSGYGGGGSVPPNPMPR 151 >UniRef50_Q5ANI0 Cluster: Potential fungal zinc cluster transcription factor; n=1; Candida albicans|Rep: Potential fungal zinc cluster transcription factor - Candida albicans (Yeast) Length = 1130 Score = 41.9 bits (94), Expect = 0.017 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 PP PPPPP PP G G PPPPP P Sbjct: 308 PPPPPPPPPPPLHHHHHYPPSHHPGFGFPPPPPGP 342 >UniRef50_Q5AL62 Cluster: Putative uncharacterized protein; n=1; Candida albicans|Rep: Putative uncharacterized protein - Candida albicans (Yeast) Length = 115 Score = 41.9 bits (94), Expect = 0.017 Identities = 20/46 (43%), Positives = 20/46 (43%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPPP PPPP PPPPPPL PP Sbjct: 18 PPPPPPQPPPPPPQP----PPPPPSLLPQPPPPPPLLSPPQLTQPP 59 Score = 36.7 bits (81), Expect = 0.65 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPP 530 PP PP PP PPPP PPPPP Sbjct: 16 PPPPPPPPQPPPPPPQPPPPPPSLLPQPPPPPP 48 Score = 34.7 bits (76), Expect = 2.6 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPPP PPPP PP L PP Sbjct: 26 PPPPPQPPPPPPSLLPQPPPPPPLLSPPQLTQPPVLPQPLPQPLPP 71 Score = 33.9 bits (74), Expect = 4.6 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = +3 Query: 435 PXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 P PPP P PPPP PPPPP PP Sbjct: 16 PPPPPPPPQPPPPPPQPPPPPPSLLPQPPPPPPLLSPPQLTQPP 59 >UniRef50_Q4WNW8 Cluster: KH domain protein; n=13; Pezizomycotina|Rep: KH domain protein - Aspergillus fumigatus (Sartorya fumigata) Length = 503 Score = 41.9 bits (94), Expect = 0.017 Identities = 15/27 (55%), Positives = 16/27 (59%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPPP 530 P PPP +PPPP G G PPPPP Sbjct: 465 PAPPPPPPASEAPPPPPPGSGSPPPPP 491 Score = 40.7 bits (91), Expect = 0.040 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPP 534 P PPP PPPP G PPPPPP Sbjct: 465 PAPPPPPPASEAPPPPPPGSGSPPPPPP 492 Score = 38.3 bits (85), Expect = 0.21 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPP 527 PPPPP PPPP G PPPP Sbjct: 467 PPPPPPASEAPPPPPPGSGSPPPPPP 492 Score = 35.1 bits (77), Expect = 2.0 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGG 512 PP PPPPP SPPPP GGG Sbjct: 471 PPASEAPPPPPPGSG--SPPPPPPGGG 495 >UniRef50_Q0CLE5 Cluster: Predicted protein; n=1; Aspergillus terreus NIH2624|Rep: Predicted protein - Aspergillus terreus (strain NIH 2624) Length = 548 Score = 41.9 bits (94), Expect = 0.017 Identities = 15/27 (55%), Positives = 16/27 (59%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPPP 530 P PPP +PPPP G G PPPPP Sbjct: 509 PAPPPPPPTSEAPPPPPPGSGSPPPPP 535 Score = 37.9 bits (84), Expect = 0.28 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPP 531 P PPP PPPP G PPPPP Sbjct: 509 PAPPPPPPTSEAPPPPPPGSGSPPPPP 535 Score = 36.7 bits (81), Expect = 0.65 Identities = 15/28 (53%), Positives = 16/28 (57%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPP 534 PPPPP + PPPP G PPPPP Sbjct: 511 PPPPPPTSEAPPPPPPGSGS---PPPPP 535 >UniRef50_A4RC14 Cluster: Predicted protein; n=1; Magnaporthe grisea|Rep: Predicted protein - Magnaporthe grisea (Rice blast fungus) (Pyricularia grisea) Length = 429 Score = 41.9 bits (94), Expect = 0.017 Identities = 18/52 (34%), Positives = 19/52 (36%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 PP+ PP PPPP PPP G PPPPP P Sbjct: 330 PPKTTAAPPPLPAVSSEPPKTTGAPPPPPPPPPPPPPPASSGSPAPPPPPPP 381 Score = 35.5 bits (78), Expect = 1.5 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +2 Query: 431 PPXGXXXPPPPXXXXKXXXPPPXXXGXXXPPPPXPXXXXXXXXPPP 568 PP PPPP PPP G PPPP P P P Sbjct: 347 PPKTTGAPPPPPPPPPPP-PPPASSGSPAPPPPPPPPPKTTMVPQP 391 Score = 34.3 bits (75), Expect = 3.5 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 7/36 (19%) Frame = +3 Query: 450 PPPPPXXXXXXSPP-------PPXXGGGXPPPPPXP 536 PPPPP PP PP G PPPPP P Sbjct: 326 PPPPPPKTTAAPPPLPAVSSEPPKTTGAPPPPPPPP 361 Score = 33.1 bits (72), Expect = 8.1 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 PP PP S PP G PPPPP P Sbjct: 328 PPPPKTTAAPPPLPAVSSEPPKTTGAPPPPPPPPP 362 >UniRef50_A4R506 Cluster: Putative uncharacterized protein; n=1; Magnaporthe grisea|Rep: Putative uncharacterized protein - Magnaporthe grisea (Rice blast fungus) (Pyricularia grisea) Length = 536 Score = 41.9 bits (94), Expect = 0.017 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 PP PPPPP PPPP PPPPP P Sbjct: 434 PPPPPPPPPPPPSPPAPPPPPPPPVITPPPPPPTP 468 Score = 40.7 bits (91), Expect = 0.040 Identities = 21/62 (33%), Positives = 21/62 (33%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXX 560 P G G P PPPPP PPPP PPPPP P Sbjct: 411 PDPGDDGAGSVKAESEPAPAAAAPPPPPP------PPPPPPSPPAPPPPPPPPVITPPPP 464 Query: 561 PP 566 PP Sbjct: 465 PP 466 Score = 37.5 bits (83), Expect = 0.37 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +1 Query: 433 PXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 P PPPPP PPPP PPPPPP PP Sbjct: 429 PAAAAPPPPPP-------PPPPPPSPPAPPPPPPPPVITPPPPPP 466 Score = 33.1 bits (72), Expect = 8.1 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 P PPPPP PPPP PPPPP PP Sbjct: 427 PAPAAAAPPPPP-------PPPPPPPSPPAPPPPPPPPVITPPPPP 465 >UniRef50_O60879 Cluster: Protein diaphanous homolog 2; n=26; Eutheria|Rep: Protein diaphanous homolog 2 - Homo sapiens (Human) Length = 1101 Score = 41.9 bits (94), Expect = 0.017 Identities = 20/49 (40%), Positives = 20/49 (40%), Gaps = 1/49 (2%) Frame = +3 Query: 423 GXXPPXGXXPPPPPXXXXXXSPPPPXXGG-GXPPPPPXPXXXAXXXXPP 566 G PP PP P PPPP G G PPPPP P PP Sbjct: 559 GVGPPPPPPAPPLPGGAPLPPPPPPLPGMMGIPPPPPPPLLFGGPPPPP 607 Score = 40.3 bits (90), Expect = 0.053 Identities = 15/26 (57%), Positives = 15/26 (57%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPP 527 PPPPP PPPP GG PPPP Sbjct: 591 PPPPPPPLLFGGPPPPPPLGGVPPPP 616 Score = 39.9 bits (89), Expect = 0.070 Identities = 19/48 (39%), Positives = 19/48 (39%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPPP 524 PP GG G PPPPP PPPP GG PPP Sbjct: 569 PPLPGGAPLPPPPPPLPGMMGIPPPPPPPLLFGGPPPPPPLGGVPPPP 616 Score = 39.1 bits (87), Expect = 0.12 Identities = 21/54 (38%), Positives = 21/54 (38%), Gaps = 4/54 (7%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXXPPPPPXXXXXXS----PPPPXXGGGXPPPPP 530 PP G G P PPPPP PPPP GG PPPPP Sbjct: 555 PPLPGVGPPPPPPAPPLPGGAPLPPPPPPLPGMMGIPPPPPPPLLFGGPPPPPP 608 Score = 38.7 bits (86), Expect = 0.16 Identities = 18/38 (47%), Positives = 18/38 (47%), Gaps = 3/38 (7%) Frame = +1 Query: 433 PXGXXXPPPPPXXXKXXX---PPPPXXGXXXPPPPPPL 537 P G PPPPP PPPP PPPPPPL Sbjct: 572 PGGAPLPPPPPPLPGMMGIPPPPPPPLLFGGPPPPPPL 609 Score = 35.1 bits (77), Expect = 2.0 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = +3 Query: 435 PXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 P PP P PP P GG P PPP P PP Sbjct: 549 PGPPAAPPLPGVGPPPPPPAPPLPGGAPLPPPPPPLPGMMGIPP 592 Score = 35.1 bits (77), Expect = 2.0 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPPP P PP G PPPPP PP Sbjct: 555 PPLPGVGPPPPP-------PAPPLPGGAPLPPPPPPLPGMMGIPPP 593 Score = 34.7 bits (76), Expect = 2.6 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +2 Query: 431 PPXGXXXPPPPXXXXKXXXPPPXXXGXXXPPPPXPXXXXXXXXPPP 568 PP PP P PPP PPPP P PPP Sbjct: 562 PPPPPPAPPLPGGAPLPPPPPPLPGMMGIPPPPPPPLLFGGPPPPP 607 Score = 33.9 bits (74), Expect = 4.6 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPP 528 PPPPP PPPP PPPP Sbjct: 591 PPPPPPPLLFGGPPPPPPLGGVPPPP 616 >UniRef50_UPI00015B5315 Cluster: PREDICTED: similar to Heterogeneous nuclear ribonucleoprotein K; n=1; Nasonia vitripennis|Rep: PREDICTED: similar to Heterogeneous nuclear ribonucleoprotein K - Nasonia vitripennis Length = 445 Score = 41.5 bits (93), Expect = 0.023 Identities = 26/67 (38%), Positives = 27/67 (40%), Gaps = 2/67 (2%) Frame = -1 Query: 530 GGGGGXSXPXXGGGGXXXXXXXGGGGGXXXPXGGXXXXXKXXPPPPPPGGXXXTP--XGG 357 GG G P GGGG GGGGG GG + PP PPGG P GG Sbjct: 160 GGYGENGQPAGGGGG-------GGGGGPGGKPGGGFGGGRGGPPNAPPGGGPGGPMNRGG 212 Query: 356 XPPPXXG 336 P G Sbjct: 213 RPDNRGG 219 Score = 41.1 bits (92), Expect = 0.030 Identities = 25/71 (35%), Positives = 25/71 (35%), Gaps = 1/71 (1%) Frame = -1 Query: 566 GGXXAXXXXXRGGGGGGXSXPXXG-GGGXXXXXXXGGGGGXXXPXGGXXXXXKXXPPPPP 390 GG GGGGGG P G GGG G GGG GG PP Sbjct: 248 GGMSGPDRGFGGGGGGGGGNPRGGIGGGNFGGDRGGNGGGPGMGGGGGGGFNGNRGGPPY 307 Query: 389 PGGXXXTPXGG 357 GG GG Sbjct: 308 SGGGGGGAGGG 318 Score = 35.9 bits (79), Expect = 1.1 Identities = 20/59 (33%), Positives = 20/59 (33%) Frame = -1 Query: 533 GGGGGGXSXPXXGGGGXXXXXXXGGGGGXXXPXGGXXXXXKXXPPPPPPGGXXXTPXGG 357 GGGGGG GGG GGG GG PP GG GG Sbjct: 261 GGGGGGNPRGGIGGGNFGGDRGGNGGGPGMGGGGGGGFNGNRGGPPYSGGGGGGAGGGG 319 Score = 33.9 bits (74), Expect = 4.6 Identities = 20/50 (40%), Positives = 20/50 (40%), Gaps = 5/50 (10%) Frame = -2 Query: 565 GGXXXXAXXXGXGGGG-----GXPPPXXGGGGXXFXXXXGGGGGXXPXGG 431 GG G GGGG G PP GGGG GGGGG G Sbjct: 282 GGNGGGPGMGGGGGGGFNGNRGGPPYSGGGGGGAGGGGGGGGGGNYNGNG 331 Score = 33.1 bits (72), Expect = 8.1 Identities = 18/35 (51%), Positives = 18/35 (51%) Frame = -1 Query: 533 GGGGGGXSXPXXGGGGXXXXXXXGGGGGXXXPXGG 429 GG GGG S P G GG GGGGG P GG Sbjct: 244 GGRGGGMSGPDRGFGG-------GGGGGGGNPRGG 271 >UniRef50_UPI0000F2D497 Cluster: PREDICTED: similar to Proline-rich protein 12; n=1; Monodelphis domestica|Rep: PREDICTED: similar to Proline-rich protein 12 - Monodelphis domestica Length = 1104 Score = 41.5 bits (93), Expect = 0.023 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = +3 Query: 435 PXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 P G PPP P SPPPP PPPP P PP Sbjct: 548 PSGSGPPPSPSKSANFSPPPPQPPPPPPPPPALPPVPMALLPPP 591 Score = 36.7 bits (81), Expect = 0.65 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PPP P PPPP PPPPP L A PP Sbjct: 553 PPPSPSKSANFSPPPPQP-PPPPPPPPALPPVPMALLPP 590 >UniRef50_Q640S7 Cluster: Fmnl1 protein; n=3; Xenopus|Rep: Fmnl1 protein - Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) Length = 1167 Score = 41.5 bits (93), Expect = 0.023 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 2/47 (4%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXG--GGXPPPPPXPXXXAXXXXPP 566 P PPPPP PPPP G PPPPP P PP Sbjct: 611 PSIAEIPPPPPLPMSADVPPPPPLPELSGIPPPPPLPMGEQGAPPPP 657 Score = 40.7 bits (91), Expect = 0.040 Identities = 19/44 (43%), Positives = 20/44 (45%), Gaps = 2/44 (4%) Frame = +3 Query: 441 GXXPPPPPXXXXXXSPPPPXXGG--GXPPPPPXPXXXAXXXXPP 566 G PPPP +PPPP G G PPPPP P PP Sbjct: 639 GIPPPPPLPMGEQGAPPPPPSMGAPGVPPPPPPPPSGFGPAPPP 682 Score = 38.7 bits (86), Expect = 0.16 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 2/41 (4%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPP--XXGGGXPPPPPXPXXXAXXXXPP 566 PPPPP PPPP PPPPP P PP Sbjct: 605 PPPPPLPSIAEIPPPPPLPMSADVPPPPPLPELSGIPPPPP 645 Score = 38.3 bits (85), Expect = 0.21 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 2/47 (4%) Frame = +1 Query: 433 PXGXXXPPPPPXXXKXXXPPPPXX--GXXXPPPPPPLXXXXXAXXPP 567 P PPPPP PPPP G PPPPP PP Sbjct: 623 PMSADVPPPPPLPELSGIPPPPPLPMGEQGAPPPPPSMGAPGVPPPP 669 Score = 36.7 bits (81), Expect = 0.65 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PPPP PPPP PPPPPL PP Sbjct: 606 PPPPLPSIAEIPPPPPLPMSADVPPPPPLPELSGIPPPP 644 Score = 36.3 bits (80), Expect = 0.86 Identities = 18/48 (37%), Positives = 18/48 (37%), Gaps = 3/48 (6%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXG---GGXPPPPPXPXXXAXXXXPP 566 P PPPPP PPPP G PPPPP PP Sbjct: 623 PMSADVPPPPPLPELSGIPPPPPLPMGEQGAPPPPPSMGAPGVPPPPP 670 Score = 35.1 bits (77), Expect = 2.0 Identities = 16/42 (38%), Positives = 17/42 (40%), Gaps = 3/42 (7%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXX---GXXXPPPPPPLXXXXXAXXPP 567 PPPPP PPPP PPPP P+ PP Sbjct: 617 PPPPPLPMSADVPPPPPLPELSGIPPPPPLPMGEQGAPPPPP 658 Score = 35.1 bits (77), Expect = 2.0 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 441 GXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 G PPPP PPPP G P PP P Sbjct: 652 GAPPPPPSMGAPGVPPPPPPPPSGFGPAPPPP 683 Score = 34.7 bits (76), Expect = 2.6 Identities = 15/31 (48%), Positives = 15/31 (48%), Gaps = 2/31 (6%) Frame = +3 Query: 450 PPPPPXXXXXX--SPPPPXXGGGXPPPPPXP 536 PPPPP PPPP G P PPP P Sbjct: 654 PPPPPSMGAPGVPPPPPPPPSGFGPAPPPPP 684 >UniRef50_Q91BL3 Cluster: Essential structural protein pp78/81; n=2; Nucleopolyhedrovirus|Rep: Essential structural protein pp78/81 - Spodoptera litura multicapsid nucleopolyhedrovirus (SpltMNPV) Length = 548 Score = 41.5 bits (93), Expect = 0.023 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = +1 Query: 433 PXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPP 534 P PPPPP PPPP PPPPPP Sbjct: 235 PTQILPPPPPPLPQSIMPPPPPIMPPPPPPPPPP 268 >UniRef50_Q743K0 Cluster: Putative uncharacterized protein; n=2; Mycobacterium avium|Rep: Putative uncharacterized protein - Mycobacterium paratuberculosis Length = 341 Score = 41.5 bits (93), Expect = 0.023 Identities = 24/69 (34%), Positives = 24/69 (34%), Gaps = 4/69 (5%) Frame = -1 Query: 530 GGGGGXSXPXXGGGGXXXXXXXGGGG----GXXXPXGGXXXXXKXXPPPPPPGGXXXTPX 363 GGGG P G GG G GG G P GG P PP G P Sbjct: 44 GGGGNPGGPGGGPGGQPAGPGGGAGGQHGGGNTPPQGGQNNPPPNGPNNPPQNGPNNAPQ 103 Query: 362 GGXPPPXXG 336 GG P G Sbjct: 104 GGQNNPPQG 112 Score = 33.1 bits (72), Expect = 8.1 Identities = 21/64 (32%), Positives = 22/64 (34%), Gaps = 5/64 (7%) Frame = -1 Query: 533 GGGGGGXSXPXXGGGGXXXXXXXGG-----GGGXXXPXGGXXXXXKXXPPPPPPGGXXXT 369 GG GGG G GG GG GG P G + P P GG Sbjct: 50 GGPGGGPGGQPAGPGGGAGGQHGGGNTPPQGGQNNPPPNGPNNPPQNGPNNAPQGGQNNP 109 Query: 368 PXGG 357 P GG Sbjct: 110 PQGG 113 >UniRef50_Q4USI3 Cluster: Serine protease; n=9; Xanthomonadaceae|Rep: Serine protease - Xanthomonas campestris pv. campestris (strain 8004) Length = 966 Score = 41.5 bits (93), Expect = 0.023 Identities = 21/49 (42%), Positives = 21/49 (42%) Frame = +3 Query: 390 GGGGGXXFXXXGXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 GGGGG PP PPPPP SPPPP PPP P Sbjct: 39 GGGGGIRPSTPTAPPPTSPPPPPPPT-----SPPPPTTAPTPPPPTTVP 82 Score = 33.5 bits (73), Expect = 6.1 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = -1 Query: 464 GGGGGXXXPXGGXXXXXKXXPPPPPPGGXXXTPXGGXPPP 345 GGGGG P PPPPPP PPP Sbjct: 38 GGGGGGIRPSTPTAPPPTSPPPPPPPTSPPPPTTAPTPPP 77 >UniRef50_Q6H7U3 Cluster: Putative formin I2I isoform; n=2; Oryza sativa|Rep: Putative formin I2I isoform - Oryza sativa subsp. japonica (Rice) Length = 881 Score = 41.5 bits (93), Expect = 0.023 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPP 530 PP PPPPP PPPP G PP PP Sbjct: 358 PPPPPPPPPPPPPPRPPPPPPPIKKGAPPPAPP 390 Score = 41.1 bits (92), Expect = 0.030 Identities = 16/38 (42%), Positives = 17/38 (44%) Frame = +1 Query: 454 PPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PPPP PPPP PPPPPP+ PP Sbjct: 353 PPPPPPPPPPPPPPPPPPPRPPPPPPPIKKGAPPPAPP 390 Score = 40.7 bits (91), Expect = 0.040 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPP 534 PP PPPPP PPPP PPP PP Sbjct: 356 PPPPPPPPPPPPPPPPRPPPPPPPIKKGAPPPAPP 390 Score = 37.1 bits (82), Expect = 0.50 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPPP 530 PPPPP PPPP PPPPP Sbjct: 353 PPPPPPPPPPPPPPPPPPPRPPPPPPP 379 Score = 36.7 bits (81), Expect = 0.65 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPP 534 PP PPPPP PPPP PPP P Sbjct: 355 PPPPPPPPPPPPPPPPPRPPPPPPPIKKGAPPPAP 389 >UniRef50_Q1EP07 Cluster: Putative uncharacterized protein; n=1; Musa acuminata|Rep: Putative uncharacterized protein - Musa acuminata (Banana) Length = 390 Score = 41.5 bits (93), Expect = 0.023 Identities = 18/35 (51%), Positives = 18/35 (51%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 PP G PPPPP PPPP PPPPP P Sbjct: 190 PPPGPEPPPPP----APEPPPPPAPEPPPPPPPKP 220 Score = 40.7 bits (91), Expect = 0.040 Identities = 16/35 (45%), Positives = 17/35 (48%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 PP P PPP +P PP G PPPPP P Sbjct: 160 PPPEPEPAPPPPEPAPPTPEPPPPPGPEPPPPPGP 194 Score = 39.5 bits (88), Expect = 0.093 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPP PPPP G PPPP P A PP Sbjct: 161 PPEPEPAPPPPEPAPPTPEPPPP-PGPEPPPPPGPEPPPPPAPEPP 205 Score = 38.7 bits (86), Expect = 0.16 Identities = 17/38 (44%), Positives = 17/38 (44%), Gaps = 3/38 (7%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXP---PPPXXGXXXPPPPPP 534 PP PPPPP P PPP PPPPPP Sbjct: 181 PPPPGPEPPPPPGPEPPPPPAPEPPPPPAPEPPPPPPP 218 Score = 37.5 bits (83), Expect = 0.37 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PP P PPP G PPPP P A PP Sbjct: 168 PPPPEPAPPTPEPPPPPGPEPPPPPGPEPPPPPAPEPPPPPAPEPP 213 Score = 36.3 bits (80), Expect = 0.86 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP P P P PPPP PPP P P PP Sbjct: 170 PPEPAPPTPEPPPPPGPEPPPPPGPEPPPPPAPEPPPPPAPEPPP 214 Score = 35.5 bits (78), Expect = 1.5 Identities = 16/38 (42%), Positives = 17/38 (44%), Gaps = 3/38 (7%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPP---PPXXGXXXPPPPPP 534 PP PPPP + PP PP PPPPPP Sbjct: 180 PPPPPGPEPPPPPGPEPPPPPAPEPPPPPAPEPPPPPP 217 Score = 33.9 bits (74), Expect = 4.6 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +3 Query: 423 GXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPPP 524 G PP P PPP PPPP PPP Sbjct: 193 GPEPPPPPAPEPPPPPAPEPPPPPPPKPDPTPPP 226 >UniRef50_Q01DC8 Cluster: Plg protein; n=2; Eukaryota|Rep: Plg protein - Ostreococcus tauri Length = 3738 Score = 41.5 bits (93), Expect = 0.023 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPPP PPPP PPPPPP PP Sbjct: 6 PPPAPPSPPPPP-----SPPPPPSPAPPSPPPPPPSPPPPSPPPPP 46 Score = 36.7 bits (81), Expect = 0.65 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP P PPP SPPPP PPPP P PP Sbjct: 5 PPPPAPPSPPP----PPSPPPPPSPAPPSPPPPPPSPPPPSPPPP 45 Score = 36.7 bits (81), Expect = 0.65 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPP 527 PP P PPP SPPPP PPPP Sbjct: 1809 PPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPP 1840 Score = 35.9 bits (79), Expect = 1.1 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPP 528 PP P PPP PPPP PPPP Sbjct: 1808 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPP 1840 Score = 35.5 bits (78), Expect = 1.5 Identities = 20/51 (39%), Positives = 20/51 (39%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPPXXXXXG 584 PP PPPPP SPPPP PP PP P PP G Sbjct: 7 PPAPPSPPPPP------SPPPPPSPA--PPSPPPPPPSPPPPSPPPPPGMG 49 Score = 35.1 bits (77), Expect = 2.0 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 P PPP SPPPP PPPP P Sbjct: 1810 PSPPPPSPPPPSPPPPSPPPPSPPPPSPP 1838 >UniRef50_A7QNX2 Cluster: Chromosome chr1 scaffold_135, whole genome shotgun sequence; n=4; Magnoliophyta|Rep: Chromosome chr1 scaffold_135, whole genome shotgun sequence - Vitis vinifera (Grape) Length = 673 Score = 41.5 bits (93), Expect = 0.023 Identities = 19/48 (39%), Positives = 19/48 (39%), Gaps = 3/48 (6%) Frame = +3 Query: 432 PPXGXXPPP---PPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPP PP PPPP G PP PP P PP Sbjct: 71 PPKSESPPPTPPPPSPSPPPPPPPPPSSGSGPPKPPPPSHSNSSPPPP 118 Score = 41.5 bits (93), Expect = 0.023 Identities = 19/45 (42%), Positives = 20/45 (44%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP G G P PPP + PP Sbjct: 82 PPPSPSPPPPP-------PPPPSSGSGPPKPPPPSHSNSSPPPPP 119 Score = 39.9 bits (89), Expect = 0.070 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PPPP PPPP PPPPPP PP Sbjct: 69 PPPPKSESPPPTPPPPSPSPPPPPPPPPSSGSGPPKPPP 107 Score = 39.1 bits (87), Expect = 0.12 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PPPP PPPP G P PPPP PP Sbjct: 81 PPPPSPSPPPPPPPPPSSGSGPPKPPPPSHSNSSPPPPP 119 Score = 38.7 bits (86), Expect = 0.16 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPP 534 PP PP PP PP P PPPPPP Sbjct: 59 PPDSNTSPPSPPPPKSESPPPTPPPPSPSPPPPPP 93 Score = 38.3 bits (85), Expect = 0.21 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 1/46 (2%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXP-PPPPXPXXXAXXXXPP 566 PP PPP SPPPP P PPPP P PP Sbjct: 51 PPPSDSSPPPDSNTSPPSPPPPKSESPPPTPPPPSPSPPPPPPPPP 96 Score = 37.5 bits (83), Expect = 0.37 Identities = 15/39 (38%), Positives = 16/39 (41%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PPPP +PPPP PPPPP PP Sbjct: 69 PPPPKSESPPPTPPPPSPSPPPPPPPPPSSGSGPPKPPP 107 Score = 36.3 bits (80), Expect = 0.86 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPP PPPP P PPPP PP Sbjct: 50 PPPPSDSSPPPDSNTSPPSPPPPKSESPPPTPPPPSPSPPPPPPPP 95 Score = 35.5 bits (78), Expect = 1.5 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PP P K PPP PPPPP PP Sbjct: 58 PPPDSNTSPPSPPPPKSESPPPTPPPPSPSPPPPPPPPPSSGSGPP 103 Score = 33.9 bits (74), Expect = 4.6 Identities = 17/48 (35%), Positives = 17/48 (35%), Gaps = 3/48 (6%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPP---PPXPXXXAXXXXPP 566 PP PPPP S PPP PPP P P PP Sbjct: 23 PPKSSTSPPPPPDDDSPSAPPPTSKTSPPPPSDSSPPPDSNTSPPSPP 70 Score = 33.5 bits (73), Expect = 6.1 Identities = 16/40 (40%), Positives = 16/40 (40%), Gaps = 5/40 (12%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXS-----PPPPXXGGGXPPPPPXP 536 PP PPPPP S PPP PPPP P Sbjct: 83 PPSPSPPPPPPPPPSSGSGPPKPPPPSHSNSSPPPPPTSP 122 >UniRef50_A4S6G3 Cluster: Predicted protein; n=2; Eukaryota|Rep: Predicted protein - Ostreococcus lucimarinus CCE9901 Length = 2146 Score = 41.5 bits (93), Expect = 0.023 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPP P SPPPP PPP P P PP Sbjct: 915 PPSPSPPPPSPPSPSPPSPPPPPPVPSPPPPSPPPPSPPPLPPPP 959 Score = 39.9 bits (89), Expect = 0.070 Identities = 18/45 (40%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PP PP SPPPP PPPP P + PP Sbjct: 880 PPPSPPPPSPPPPSPLPSPPPPSP-PSPSPPPPSPLPPSPSPPPP 923 Score = 38.3 bits (85), Expect = 0.21 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP P PPP PPPP P PPPP PP Sbjct: 889 PPPPSPLPSPPPPSPPSPSPPPPSPLPPSPSPPPPSPPSPSPPSPP 934 Score = 37.9 bits (84), Expect = 0.28 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 2/46 (4%) Frame = +3 Query: 435 PXGXXPPPPPXXXXXXSPPPPXXGGGXP--PPPPXPXXXAXXXXPP 566 P PPPP SPPPP P PPPP P PP Sbjct: 903 PPSPSPPPPSPLPPSPSPPPPSPPSPSPPSPPPPPPVPSPPPPSPP 948 Score = 37.9 bits (84), Expect = 0.28 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +1 Query: 433 PXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPP 534 P PPPPP PPP PPPPPP Sbjct: 928 PSPPSPPPPPPVPSPPPPSPPPPSPPPLPPPPPP 961 Score = 37.5 bits (83), Expect = 0.37 Identities = 16/45 (35%), Positives = 17/45 (37%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPP PPP PPPP P + PP Sbjct: 891 PPSPLPSPPPPSPPSPSPPPPSPLPPSPSPPPPSPPSPSPPSPPP 935 Score = 37.1 bits (82), Expect = 0.50 Identities = 19/49 (38%), Positives = 20/49 (40%), Gaps = 4/49 (8%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXX---GGGXPPP-PPXPXXXAXXXXPP 566 PP P PPP SPPPP PPP PP P + PP Sbjct: 890 PPPSPLPSPPPPSPPSPSPPPPSPLPPSPSPPPPSPPSPSPPSPPPPPP 938 Score = 37.1 bits (82), Expect = 0.50 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPP 534 PPPP PPPP PPPPPP Sbjct: 935 PPPPVPSPPPPSPPPPSPPPLPPPPPPP 962 Score = 35.5 bits (78), Expect = 1.5 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP P PPP SP PP P PP P PP Sbjct: 900 PPSPPSPSPPPPSPLPPSPSPPPPSPPSPSPPSPPPPPPVPSPPP 944 Score = 35.5 bits (78), Expect = 1.5 Identities = 19/49 (38%), Positives = 20/49 (40%), Gaps = 4/49 (8%) Frame = +3 Query: 432 PPXGXXPP---PPPXXXXXXSPPPPXXGGGXP-PPPPXPXXXAXXXXPP 566 PP PP PPP SPP P P PPPP P + PP Sbjct: 909 PPPSPLPPSPSPPPPSPPSPSPPSPPPPPPVPSPPPPSPPPPSPPPLPP 957 Score = 35.5 bits (78), Expect = 1.5 Identities = 17/47 (36%), Positives = 17/47 (36%), Gaps = 1/47 (2%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXX-GXXXPPPPPPLXXXXXAXXPP 567 PP PP PP PPPP P PPPP PP Sbjct: 915 PPSPSPPPPSPPSPSPPSPPPPPPVPSPPPPSPPPPSPPPLPPPPPP 961 Score = 35.5 bits (78), Expect = 1.5 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = +3 Query: 435 PXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 P PP PP SPPPP P PPP P PP Sbjct: 925 PPSPSPPSPPPPPPVPSPPPPSPP--PPSPPPLPPPPPPPSPPP 966 Score = 35.5 bits (78), Expect = 1.5 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 PP PPP P PPP PPPPP P Sbjct: 930 PPSPPPPPPVPSPPPPSPPPPSPPPLPPPPPPPSP 964 Score = 35.1 bits (77), Expect = 2.0 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PP SPPPP PP P P PP Sbjct: 681 PPSPPIVQPSPSPPPPVEVPSPSPPSPSPPVEVPSPSPP 719 Score = 34.7 bits (76), Expect = 2.6 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPL 537 PP PPPP PPPP PPPP PL Sbjct: 881 PPSPPPPSPPPP--SPLPSPPPPSPPSPSPPPPSPL 914 Score = 34.7 bits (76), Expect = 2.6 Identities = 17/51 (33%), Positives = 18/51 (35%), Gaps = 5/51 (9%) Frame = +1 Query: 430 PPXGXXXPPPP-----PXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP P PP P P PP PPPPPP+ PP Sbjct: 899 PPPSPPSPSPPPPSPLPPSPSPPPPSPPSPSPPSPPPPPPVPSPPPPSPPP 949 Score = 34.3 bits (75), Expect = 3.5 Identities = 18/51 (35%), Positives = 18/51 (35%), Gaps = 6/51 (11%) Frame = +1 Query: 433 PXGXXXPPPPPXXXKXXXPPPPXXGXXXPPP------PPPLXXXXXAXXPP 567 P PPP P PPPP PPP PPPL PP Sbjct: 915 PPSPSPPPPSPPSPSPPSPPPPPPVPSPPPPSPPPPSPPPLPPPPPPPSPP 965 Score = 33.9 bits (74), Expect = 4.6 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 1/45 (2%) Frame = +3 Query: 435 PXGXXPPPPPXXXXXXSPPP-PXXGGGXPPPPPXPXXXAXXXXPP 566 P PP PP SPPP P P PPP P PP Sbjct: 714 PSPSPPPQPPVEVPSPSPPPQPPVEVPSPSPPPQPPVEVPSPSPP 758 Score = 33.9 bits (74), Expect = 4.6 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 1/45 (2%) Frame = +3 Query: 435 PXGXXPPPPPXXXXXXSPPP-PXXGGGXPPPPPXPXXXAXXXXPP 566 P PP PP SPPP P P PPP P PP Sbjct: 727 PSPSPPPQPPVEVPSPSPPPQPPVEVPSPSPPPQPPVEVPSPSPP 771 Score = 33.9 bits (74), Expect = 4.6 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 1/45 (2%) Frame = +3 Query: 435 PXGXXPPPPPXXXXXXSPPP-PXXGGGXPPPPPXPXXXAXXXXPP 566 P PP PP SPPP P P PPP P PP Sbjct: 740 PSPSPPPQPPVEVPSPSPPPQPPVEVPSPSPPPQPPVEVPSPPPP 784 Score = 33.9 bits (74), Expect = 4.6 Identities = 15/45 (33%), Positives = 15/45 (33%) Frame = +1 Query: 433 PXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 P PPPP P PP P PPPP PP Sbjct: 878 PSPPPSPPPPSPPPPSPLPSPPPPSPPSPSPPPPSPLPPSPSPPP 922 Score = 33.9 bits (74), Expect = 4.6 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPL 537 PP P PPP PPP P PPPP+ Sbjct: 933 PPPPPPVPSPPPPSPPPPSPPPLPPPPPPPSPPPPV 968 Score = 33.5 bits (73), Expect = 6.1 Identities = 14/30 (46%), Positives = 15/30 (50%), Gaps = 1/30 (3%) Frame = +1 Query: 451 PPPPPXXXKXXXPPP-PXXGXXXPPPPPPL 537 PP PP PPP P PPPPPP+ Sbjct: 758 PPQPPVEVPSPSPPPQPPVEVPSPPPPPPV 787 >UniRef50_A2X6K1 Cluster: Putative uncharacterized protein; n=3; Oryza sativa|Rep: Putative uncharacterized protein - Oryza sativa subsp. indica (Rice) Length = 134 Score = 41.5 bits (93), Expect = 0.023 Identities = 25/74 (33%), Positives = 26/74 (35%) Frame = -1 Query: 566 GGXXAXXXXXRGGGGGGXSXPXXGGGGXXXXXXXGGGGGXXXPXGGXXXXXKXXPPPPPP 387 GG GGGGGG GGGG GGGGG GG PP Sbjct: 39 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGYYPPWN 98 Query: 386 GGXXXTPXGGXPPP 345 GG + G P Sbjct: 99 GGYYPSGPGHHHDP 112 Score = 38.7 bits (86), Expect = 0.16 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = -1 Query: 566 GGXXAXXXXXRGGGGGGXSXPXXGGGGXXXXXXXGGGGGXXXPXGG 429 GG GGGGGG GGGG GGGGG GG Sbjct: 32 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 77 Score = 38.7 bits (86), Expect = 0.16 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = -1 Query: 566 GGXXAXXXXXRGGGGGGXSXPXXGGGGXXXXXXXGGGGGXXXPXGG 429 GG GGGGGG GGGG GGGGG GG Sbjct: 33 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 78 Score = 38.7 bits (86), Expect = 0.16 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = -1 Query: 566 GGXXAXXXXXRGGGGGGXSXPXXGGGGXXXXXXXGGGGGXXXPXGG 429 GG GGGGGG GGGG GGGGG GG Sbjct: 34 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 79 Score = 38.7 bits (86), Expect = 0.16 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = -1 Query: 566 GGXXAXXXXXRGGGGGGXSXPXXGGGGXXXXXXXGGGGGXXXPXGG 429 GG GGGGGG GGGG GGGGG GG Sbjct: 35 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 80 Score = 38.7 bits (86), Expect = 0.16 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = -1 Query: 566 GGXXAXXXXXRGGGGGGXSXPXXGGGGXXXXXXXGGGGGXXXPXGG 429 GG GGGGGG GGGG GGGGG GG Sbjct: 36 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 81 Score = 38.7 bits (86), Expect = 0.16 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = -1 Query: 566 GGXXAXXXXXRGGGGGGXSXPXXGGGGXXXXXXXGGGGGXXXPXGG 429 GG GGGGGG GGGG GGGGG GG Sbjct: 37 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 82 Score = 38.7 bits (86), Expect = 0.16 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = -1 Query: 566 GGXXAXXXXXRGGGGGGXSXPXXGGGGXXXXXXXGGGGGXXXPXGG 429 GG GGGGGG GGGG GGGGG GG Sbjct: 38 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 83 Score = 38.3 bits (85), Expect = 0.21 Identities = 20/51 (39%), Positives = 20/51 (39%) Frame = -2 Query: 583 PXXXXXGGXXXXAXXXGXGGGGGXPPPXXGGGGXXFXXXXGGGGGXXPXGG 431 P GG G GGGGG GGGG GGGGG GG Sbjct: 26 PQANKQGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 76 Score = 37.9 bits (84), Expect = 0.28 Identities = 17/36 (47%), Positives = 18/36 (50%) Frame = -1 Query: 536 RGGGGGGXSXPXXGGGGXXXXXXXGGGGGXXXPXGG 429 +GGGGGG GGGG GGGGG GG Sbjct: 31 QGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 66 >UniRef50_Q5CS67 Cluster: Signal peptide containing large protein with proline stretches; n=2; Cryptosporidium|Rep: Signal peptide containing large protein with proline stretches - Cryptosporidium parvum Iowa II Length = 1884 Score = 41.5 bits (93), Expect = 0.023 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPP 534 P G PPPPP PPPP PPP PP Sbjct: 1413 PSSGSSAPPPPPHSPPPPPPPPPPSSPPSPPPSPP 1447 Score = 39.5 bits (88), Expect = 0.093 Identities = 20/52 (38%), Positives = 20/52 (38%), Gaps = 2/52 (3%) Frame = +3 Query: 387 RGGGGGXXFXXXGXXPPXGXX--PPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 R GG G PP PPPPP PPPP P PPP P Sbjct: 1522 RAGGFGNGKRTPPHPPPSSGSSAPPPPPPPPPPPPPPPPPPPSPPPSPPPSP 1573 Score = 39.1 bits (87), Expect = 0.12 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 P PPP PPPP PPPPPP PP Sbjct: 1409 PHPPPSSGSSAPPPPPHSPPPPPPPPPPSSPPSPPPSPP 1447 Score = 39.1 bits (87), Expect = 0.12 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = +1 Query: 439 GXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 G PP PP PPPP PPPPPP PP Sbjct: 1529 GKRTPPHPPPSSGSSAPPPPPPPPPPPPPPPPPPPSPPPSPPP 1571 Score = 38.3 bits (85), Expect = 0.21 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +3 Query: 423 GXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 G PP PPP PPPP PPPPP P Sbjct: 1162 GQRPPSPPHPPPSSGSFTPPPPPPPPPPPPPPPPPPPP 1199 Score = 38.3 bits (85), Expect = 0.21 Identities = 17/38 (44%), Positives = 18/38 (47%) Frame = +3 Query: 423 GXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 G PP PP PP +PPPP PPPPP P Sbjct: 1402 GQRPPS---PPHPPPSSGSSAPPPPPHSPPPPPPPPPP 1436 Score = 38.3 bits (85), Expect = 0.21 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPP 534 PP PPPP PPPP PP PPP Sbjct: 1537 PPSSGSSAPPPPPPPPPPPPPPPPPPPSPPPSPPP 1571 Score = 37.1 bits (82), Expect = 0.50 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 PPPPP PPPP PPP P P Sbjct: 1420 PPPPPHSPPPPPPPPPPSSPPSPPPSPPP 1448 Score = 36.7 bits (81), Expect = 0.65 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = +3 Query: 435 PXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 P G PP PP PPP G PPPPP P PP Sbjct: 1160 PFGQRPPSPPH-------PPPSSGSFTPPPPPPPPPPPPPPPPP 1196 >UniRef50_Q38EF1 Cluster: Putative uncharacterized protein; n=1; Trypanosoma brucei|Rep: Putative uncharacterized protein - Trypanosoma brucei Length = 576 Score = 41.5 bits (93), Expect = 0.023 Identities = 23/65 (35%), Positives = 24/65 (36%), Gaps = 3/65 (4%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXX-PPPPPXXXXXXSPPP--PXXGGGXPPPPPXPXXXAX 551 P G G PP PPPPP +PPP P PPPPP P A Sbjct: 502 PASGPSKGMAINRNAPAPPQKGGVPPPPPPPPPPKAPPPKGPPPKVAPPPPPPPPPPPAP 561 Query: 552 XXXPP 566 PP Sbjct: 562 GKLPP 566 Score = 40.3 bits (90), Expect = 0.053 Identities = 19/48 (39%), Positives = 19/48 (39%), Gaps = 2/48 (4%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPP--PXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPPP PPP P PPPPPP PP Sbjct: 519 PPQKGGVPPPPPPPPPPKAPPPKGPPPKVAPPPPPPPPPPPAPGKLPP 566 Score = 35.5 bits (78), Expect = 1.5 Identities = 19/47 (40%), Positives = 20/47 (42%), Gaps = 2/47 (4%) Frame = +1 Query: 433 PXGXXXPPPPPXXXKXXX--PPPPXXGXXXPPPPPPLXXXXXAXXPP 567 P G PPPPP + PPPP PPPPP A PP Sbjct: 364 PSGLPPPPPPPGGLRPPGKAPPPP------PPPPPMFAGKMKAPPPP 404 Score = 35.5 bits (78), Expect = 1.5 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = +3 Query: 423 GXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 G P G PPPPP PPPP G PPP P Sbjct: 375 GGLRPPGKAPPPPP-------PPPPMFAGKMKAPPPPP 405 Score = 35.1 bits (77), Expect = 2.0 Identities = 16/35 (45%), Positives = 17/35 (48%) Frame = +1 Query: 433 PXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPL 537 P G PPPPP PPP G PPPPP+ Sbjct: 379 PPGKAPPPPPP-------PPPMFAGKMKAPPPPPI 406 Score = 33.5 bits (73), Expect = 6.1 Identities = 21/61 (34%), Positives = 21/61 (34%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXX 560 PP GG G PP PPPPP PPP PP P P A Sbjct: 372 PPPGG-----LRPPGKAPPP--PPPPPPMFAGKMKAPPPPPIKAPPPMPSLPGAAATKGL 424 Query: 561 P 563 P Sbjct: 425 P 425 >UniRef50_A7SGL4 Cluster: Predicted protein; n=1; Nematostella vectensis|Rep: Predicted protein - Nematostella vectensis Length = 620 Score = 41.5 bits (93), Expect = 0.023 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPP 530 PP PPPPP PPPP PPPPP Sbjct: 429 PPPPPPPPPPPCPVPCPPPPPPPPPSPPPPPPP 461 Score = 41.1 bits (92), Expect = 0.030 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = +1 Query: 433 PXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPP 534 P PPPPP PPPP PPPPPP Sbjct: 427 PCPPPPPPPPPPPCPVPCPPPPPPPPPSPPPPPP 460 Score = 41.1 bits (92), Expect = 0.030 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = +1 Query: 433 PXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPP 534 P PPPPP PPPP PPPPPP Sbjct: 429 PPPPPPPPPPPCPVPCPPPPPPPPPSPPPPPPPP 462 Score = 39.9 bits (89), Expect = 0.070 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 PP PPPP PPPP PPPPP P Sbjct: 430 PPPPPPPPPPCPVPCPPPPPPPPPSPPPPPPPPCP 464 Score = 39.1 bits (87), Expect = 0.12 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPPP PPPP PPPPPP PP Sbjct: 422 PPCPVPCPPPPPPP-----PPPPCPVPCPPPPPPPPPSPPPPPPPP 462 Score = 37.1 bits (82), Expect = 0.50 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 1/46 (2%) Frame = +3 Query: 432 PPXGXXPP-PPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PP P P PPPP PPPPP P PP Sbjct: 416 PPSPPPPPCPVPCPPPPPPPPPPPCPVPCPPPPPPPPPSPPPPPPP 461 Score = 36.3 bits (80), Expect = 0.86 Identities = 18/48 (37%), Positives = 18/48 (37%), Gaps = 3/48 (6%) Frame = +1 Query: 433 PXGXXXPPPPPXXXKXXXPPPPXXGXXXP---PPPPPLXXXXXAXXPP 567 P PPPPP PPPP P PPPPP PP Sbjct: 413 PYTPPSPPPPPCPVPCPPPPPPPPPPPCPVPCPPPPPPPPPSPPPPPP 460 Score = 35.1 bits (77), Expect = 2.0 Identities = 18/50 (36%), Positives = 18/50 (36%), Gaps = 4/50 (8%) Frame = +1 Query: 430 PPXGXXXPPP----PPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPP P PPPP PPPPPP PP Sbjct: 397 PPPPAPYPPPSAPYPAPYTPPSPPPPPCPVPCPPPPPPPPPPPCPVPCPP 446 Score = 34.7 bits (76), Expect = 2.6 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 PP PPP P PPPP G PPPP P Sbjct: 183 PPGVLAPPPAPPGVL---PPPPAPPGALIPPPPAP 214 Score = 34.7 bits (76), Expect = 2.6 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +1 Query: 433 PXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 P P PPP PPPP PPPPPP PP Sbjct: 411 PAPYTPPSPPPPPCPVPCPPPPP-----PPPPPPCPVPCPPPPPP 450 Score = 33.5 bits (73), Expect = 6.1 Identities = 19/51 (37%), Positives = 19/51 (37%), Gaps = 6/51 (11%) Frame = +3 Query: 432 PPXGXXPPPP---PXXXXXXSPPPPXXG---GGXPPPPPXPXXXAXXXXPP 566 PP PPP P SPPPP PPPPP P PP Sbjct: 398 PPPAPYPPPSAPYPAPYTPPSPPPPPCPVPCPPPPPPPPPPPCPVPCPPPP 448 >UniRef50_A2DM31 Cluster: Putative uncharacterized protein; n=1; Trichomonas vaginalis G3|Rep: Putative uncharacterized protein - Trichomonas vaginalis G3 Length = 560 Score = 41.5 bits (93), Expect = 0.023 Identities = 18/33 (54%), Positives = 18/33 (54%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPP 530 PP G PPPP PPPP G G PPPPP Sbjct: 464 PPPGIGLPPPPPPAFGIPPPPP--GVGVPPPPP 494 Score = 39.5 bits (88), Expect = 0.093 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPP 530 PP PPPPP PP G G PPPPP Sbjct: 443 PPPPVAPPPPPMAPPPPPVAPPPPGIGLPPPPP 475 Score = 37.5 bits (83), Expect = 0.37 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +1 Query: 433 PXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPP 534 P PPPPP PP G PPPPPP Sbjct: 443 PPPPVAPPPPPMAPPPPPVAPPPPGIGLPPPPPP 476 Score = 36.3 bits (80), Expect = 0.86 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 2/36 (5%) Frame = +1 Query: 430 PPXGXXXPPPP--PXXXKXXXPPPPXXGXXXPPPPP 531 PP PPPP P PPPP PPPPP Sbjct: 450 PPPPMAPPPPPVAPPPPGIGLPPPPPPAFGIPPPPP 485 >UniRef50_A0EAP8 Cluster: Chromosome undetermined scaffold_86, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_86, whole genome shotgun sequence - Paramecium tetraurelia Length = 951 Score = 41.5 bits (93), Expect = 0.023 Identities = 18/35 (51%), Positives = 18/35 (51%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 PP PPPPP PPPP G PPPPP P Sbjct: 500 PPNKSGPPPPPPP-----PPPPFGKAGFPPPPPPP 529 >UniRef50_A0CJV0 Cluster: Chromosome undetermined scaffold_2, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_2, whole genome shotgun sequence - Paramecium tetraurelia Length = 362 Score = 41.5 bits (93), Expect = 0.023 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = +1 Query: 439 GXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPP 534 G PPPPP PPPP PPPPPP Sbjct: 219 GYVPPPPPPMQQGYVPPPPPMQQGYVPPPPPP 250 Score = 40.3 bits (90), Expect = 0.053 Identities = 16/39 (41%), Positives = 17/39 (43%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PP PPPP PPPPPP+ PP Sbjct: 200 PPQPPNQQGYVPPPPPMQQGYVPPPPPPMQQGYVPPPPP 238 Score = 39.9 bits (89), Expect = 0.070 Identities = 16/39 (41%), Positives = 17/39 (43%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PPPPP PPPP PPPPP+ PP Sbjct: 211 PPPPPMQQGYVPPPPPPMQQGYVPPPPPMQQGYVPPPPP 249 Score = 39.5 bits (88), Expect = 0.093 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = +3 Query: 441 GXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 G PPPPP PPPP G PPPP P PP Sbjct: 208 GYVPPPPPMQQGYVPPPPPPMQQGYVPPPP-PMQQGYVPPPP 248 Score = 37.9 bits (84), Expect = 0.28 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PP PPPP G PPPPP P PP Sbjct: 200 PPQPPNQQGYVPPPPPMQQGYVPPPPP-PMQQGYVPPPP 237 >UniRef50_A4R9P2 Cluster: Predicted protein; n=1; Magnaporthe grisea|Rep: Predicted protein - Magnaporthe grisea (Rice blast fungus) (Pyricularia grisea) Length = 216 Score = 41.5 bits (93), Expect = 0.023 Identities = 22/56 (39%), Positives = 22/56 (39%), Gaps = 7/56 (12%) Frame = +3 Query: 390 GGGGGXXFXXXGXXPPX-------GXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 GGGGG PP G PPPP PPP GG PPPP P Sbjct: 61 GGGGGGGEGGQQQAPPAPAKDGADGAAPPPPAKDGAAPPPPPAKDGGDAAPPPPPP 116 >UniRef50_A2QQW4 Cluster: Contig An08c0110, complete genome; n=2; Aspergillus|Rep: Contig An08c0110, complete genome - Aspergillus niger Length = 384 Score = 41.5 bits (93), Expect = 0.023 Identities = 17/45 (37%), Positives = 18/45 (40%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 P PPPPP +PPPP P PPP P PP Sbjct: 185 PSAPAPPPPPPPSASPAAPPPPPPPASAPRPPPAPSRSTPPPPPP 229 Score = 39.1 bits (87), Expect = 0.12 Identities = 17/29 (58%), Positives = 17/29 (58%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 PPPPP PPPP G G PPPPP P Sbjct: 2 PPPPP-------PPPPPGGMGGPPPPPPP 23 Score = 38.7 bits (86), Expect = 0.16 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPP 534 P PPPPP PPP PPPPPP Sbjct: 196 PSASPAAPPPPPPPASAPRPPPAPSRSTPPPPPPP 230 Score = 38.3 bits (85), Expect = 0.21 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPP PPP PPPPPP A PP Sbjct: 195 PPSASPAAPPPPPPPASAPRPPPAPSRSTPPPPPP--PGASAPQPP 238 Score = 37.1 bits (82), Expect = 0.50 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 2/41 (4%) Frame = +3 Query: 432 PPXGXXP--PPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXA 548 PP P PPPP PPP PPPPP P A Sbjct: 194 PPPSASPAAPPPPPPPASAPRPPPAPSRSTPPPPPPPGASA 234 Score = 36.7 bits (81), Expect = 0.65 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +1 Query: 433 PXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 P PPPPP PPPP P PPP PP Sbjct: 185 PSAPAPPPPPPPSASPAAPPPPPPPASAPRPPPAPSRSTPPPPPP 229 Score = 36.7 bits (81), Expect = 0.65 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPP 527 PP P PPP PPPP G P PP Sbjct: 207 PPPASAPRPPPAPSRSTPPPPPPPGASAPQPP 238 Score = 36.3 bits (80), Expect = 0.86 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PPPPP PPPP PPP P PP Sbjct: 192 PPPPPSASPAAPPPPPPPASAPRPPPAPSRSTPPPPPPP 230 Score = 35.9 bits (79), Expect = 1.1 Identities = 18/48 (37%), Positives = 18/48 (37%), Gaps = 3/48 (6%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXS---PPPPXXGGGXPPPPPXPXXXAXXXXPP 566 P PPPPP S PPPP P PP P A PP Sbjct: 169 PGSAKGPPPPPVSTRKPSAPAPPPPPPPSASPAAPPPPPPPASAPRPP 216 Score = 33.9 bits (74), Expect = 4.6 Identities = 17/48 (35%), Positives = 18/48 (37%), Gaps = 3/48 (6%) Frame = +1 Query: 433 PXGXXXPPPPPXXXKXXX---PPPPXXGXXXPPPPPPLXXXXXAXXPP 567 P PPPPP + PPPP P PPP A PP Sbjct: 169 PGSAKGPPPPPVSTRKPSAPAPPPPPPPSASPAAPPPPPPPASAPRPP 216 Score = 33.5 bits (73), Expect = 6.1 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 3/42 (7%) Frame = +1 Query: 451 PPPPPXXXKXXXPPP---PXXGXXXPPPPPPLXXXXXAXXPP 567 PPP P K PPP PPPPPP A PP Sbjct: 165 PPPLPGSAKGPPPPPVSTRKPSAPAPPPPPPPSASPAAPPPP 206 >UniRef50_Q9LKA5 Cluster: Uncharacterized mitochondrial protein At3g15000; n=4; core eudicotyledons|Rep: Uncharacterized mitochondrial protein At3g15000 - Arabidopsis thaliana (Mouse-ear cress) Length = 395 Score = 41.5 bits (93), Expect = 0.023 Identities = 17/32 (53%), Positives = 18/32 (56%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPP 527 PP G PPPP +PPPP GG PPPP Sbjct: 246 PPMGGPPPPP--HIGGSAPPPPHMGGSAPPPP 275 Score = 39.1 bits (87), Expect = 0.12 Identities = 20/52 (38%), Positives = 20/52 (38%), Gaps = 2/52 (3%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPX--GXXPPPPPXXXXXXSPPPPXXGGGXPPPPP 530 PP GG PP G PPPP PPPP GG PPP Sbjct: 246 PPMGGPPPPPHIGGSAPPPPHMGGSAPPPPHMGQNYGPPPPNNMGGPRHPPP 297 Score = 35.5 bits (78), Expect = 1.5 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +3 Query: 453 PPPPXXXXXXSPPPPXXGGGXPPPP 527 PPP PPPP GG PPPP Sbjct: 241 PPPQRPPMGGPPPPPHIGGSAPPPP 265 Score = 34.3 bits (75), Expect = 3.5 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +3 Query: 456 PPPXXXXXXSPPPPXXGGGXPPPPP 530 PPP PPPP GG PPPP Sbjct: 241 PPPQRPPMGGPPPPPHIGGSAPPPP 265 >UniRef50_Q95JC9 Cluster: Basic proline-rich protein precursor [Contains: Proline-rich peptide SP-A (PRP-SP-A); Proline-rich peptide SP-B (PRP-SP-B); Parotid hormone (PH-Ab)]; n=10; Eukaryota|Rep: Basic proline-rich protein precursor [Contains: Proline-rich peptide SP-A (PRP-SP-A); Proline-rich peptide SP-B (PRP-SP-B); Parotid hormone (PH-Ab)] - Sus scrofa (Pig) Length = 676 Score = 41.5 bits (93), Expect = 0.023 Identities = 24/64 (37%), Positives = 25/64 (39%), Gaps = 2/64 (3%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXXP--PPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXX 554 PP G G PP G P PPPP + PPP G PPPPP P Sbjct: 615 PPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPP----GPPPPPPGPSPPRPP 670 Query: 555 XXPP 566 PP Sbjct: 671 PGPP 674 Score = 39.1 bits (87), Expect = 0.12 Identities = 23/64 (35%), Positives = 24/64 (37%), Gaps = 3/64 (4%) Frame = +3 Query: 384 PRGGGGGXXFXXXGXXPPXGXXPP--PPPXXXXXXSPPPPXXGGGXPPPP-PXPXXXAXX 554 P G G G PP G PP PPP + PPP PPPP P P Sbjct: 63 PPGDGPEQGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPP 122 Query: 555 XXPP 566 PP Sbjct: 123 PGPP 126 Score = 39.1 bits (87), Expect = 0.12 Identities = 23/65 (35%), Positives = 24/65 (36%), Gaps = 3/65 (4%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXXPP--PPPXXXXXXSPPPPXXGGGXPPPP-PXPXXXAX 551 PP G G PP G PP PPP + PPP PPPP P P Sbjct: 447 PPPPGPPSPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARP 506 Query: 552 XXXPP 566 PP Sbjct: 507 PPGPP 511 Score = 38.3 bits (85), Expect = 0.21 Identities = 23/65 (35%), Positives = 24/65 (36%), Gaps = 3/65 (4%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXXPP--PPPXXXXXXSPPPPXXGGGXPPPP-PXPXXXAX 551 PP G G PP G PP PPP + PPP PPPP P P Sbjct: 83 PPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARP 142 Query: 552 XXXPP 566 PP Sbjct: 143 PPGPP 147 Score = 38.3 bits (85), Expect = 0.21 Identities = 23/65 (35%), Positives = 24/65 (36%), Gaps = 3/65 (4%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXXP--PPPPXXXXXXSPPPPXXGGGXPPPP-PXPXXXAX 551 PP G G PP G P PPPP + PPP PPPP P P Sbjct: 104 PPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARP 163 Query: 552 XXXPP 566 PP Sbjct: 164 PPGPP 168 Score = 38.3 bits (85), Expect = 0.21 Identities = 23/65 (35%), Positives = 24/65 (36%), Gaps = 3/65 (4%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXXPP--PPPXXXXXXSPPPPXXGGGXPPPP-PXPXXXAX 551 PP G G PP G PP PPP + PPP PPPP P P Sbjct: 125 PPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARP 184 Query: 552 XXXPP 566 PP Sbjct: 185 PPGPP 189 Score = 38.3 bits (85), Expect = 0.21 Identities = 23/65 (35%), Positives = 24/65 (36%), Gaps = 3/65 (4%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXXPP--PPPXXXXXXSPPPPXXGGGXPPPP-PXPXXXAX 551 PP G G PP G PP PPP + PPP PPPP P P Sbjct: 146 PPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARP 205 Query: 552 XXXPP 566 PP Sbjct: 206 PPGPP 210 Score = 38.3 bits (85), Expect = 0.21 Identities = 23/65 (35%), Positives = 24/65 (36%), Gaps = 3/65 (4%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXXP--PPPPXXXXXXSPPPPXXGGGXPPPP-PXPXXXAX 551 PP G G PP G P PPPP + PPP PPPP P P Sbjct: 167 PPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARP 226 Query: 552 XXXPP 566 PP Sbjct: 227 PPGPP 231 Score = 38.3 bits (85), Expect = 0.21 Identities = 23/65 (35%), Positives = 24/65 (36%), Gaps = 3/65 (4%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXXPP--PPPXXXXXXSPPPPXXGGGXPPPP-PXPXXXAX 551 PP G G PP G PP PPP + PPP PPPP P P Sbjct: 188 PPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARP 247 Query: 552 XXXPP 566 PP Sbjct: 248 PPGPP 252 Score = 38.3 bits (85), Expect = 0.21 Identities = 23/65 (35%), Positives = 24/65 (36%), Gaps = 3/65 (4%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXXP--PPPPXXXXXXSPPPPXXGGGXPPPP-PXPXXXAX 551 PP G G PP G P PPPP + PPP PPPP P P Sbjct: 230 PPPPGPPPPGPAPPGARPPPGPPPLGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARP 289 Query: 552 XXXPP 566 PP Sbjct: 290 PPGPP 294 Score = 38.3 bits (85), Expect = 0.21 Identities = 23/65 (35%), Positives = 24/65 (36%), Gaps = 3/65 (4%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXXP--PPPPXXXXXXSPPPPXXGGGXPPPP-PXPXXXAX 551 PP G G PP G P PPPP + PPP PPPP P P Sbjct: 272 PPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARP 331 Query: 552 XXXPP 566 PP Sbjct: 332 PPGPP 336 Score = 38.3 bits (85), Expect = 0.21 Identities = 23/65 (35%), Positives = 24/65 (36%), Gaps = 3/65 (4%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXXP--PPPPXXXXXXSPPPPXXGGGXPPPP-PXPXXXAX 551 PP G G PP G P PPPP + PPP PPPP P P Sbjct: 293 PPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARP 352 Query: 552 XXXPP 566 PP Sbjct: 353 PPGPP 357 Score = 38.3 bits (85), Expect = 0.21 Identities = 23/65 (35%), Positives = 24/65 (36%), Gaps = 3/65 (4%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXXPP--PPPXXXXXXSPPPPXXGGGXPPPP-PXPXXXAX 551 PP G G PP G PP PPP + PPP PPPP P P Sbjct: 314 PPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARP 373 Query: 552 XXXPP 566 PP Sbjct: 374 PPGPP 378 Score = 38.3 bits (85), Expect = 0.21 Identities = 23/65 (35%), Positives = 24/65 (36%), Gaps = 3/65 (4%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXXPP--PPPXXXXXXSPPPPXXGGGXPPPP-PXPXXXAX 551 PP G G PP G PP PPP + PPP PPPP P P Sbjct: 335 PPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARP 394 Query: 552 XXXPP 566 PP Sbjct: 395 PPGPP 399 Score = 38.3 bits (85), Expect = 0.21 Identities = 23/65 (35%), Positives = 24/65 (36%), Gaps = 3/65 (4%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXXPP--PPPXXXXXXSPPPPXXGGGXPPPP-PXPXXXAX 551 PP G G PP G PP PPP + PPP PPPP P P Sbjct: 356 PPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARP 415 Query: 552 XXXPP 566 PP Sbjct: 416 PPPPP 420 Score = 38.3 bits (85), Expect = 0.21 Identities = 23/65 (35%), Positives = 24/65 (36%), Gaps = 3/65 (4%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXXPP--PPPXXXXXXSPPPPXXGGGXPPPP-PXPXXXAX 551 PP G G PP G PP PPP + PPP PPPP P P Sbjct: 468 PPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARP 527 Query: 552 XXXPP 566 PP Sbjct: 528 PPGPP 532 Score = 38.3 bits (85), Expect = 0.21 Identities = 23/65 (35%), Positives = 24/65 (36%), Gaps = 3/65 (4%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXXPP--PPPXXXXXXSPPPPXXGGGXPPPP-PXPXXXAX 551 PP G G PP G PP PPP + PPP PPPP P P Sbjct: 489 PPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARP 548 Query: 552 XXXPP 566 PP Sbjct: 549 PPGPP 553 Score = 38.3 bits (85), Expect = 0.21 Identities = 23/65 (35%), Positives = 24/65 (36%), Gaps = 3/65 (4%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXXPP--PPPXXXXXXSPPPPXXGGGXPPPP-PXPXXXAX 551 PP G G PP G PP PPP + PPP PPPP P P Sbjct: 510 PPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARP 569 Query: 552 XXXPP 566 PP Sbjct: 570 PPGPP 574 Score = 38.3 bits (85), Expect = 0.21 Identities = 23/65 (35%), Positives = 24/65 (36%), Gaps = 3/65 (4%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXXPP--PPPXXXXXXSPPPPXXGGGXPPPP-PXPXXXAX 551 PP G G PP G PP PPP + PPP PPPP P P Sbjct: 531 PPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARP 590 Query: 552 XXXPP 566 PP Sbjct: 591 PPGPP 595 Score = 38.3 bits (85), Expect = 0.21 Identities = 23/65 (35%), Positives = 24/65 (36%), Gaps = 3/65 (4%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXXP--PPPPXXXXXXSPPPPXXGGGXPPPP-PXPXXXAX 551 PP G G PP G P PPPP + PPP PPPP P P Sbjct: 552 PPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARP 611 Query: 552 XXXPP 566 PP Sbjct: 612 PPGPP 616 Score = 38.3 bits (85), Expect = 0.21 Identities = 23/65 (35%), Positives = 24/65 (36%), Gaps = 3/65 (4%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXXP--PPPPXXXXXXSPPPPXXGGGXPPPP-PXPXXXAX 551 PP G G PP G P PPPP + PPP PPPP P P Sbjct: 573 PPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARP 632 Query: 552 XXXPP 566 PP Sbjct: 633 PPGPP 637 Score = 38.3 bits (85), Expect = 0.21 Identities = 23/65 (35%), Positives = 24/65 (36%), Gaps = 3/65 (4%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXXPP--PPPXXXXXXSPPPPXXGGGXPPPP-PXPXXXAX 551 PP G G PP G PP PPP + PPP PPPP P P Sbjct: 594 PPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARP 653 Query: 552 XXXPP 566 PP Sbjct: 654 PPGPP 658 Score = 37.9 bits (84), Expect = 0.28 Identities = 23/65 (35%), Positives = 24/65 (36%), Gaps = 3/65 (4%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXXP--PPPPXXXXXXSPPPPXXGG-GXPPPPPXPXXXAX 551 PP G G PP G P PPPP + PPP G PPP P P Sbjct: 209 PPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPLGPPPPGPAPPGARP 268 Query: 552 XXXPP 566 PP Sbjct: 269 PPGPP 273 Score = 37.9 bits (84), Expect = 0.28 Identities = 20/51 (39%), Positives = 21/51 (41%), Gaps = 3/51 (5%) Frame = +3 Query: 423 GXXPPXGXXPP--PPPXXXXXXSPPPPXXGGGXPPPP-PXPXXXAXXXXPP 566 G PP G PP PPP + PPP PPPP P P PP Sbjct: 265 GARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPP 315 Score = 37.9 bits (84), Expect = 0.28 Identities = 18/39 (46%), Positives = 18/39 (46%), Gaps = 1/39 (2%) Frame = +3 Query: 423 GXXPPXGXXPP-PPPXXXXXXSPPPPXXGGGXPPPPPXP 536 G PP PP PPP P PP G PPPPP P Sbjct: 386 GPAPPGARPPPGPPPPGPPPPGPAPP--GARPPPPPPPP 422 Score = 37.5 bits (83), Expect = 0.37 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP P PPP P PP G PP PPPL PP Sbjct: 221 PPGARPPPGPPPPGPPPPGPAPP--GARPPPGPPPLGPPPPGPAPP 264 Score = 37.5 bits (83), Expect = 0.37 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 1/47 (2%) Frame = +1 Query: 430 PPXGXXXP-PPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP G P PPPP PPP PPPP P PP Sbjct: 373 PPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPPP 419 Score = 37.5 bits (83), Expect = 0.37 Identities = 21/62 (33%), Positives = 21/62 (33%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXX 560 PP G G PP G PPP P P P G PP PP P Sbjct: 442 PPPAGPPPPGPPSPGPAPP-GARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPA 500 Query: 561 PP 566 PP Sbjct: 501 PP 502 Score = 37.1 bits (82), Expect = 0.50 Identities = 20/47 (42%), Positives = 20/47 (42%), Gaps = 1/47 (2%) Frame = +1 Query: 430 PPXGXXXP-PPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP G P PPPP PPP G P PPPP A PP Sbjct: 79 PPPGPPPPGPPPPGPAPPGARPPP--GPPPPGPPPPGPAPPGARPPP 123 Score = 37.1 bits (82), Expect = 0.50 Identities = 20/47 (42%), Positives = 20/47 (42%), Gaps = 1/47 (2%) Frame = +1 Query: 430 PPXGXXXP-PPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP G P PPPP PPP G P PPPP A PP Sbjct: 100 PPPGPPPPGPPPPGPAPPGARPPP--GPPPPGPPPPGPAPPGARPPP 144 Score = 37.1 bits (82), Expect = 0.50 Identities = 20/47 (42%), Positives = 20/47 (42%), Gaps = 1/47 (2%) Frame = +1 Query: 430 PPXGXXXP-PPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP G P PPPP PPP G P PPPP A PP Sbjct: 121 PPPGPPPPGPPPPGPAPPGARPPP--GPPPPGPPPPGPAPPGARPPP 165 Score = 37.1 bits (82), Expect = 0.50 Identities = 20/47 (42%), Positives = 20/47 (42%), Gaps = 1/47 (2%) Frame = +1 Query: 430 PPXGXXXP-PPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP G P PPPP PPP G P PPPP A PP Sbjct: 142 PPPGPPPPGPPPPGPAPPGARPPP--GPPPPGPPPPGPAPPGARPPP 186 Score = 37.1 bits (82), Expect = 0.50 Identities = 20/47 (42%), Positives = 20/47 (42%), Gaps = 1/47 (2%) Frame = +1 Query: 430 PPXGXXXP-PPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP G P PPPP PPP G P PPPP A PP Sbjct: 163 PPPGPPPPGPPPPGPAPPGARPPP--GPPPPGPPPPGPAPPGARPPP 207 Score = 37.1 bits (82), Expect = 0.50 Identities = 20/47 (42%), Positives = 20/47 (42%), Gaps = 1/47 (2%) Frame = +1 Query: 430 PPXGXXXP-PPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP G P PPPP PPP G P PPPP A PP Sbjct: 184 PPPGPPPPGPPPPGPAPPGARPPP--GPPPPGPPPPGPAPPGARPPP 228 Score = 37.1 bits (82), Expect = 0.50 Identities = 20/47 (42%), Positives = 20/47 (42%), Gaps = 1/47 (2%) Frame = +1 Query: 430 PPXGXXXP-PPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP G P PPPP PPP G P PPPP A PP Sbjct: 205 PPPGPPPPGPPPPGPAPPGARPPP--GPPPPGPPPPGPAPPGARPPP 249 Score = 37.1 bits (82), Expect = 0.50 Identities = 20/47 (42%), Positives = 20/47 (42%), Gaps = 1/47 (2%) Frame = +1 Query: 430 PPXGXXXP-PPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP G P PPPP PPP G P PPPP A PP Sbjct: 268 PPPGPPPPGPPPPGPAPPGARPPP--GPPPPGPPPPGPAPPGARPPP 312 Score = 37.1 bits (82), Expect = 0.50 Identities = 20/47 (42%), Positives = 20/47 (42%), Gaps = 1/47 (2%) Frame = +1 Query: 430 PPXGXXXP-PPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP G P PPPP PPP G P PPPP A PP Sbjct: 289 PPPGPPPPGPPPPGPAPPGARPPP--GPPPPGPPPPGPAPPGARPPP 333 Score = 37.1 bits (82), Expect = 0.50 Identities = 20/47 (42%), Positives = 20/47 (42%), Gaps = 1/47 (2%) Frame = +1 Query: 430 PPXGXXXP-PPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP G P PPPP PPP G P PPPP A PP Sbjct: 310 PPPGPPPPGPPPPGPAPPGARPPP--GPPPPGPPPPGPAPPGARPPP 354 Score = 37.1 bits (82), Expect = 0.50 Identities = 20/47 (42%), Positives = 20/47 (42%), Gaps = 1/47 (2%) Frame = +1 Query: 430 PPXGXXXP-PPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP G P PPPP PPP G P PPPP A PP Sbjct: 331 PPPGPPPPGPPPPGPAPPGARPPP--GPPPPGPPPPGPAPPGARPPP 375 Score = 37.1 bits (82), Expect = 0.50 Identities = 20/47 (42%), Positives = 20/47 (42%), Gaps = 1/47 (2%) Frame = +1 Query: 430 PPXGXXXP-PPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP G P PPPP PPP G P PPPP A PP Sbjct: 352 PPPGPPPPGPPPPGPAPPGARPPP--GPPPPGPPPPGPAPPGARPPP 396 Score = 37.1 bits (82), Expect = 0.50 Identities = 20/47 (42%), Positives = 20/47 (42%), Gaps = 1/47 (2%) Frame = +1 Query: 430 PPXGXXXP-PPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP G P PPPP PPP G P PPPP A PP Sbjct: 464 PPPGPPPPGPPPPGPAPPGARPPP--GPPPPGPPPPGPAPPGARPPP 508 Score = 37.1 bits (82), Expect = 0.50 Identities = 20/47 (42%), Positives = 20/47 (42%), Gaps = 1/47 (2%) Frame = +1 Query: 430 PPXGXXXP-PPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP G P PPPP PPP G P PPPP A PP Sbjct: 485 PPPGPPPPGPPPPGPAPPGARPPP--GPPPPGPPPPGPAPPGARPPP 529 Score = 37.1 bits (82), Expect = 0.50 Identities = 20/47 (42%), Positives = 20/47 (42%), Gaps = 1/47 (2%) Frame = +1 Query: 430 PPXGXXXP-PPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP G P PPPP PPP G P PPPP A PP Sbjct: 506 PPPGPPPPGPPPPGPAPPGARPPP--GPPPPGPPPPGPAPPGARPPP 550 Score = 37.1 bits (82), Expect = 0.50 Identities = 20/47 (42%), Positives = 20/47 (42%), Gaps = 1/47 (2%) Frame = +1 Query: 430 PPXGXXXP-PPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP G P PPPP PPP G P PPPP A PP Sbjct: 527 PPPGPPPPGPPPPGPAPPGARPPP--GPPPPGPPPPGPAPPGARPPP 571 Score = 37.1 bits (82), Expect = 0.50 Identities = 20/47 (42%), Positives = 20/47 (42%), Gaps = 1/47 (2%) Frame = +1 Query: 430 PPXGXXXP-PPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP G P PPPP PPP G P PPPP A PP Sbjct: 548 PPPGPPPPGPPPPGPAPPGARPPP--GPPPPGPPPPGPAPPGARPPP 592 Score = 37.1 bits (82), Expect = 0.50 Identities = 20/47 (42%), Positives = 20/47 (42%), Gaps = 1/47 (2%) Frame = +1 Query: 430 PPXGXXXP-PPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP G P PPPP PPP G P PPPP A PP Sbjct: 569 PPPGPPPPGPPPPGPAPPGARPPP--GPPPPGPPPPGPAPPGARPPP 613 Score = 37.1 bits (82), Expect = 0.50 Identities = 20/47 (42%), Positives = 20/47 (42%), Gaps = 1/47 (2%) Frame = +1 Query: 430 PPXGXXXP-PPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP G P PPPP PPP G P PPPP A PP Sbjct: 590 PPPGPPPPGPPPPGPAPPGARPPP--GPPPPGPPPPGPAPPGARPPP 634 Score = 37.1 bits (82), Expect = 0.50 Identities = 20/47 (42%), Positives = 20/47 (42%), Gaps = 1/47 (2%) Frame = +1 Query: 430 PPXGXXXP-PPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP G P PPPP PPP G P PPPP A PP Sbjct: 611 PPPGPPPPGPPPPGPAPPGARPPP--GPPPPGPPPPGPAPPGARPPP 655 Score = 36.7 bits (81), Expect = 0.65 Identities = 22/61 (36%), Positives = 22/61 (36%) Frame = +3 Query: 384 PRGGGGGXXFXXXGXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXP 563 PR G G G PP G PPP P P P G PP PP P P Sbjct: 61 PRPPGDGPE---QGPAPP-GARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAP 116 Query: 564 P 566 P Sbjct: 117 P 117 Score = 36.3 bits (80), Expect = 0.86 Identities = 18/48 (37%), Positives = 18/48 (37%) Frame = +3 Query: 423 GXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 G PP G PPP P P P G PP PP P PP Sbjct: 260 GPAPP-GARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPP 306 Score = 36.3 bits (80), Expect = 0.86 Identities = 22/61 (36%), Positives = 22/61 (36%), Gaps = 9/61 (14%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXXPP--------PPPXXXXXXSPPP-PXXGGGXPPPPPX 533 PP G PP G PP PPP PPP P G PPPPP Sbjct: 361 PPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPPPP 420 Query: 534 P 536 P Sbjct: 421 P 421 Score = 34.7 bits (76), Expect = 2.6 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP P PPP P PP G PP PPP PP Sbjct: 74 PPGARPPPGPPPPGPPPPGPAPP--GARPPPGPPPPGPPPPGPAPP 117 Score = 34.7 bits (76), Expect = 2.6 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP P PPP P PP G PP PPP PP Sbjct: 95 PPGARPPPGPPPPGPPPPGPAPP--GARPPPGPPPPGPPPPGPAPP 138 Score = 34.7 bits (76), Expect = 2.6 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP P PPP P PP G PP PPP PP Sbjct: 116 PPGARPPPGPPPPGPPPPGPAPP--GARPPPGPPPPGPPPPGPAPP 159 Score = 34.7 bits (76), Expect = 2.6 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP P PPP P PP G PP PPP PP Sbjct: 137 PPGARPPPGPPPPGPPPPGPAPP--GARPPPGPPPPGPPPPGPAPP 180 Score = 34.7 bits (76), Expect = 2.6 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP P PPP P PP G PP PPP PP Sbjct: 158 PPGARPPPGPPPPGPPPPGPAPP--GARPPPGPPPPGPPPPGPAPP 201 Score = 34.7 bits (76), Expect = 2.6 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP P PPP P PP G PP PPP PP Sbjct: 179 PPGARPPPGPPPPGPPPPGPAPP--GARPPPGPPPPGPPPPGPAPP 222 Score = 34.7 bits (76), Expect = 2.6 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP P PPP P PP G PP PPP PP Sbjct: 200 PPGARPPPGPPPPGPPPPGPAPP--GARPPPGPPPPGPPPPGPAPP 243 Score = 34.7 bits (76), Expect = 2.6 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP P PPP P PP G PP PPP PP Sbjct: 242 PPGARPPPGPPPLGPPPPGPAPP--GARPPPGPPPPGPPPPGPAPP 285 Score = 34.7 bits (76), Expect = 2.6 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPP PPP G P PPPP A PP Sbjct: 248 PPGPPPLGPPPPGPAPPGARPPP--GPPPPGPPPPGPAPPGARPPP 291 Score = 34.7 bits (76), Expect = 2.6 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP P PPP P PP G PP PPP PP Sbjct: 263 PPGARPPPGPPPPGPPPPGPAPP--GARPPPGPPPPGPPPPGPAPP 306 Score = 34.7 bits (76), Expect = 2.6 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP P PPP P PP G PP PPP PP Sbjct: 284 PPGARPPPGPPPPGPPPPGPAPP--GARPPPGPPPPGPPPPGPAPP 327 Score = 34.7 bits (76), Expect = 2.6 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP P PPP P PP G PP PPP PP Sbjct: 305 PPGARPPPGPPPPGPPPPGPAPP--GARPPPGPPPPGPPPPGPAPP 348 Score = 34.7 bits (76), Expect = 2.6 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP P PPP P PP G PP PPP PP Sbjct: 326 PPGARPPPGPPPPGPPPPGPAPP--GARPPPGPPPPGPPPPGPAPP 369 Score = 34.7 bits (76), Expect = 2.6 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP P PPP P PP G PP PPP PP Sbjct: 347 PPGARPPPGPPPPGPPPPGPAPP--GARPPPGPPPPGPPPPGPAPP 390 Score = 34.7 bits (76), Expect = 2.6 Identities = 17/46 (36%), Positives = 18/46 (39%), Gaps = 1/46 (2%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPP-PPXPXXXAXXXXPP 566 PP PPPP +PP G PPP PP P PP Sbjct: 441 PPPPAGPPPPGPPSPGPAPPGARPPPGPPPPGPPPPGPAPPGARPP 486 Score = 34.7 bits (76), Expect = 2.6 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP P PPP P PP G PP PPP PP Sbjct: 459 PPGARPPPGPPPPGPPPPGPAPP--GARPPPGPPPPGPPPPGPAPP 502 Score = 34.7 bits (76), Expect = 2.6 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP P PPP P PP G PP PPP PP Sbjct: 480 PPGARPPPGPPPPGPPPPGPAPP--GARPPPGPPPPGPPPPGPAPP 523 Score = 34.7 bits (76), Expect = 2.6 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP P PPP P PP G PP PPP PP Sbjct: 501 PPGARPPPGPPPPGPPPPGPAPP--GARPPPGPPPPGPPPPGPAPP 544 Score = 34.7 bits (76), Expect = 2.6 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP P PPP P PP G PP PPP PP Sbjct: 522 PPGARPPPGPPPPGPPPPGPAPP--GARPPPGPPPPGPPPPGPAPP 565 Score = 34.7 bits (76), Expect = 2.6 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP P PPP P PP G PP PPP PP Sbjct: 543 PPGARPPPGPPPPGPPPPGPAPP--GARPPPGPPPPGPPPPGPAPP 586 Score = 34.7 bits (76), Expect = 2.6 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP P PPP P PP G PP PPP PP Sbjct: 564 PPGARPPPGPPPPGPPPPGPAPP--GARPPPGPPPPGPPPPGPAPP 607 Score = 34.7 bits (76), Expect = 2.6 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP P PPP P PP G PP PPP PP Sbjct: 585 PPGARPPPGPPPPGPPPPGPAPP--GARPPPGPPPPGPPPPGPAPP 628 Score = 34.7 bits (76), Expect = 2.6 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP P PPP P PP G PP PPP PP Sbjct: 606 PPGARPPPGPPPPGPPPPGPAPP--GARPPPGPPPPGPPPPGPAPP 649 Score = 34.3 bits (75), Expect = 3.5 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP P PPP P PP G PP PPP PP Sbjct: 627 PPGARPPPGPPPPGPPPPGPAPP--GARPPPGPPPPPPGPSPPRPP 670 Score = 33.5 bits (73), Expect = 6.1 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 1/47 (2%) Frame = +2 Query: 431 PPXGXXXPPPPXXXXKXXXPPPXXXGXXXPPP-PXPXXXXXXXXPPP 568 PP G PPPP PPP PPP P P PPP Sbjct: 210 PPPG---PPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPP 253 Score = 33.5 bits (73), Expect = 6.1 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 1/47 (2%) Frame = +2 Query: 431 PPXGXXXPPPPXXXXKXXXPPPXXXGXXXPPP-PXPXXXXXXXXPPP 568 PP G PPPP PPP PPP P P PPP Sbjct: 252 PPLG---PPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPP 295 Score = 33.1 bits (72), Expect = 8.1 Identities = 15/45 (33%), Positives = 15/45 (33%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPP P PPPP P P P PP Sbjct: 398 PPPPGPPPPGPAPPGARPPPPPPPPADEPQQGPAPSGDKPKKKPP 442 Score = 33.1 bits (72), Expect = 8.1 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = +2 Query: 431 PPXGXXXPPPPXXXXKXXXPPPXXXGXXXPPPPXPXXXXXXXXPPP 568 PP G PPPP PPP PPPP P PPP Sbjct: 637 PPPG---PPPPGPAPPGARPPPGPP----PPPPGPSPPRPPPGPPP 675 >UniRef50_UPI00015BDD6A Cluster: UPI00015BDD6A related cluster; n=1; unknown|Rep: UPI00015BDD6A UniRef100 entry - unknown Length = 231 Score = 41.1 bits (92), Expect = 0.030 Identities = 15/29 (51%), Positives = 16/29 (55%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPPL 537 PPPPP PPPP PPPPPP+ Sbjct: 68 PPPPPPPPPPPPPPPPPPPETPPPPPPPV 96 Score = 40.7 bits (91), Expect = 0.040 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPP 534 PPPPP PPPP PPPPPP Sbjct: 67 PPPPPPPPPPPPPPPPPPPPETPPPPPP 94 Score = 39.5 bits (88), Expect = 0.093 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 PPPPP PPPP PPPPP P Sbjct: 67 PPPPPPPPPPPPPPPPPPPPETPPPPPPP 95 >UniRef50_UPI0000E4922C Cluster: PREDICTED: similar to Enabled homolog (Drosophila); n=1; Strongylocentrotus purpuratus|Rep: PREDICTED: similar to Enabled homolog (Drosophila) - Strongylocentrotus purpuratus Length = 439 Score = 41.1 bits (92), Expect = 0.030 Identities = 18/35 (51%), Positives = 19/35 (54%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 PP PP PP +PP P GGG PPPPP P Sbjct: 228 PPAPAAPPAPP------APPAPPAGGGPPPPPPPP 256 Score = 37.1 bits (82), Expect = 0.50 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPP 534 PP PP P PP P G PPPPPP Sbjct: 221 PPAVPAAPPAPAAPPAPPAPPAPPAGGGPPPPPPP 255 Score = 35.1 bits (77), Expect = 2.0 Identities = 16/51 (31%), Positives = 17/51 (33%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPPXXXXXG 584 PP PP PP + PP PP PP P PP G Sbjct: 209 PPAPPAPPAPPAPPAVPAAPPAPAAPPAPPAPPAPPAGGGPPPPPPPPAIG 259 >UniRef50_UPI0000498915 Cluster: hypothetical protein 9.t00033; n=1; Entamoeba histolytica HM-1:IMSS|Rep: hypothetical protein 9.t00033 - Entamoeba histolytica HM-1:IMSS Length = 540 Score = 41.1 bits (92), Expect = 0.030 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = +3 Query: 441 GXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 G PPPPP PPP PPPPP P PP Sbjct: 411 GIPPPPPPARGTGCGAPPPPPPLNAPPPPPPPAHGTGCGVPP 452 Score = 39.9 bits (89), Expect = 0.070 Identities = 17/34 (50%), Positives = 17/34 (50%), Gaps = 2/34 (5%) Frame = +1 Query: 439 GXXXPPPPPXXXKXXXPPPP--XXGXXXPPPPPP 534 G PPPPP PPPP G PPPPPP Sbjct: 423 GCGAPPPPPPLNAPPPPPPPAHGTGCGVPPPPPP 456 Score = 38.7 bits (86), Expect = 0.16 Identities = 20/52 (38%), Positives = 20/52 (38%), Gaps = 4/52 (7%) Frame = +3 Query: 441 GXXPPPPPXXXXXXS----PPPPXXGGGXPPPPPXPXXXAXXXXPPXXXXXG 584 G PPPPP PPPP G G PPP P A PP G Sbjct: 396 GAPPPPPPPAFDTGCGIPPPPPPARGTGCGAPPPPPPLNAPPPPPPPAHGTG 447 Score = 38.7 bits (86), Expect = 0.16 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 PPPPP PPPP G G PPP P Sbjct: 427 PPPPPPLNAPPPPPPPAHGTGCGVPPPPP 455 Score = 37.9 bits (84), Expect = 0.28 Identities = 18/43 (41%), Positives = 18/43 (41%), Gaps = 4/43 (9%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXX----GGGXPPPPPXPXXXAXXXXPP 566 PPPP PPPP G G PPPPP P PP Sbjct: 372 PPPPAFDTGCGVPPPPPPARGTGCGAPPPPPPPAFDTGCGIPP 414 Score = 35.5 bits (78), Expect = 1.5 Identities = 18/48 (37%), Positives = 18/48 (37%), Gaps = 6/48 (12%) Frame = +3 Query: 441 GXXPPPPPXXXXXXSPPPP------XXGGGXPPPPPXPXXXAXXXXPP 566 G PPPPP PPP G G PPPPP PP Sbjct: 382 GVPPPPPPARGTGCGAPPPPPPPAFDTGCGIPPPPPPARGTGCGAPPP 429 Score = 35.1 bits (77), Expect = 2.0 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 4/43 (9%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXX----GXXXPPPPPPLXXXXXAXXPP 567 PPPP PPPP G PPPPPP PP Sbjct: 372 PPPPAFDTGCGVPPPPPPARGTGCGAPPPPPPPAFDTGCGIPP 414 Score = 34.7 bits (76), Expect = 2.6 Identities = 18/44 (40%), Positives = 19/44 (43%), Gaps = 5/44 (11%) Frame = +3 Query: 450 PPPPPXXXXXXS---PPPP--XXGGGXPPPPPXPXXXAXXXXPP 566 PPPPP + PPPP G G PPPPP PP Sbjct: 357 PPPPPSYGGHHNVPPPPPPAFDTGCGVPPPPPPARGTGCGAPPP 400 Score = 34.7 bits (76), Expect = 2.6 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 2/41 (4%) Frame = +1 Query: 451 PPPPPXXXKXXX--PPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PPPPP PPPP PPPPPP PP Sbjct: 414 PPPPPARGTGCGAPPPPPPLN-APPPPPPPAHGTGCGVPPP 453 Score = 33.1 bits (72), Expect = 8.1 Identities = 17/34 (50%), Positives = 17/34 (50%), Gaps = 4/34 (11%) Frame = +3 Query: 441 GXXPPPPPXXXXXXSPPPP----XXGGGXPPPPP 530 G PPPPP PPPP G G PPPPP Sbjct: 425 GAPPPPPPLNAP---PPPPPPAHGTGCGVPPPPP 455 >UniRef50_Q4A2Z7 Cluster: Putative membrane protein precursor; n=1; Emiliania huxleyi virus 86|Rep: Putative membrane protein precursor - Emiliania huxleyi virus 86 Length = 516 Score = 41.1 bits (92), Expect = 0.030 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP P PPP SPPPP PPP P P PP Sbjct: 91 PPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPSPPPSPSPPSPPPP 135 Score = 40.3 bits (90), Expect = 0.053 Identities = 17/46 (36%), Positives = 18/46 (39%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP P PPP PPPP PPP PP + PP Sbjct: 90 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPSPPPSPSPPSPPPP 135 Score = 40.3 bits (90), Expect = 0.053 Identities = 17/45 (37%), Positives = 18/45 (40%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PP PP SPPP PPP P P + PP Sbjct: 105 PPPSPPPPSPPPPSPPPSPPPSPSPPSPPPPSPPPPSISPSPPPP 149 Score = 39.5 bits (88), Expect = 0.093 Identities = 17/45 (37%), Positives = 18/45 (40%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPP SPP P PP PP P + PP Sbjct: 51 PPSPPPSPPPPLPPPSPSPPSPPPPSPPPPSPPPPSPPSPPPSPP 95 Score = 39.1 bits (87), Expect = 0.12 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = +3 Query: 435 PXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 P P PPP SPPPP PPPP P PP Sbjct: 87 PPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPSPPPSPSPP 130 Score = 39.1 bits (87), Expect = 0.12 Identities = 18/44 (40%), Positives = 19/44 (43%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXP 563 PP P PPP SPPPP PPPPP P + P Sbjct: 198 PPPSASPSPPPPSPPPPSPPPPPP----PPPPPPPSPPSPNPPP 237 Score = 39.1 bits (87), Expect = 0.12 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPP SPPPP PPPPP P PP Sbjct: 199 PPSASPSPPPP------SPPPPSPPPPPPPPPPPPPSPPSPNPPP 237 Score = 38.7 bits (86), Expect = 0.16 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPP P SPPP PPP P P PP Sbjct: 72 PPPPSPPPPSPPPPSPPSPPPSPPPPSPPPPSPPPPSPPPPSPPP 116 Score = 38.7 bits (86), Expect = 0.16 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP P PPP SPPPP PP P P PP Sbjct: 96 PPSPPPPSPPPPSPPPPSPPPPSPPPSPPPSPSPPSPPPPSPPPP 140 Score = 38.7 bits (86), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPP 530 PP P P P SPPPP PPPPP Sbjct: 119 PPPSPPPSPSPPSPPPPSPPPPSISPSPPPPPP 151 Score = 38.3 bits (85), Expect = 0.21 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPP 534 PP P PPP PPPP P PPPP Sbjct: 63 PPPSPSPPSPPPPSPPPPSPPPPSPPSPPPSPPPP 97 Score = 38.3 bits (85), Expect = 0.21 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = +3 Query: 435 PXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 P PPPP SPPPP PPPP P PP Sbjct: 77 PPPPSPPPPSPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 120 Score = 38.3 bits (85), Expect = 0.21 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = +3 Query: 435 PXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 P PP PP SPPPP PPPP P PP Sbjct: 82 PPPPSPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPSPPP 125 Score = 38.3 bits (85), Expect = 0.21 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPP 534 PP PPPP PP P PPPPPP Sbjct: 189 PPSSASPTPPPPSASPSPPPPSPPPPSPPPPPPPP 223 Score = 37.5 bits (83), Expect = 0.37 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = +3 Query: 435 PXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 P PPP P SPPPP PPP P P PP Sbjct: 32 PPPPSPPPLPPPLPPPSPPPPSPPPSPPPPLPPPSPSPPSPPPP 75 Score = 37.5 bits (83), Expect = 0.37 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PP PP SPPPP PPPP P PP Sbjct: 54 PPPSPPPPLPPPSPSPPSPPPPSPPP-PSPPPPSPPSPPPSPPPP 97 Score = 37.5 bits (83), Expect = 0.37 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PP PP PP P PP PP P PP Sbjct: 73 PPPSPPPPSPPPPSPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPP 117 Score = 37.5 bits (83), Expect = 0.37 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPP 534 PP P PPP PPPP PPP PP Sbjct: 197 PPPPSASPSPPPPSPPPPSPPPPPPPPPPPPPSPP 231 Score = 37.1 bits (82), Expect = 0.50 Identities = 16/46 (34%), Positives = 17/46 (36%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP P PPP PPPP PP P P + PP Sbjct: 95 PPPSPPPPSPPPPSPPPPSPPPPSPPPSPPPSPSPPSPPPPSPPPP 140 Score = 37.1 bits (82), Expect = 0.50 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP P PPP PPPP PPPPPP A P Sbjct: 123 PPPSPSPPSPPPPS-----PPPPSISPSPPPPPPPWWQAPSASPSP 163 Score = 36.7 bits (81), Expect = 0.65 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP P PPP P PP PPPP P PP Sbjct: 29 PPSPPPPSPPPLPPPLPPPSPPPPSPPPSPPPPLPPPSPSPPSPP 73 Score = 36.7 bits (81), Expect = 0.65 Identities = 18/48 (37%), Positives = 18/48 (37%), Gaps = 3/48 (6%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGG---GXPPPPPXPXXXAXXXXPP 566 PP P PPP SPPPP PPP P P PP Sbjct: 64 PPSPSPPSPPPPSPPPPSPPPPSPPSPPPSPPPPSPPPPSPPPPSPPP 111 Score = 36.7 bits (81), Expect = 0.65 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP P PPP PP P PP PP P PP Sbjct: 106 PPSPPPPSPPPPSPPPSPPPSPSPPSPPPPSPPPPSISPSPPPPP 150 Score = 36.3 bits (80), Expect = 0.86 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPP PP P PP PPP PP Sbjct: 50 PPPSPPPSPPPPLPPPSPSPPSPPPPSPPPPSPPPPSPPSPPPSPP 95 Score = 35.9 bits (79), Expect = 1.1 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPL 537 PP PP PP PP P P PPPPL Sbjct: 27 PPPPSPPPPSPPPLPPPLPPPSPPPPSPPPSPPPPL 62 Score = 35.9 bits (79), Expect = 1.1 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = +3 Query: 435 PXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 P PP PP SPPPP PP P P PP Sbjct: 41 PPPLPPPSPPPPSPPPSPPPPLPPPSPSPPSPPPPSPPPPSPPP 84 Score = 35.9 bits (79), Expect = 1.1 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 2/47 (4%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSP--PPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP P PPP SP PPP PPPP P PP Sbjct: 69 PPSPPPPSPPPPSPPPPSPPSPPPSPPPPSPPPPSPPPPSPPPPSPP 115 Score = 35.9 bits (79), Expect = 1.1 Identities = 17/48 (35%), Positives = 18/48 (37%), Gaps = 3/48 (6%) Frame = +3 Query: 432 PPXGXXPPPP---PXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 P PPPP P SP PP PPPP P + PP Sbjct: 174 PSASPSPPPPSISPSPPSSASPTPPPPSASPSPPPPSPPPPSPPPPPP 221 Score = 35.9 bits (79), Expect = 1.1 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP SPP P P PP PP Sbjct: 212 PPPSPPPPPPPPPPPPPSPPSPNPPPSASPSPPFGRSLRSPPPPP 256 Score = 35.5 bits (78), Expect = 1.5 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PPPP PPPP PPPP P PP Sbjct: 82 PPPPSPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 120 Score = 35.5 bits (78), Expect = 1.5 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PP PPPP PPPP P PP Sbjct: 87 PPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPSPPP 125 Score = 35.1 bits (77), Expect = 2.0 Identities = 19/58 (32%), Positives = 19/58 (32%), Gaps = 2/58 (3%) Frame = +3 Query: 399 GGXXFXXXGXXPPXGXXPPPPPXXXXXXSP--PPPXXGGGXPPPPPXPXXXAXXXXPP 566 GG PP P PPP P PPP PPP P P PP Sbjct: 13 GGAYATPPSPPPPSPPPPSPPPPSPPPLPPPLPPPSPPPPSPPPSPPPPLPPPSPSPP 70 Score = 35.1 bits (77), Expect = 2.0 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP P PPP PPP PP PP P PP Sbjct: 41 PPPLPPPSPPPPSPPPSPPPPLPPPSPSPPSPPPPSPPPPSPPPP 85 Score = 34.7 bits (76), Expect = 2.6 Identities = 15/39 (38%), Positives = 16/39 (41%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PPP P PPPP PPP PP + PP Sbjct: 37 PPPLPPPLPPPSPPPPSPPPSPPPPLPPPSPSPPSPPPP 75 Score = 34.7 bits (76), Expect = 2.6 Identities = 17/47 (36%), Positives = 17/47 (36%), Gaps = 2/47 (4%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPP--PPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPP PP PP PPPP P PP Sbjct: 42 PPLPPPSPPPPSPPPSPPPPLPPPSPSPPSPPPPSPPPPSPPPPSPP 88 Score = 34.3 bits (75), Expect = 3.5 Identities = 17/47 (36%), Positives = 17/47 (36%), Gaps = 1/47 (2%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPP-PPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPP PP PP PPPP P PP Sbjct: 19 PPSPPPPSPPPPSPPPPSPPPLPPPLPPPSPPPPSPPPSPPPPLPPP 65 Score = 34.3 bits (75), Expect = 3.5 Identities = 17/47 (36%), Positives = 17/47 (36%), Gaps = 1/47 (2%) Frame = +1 Query: 430 PPXGXXXPPP-PPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPP PP PPPP PP PP PP Sbjct: 38 PPLPPPLPPPSPPPPSPPPSPPPPLPPPSPSPPSPPPPSPPPPSPPP 84 Score = 34.3 bits (75), Expect = 3.5 Identities = 18/43 (41%), Positives = 19/43 (44%), Gaps = 8/43 (18%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPP-----PXXGGGX---PPPPPXP 536 PP PPPPP +PPP P G PPPPP P Sbjct: 217 PPPPPPPPPPPPSPPSPNPPPSASPSPPFGRSLRSPPPPPPPP 259 Score = 33.5 bits (73), Expect = 6.1 Identities = 17/47 (36%), Positives = 17/47 (36%), Gaps = 4/47 (8%) Frame = +3 Query: 435 PXGXXPPPPPXXXXXXSPPPP----XXGGGXPPPPPXPXXXAXXXXP 563 P PPPP PPPP PPPPP P A P Sbjct: 132 PPPPSPPPPSISPSPPPPPPPWWQAPSASPSPPPPPPPWWQAPSASP 178 Score = 33.5 bits (73), Expect = 6.1 Identities = 17/46 (36%), Positives = 18/46 (39%), Gaps = 1/46 (2%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPP-PPXPXXXAXXXXPP 566 PP P PP +PPPP PPP PP P PP Sbjct: 181 PPPSISPSPPSSASP--TPPPPSASPSPPPPSPPPPSPPPPPPPPP 224 Score = 33.1 bits (72), Expect = 8.1 Identities = 16/47 (34%), Positives = 16/47 (34%), Gaps = 1/47 (2%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXX-GXXXPPPPPPLXXXXXAXXPP 567 PP P PPP PP P P PPPP PP Sbjct: 45 PPPSPPPPSPPPSPPPPLPPPSPSPPSPPPPSPPPPSPPPPSPPSPP 91 Score = 33.1 bits (72), Expect = 8.1 Identities = 15/46 (32%), Positives = 15/46 (32%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 P PPPP PP P PPPP P PP Sbjct: 65 PSPSPPSPPPPSPPPPSPPPPSPPSPPPSPPPPSPPPPSPPPPSPP 110 Score = 33.1 bits (72), Expect = 8.1 Identities = 15/45 (33%), Positives = 15/45 (33%) Frame = +1 Query: 433 PXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 P PPP P P PP PPP PP PP Sbjct: 67 PSPPSPPPPSPPPPSPPPPSPPSPPPSPPPPSPPPPSPPPPSPPP 111 >UniRef50_Q4A263 Cluster: Putative membrane protein; n=1; Emiliania huxleyi virus 86|Rep: Putative membrane protein - Emiliania huxleyi virus 86 Length = 403 Score = 41.1 bits (92), Expect = 0.030 Identities = 17/45 (37%), Positives = 18/45 (40%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PP PP SPPP P PPP P + PP Sbjct: 144 PPPSSPPPSPPPPSSPPSPPPSSPPSSPPSPPPSPPPSSPPSPPP 188 Score = 36.7 bits (81), Expect = 0.65 Identities = 16/44 (36%), Positives = 17/44 (38%) Frame = +3 Query: 435 PXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 P PPPPP SPPPP PP P + PP Sbjct: 136 PPPPPPPPPPPSSPPPSPPPPSSPPSPPPSSPPSSPPSPPPSPP 179 Score = 36.3 bits (80), Expect = 0.86 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPP P PPP PP PPP PP Sbjct: 142 PPPPPSSPPPSPPPPSSPPSPPPSSPPSSPPSPPPSPPPSSPPSPP 187 Score = 35.9 bits (79), Expect = 1.1 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PPPPP PPP PP PPP PP Sbjct: 137 PPPPPPPPPPSSPPPSPPPPSSPPSPPPSSPPSSPPSPP 175 Score = 35.9 bits (79), Expect = 1.1 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PPPPP PPPP PP PP PP Sbjct: 141 PPPPPPSSPPPSPPPPSSPPSPPPSSPPSSPPSPPPSPP 179 Score = 33.9 bits (74), Expect = 4.6 Identities = 15/46 (32%), Positives = 15/46 (32%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPP PPP PP PPP PP Sbjct: 154 PPPSSPPSPPPSSPPSSPPSPPPSPPPSSPPSPPPSSPPSPPPSPP 199 Score = 33.9 bits (74), Expect = 4.6 Identities = 15/46 (32%), Positives = 15/46 (32%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPP P PPP P PPP PP Sbjct: 167 PPSSPPSPPPSPPPSSPPSPPPSSPPSPPPSPPPSSPPSSPPSSPP 212 Score = 33.5 bits (73), Expect = 6.1 Identities = 18/47 (38%), Positives = 19/47 (40%), Gaps = 2/47 (4%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPP--PPXPXXXAXXXXPP 566 PP PP PP SPP P PPP PP P + PP Sbjct: 153 PPPPSSPPSPPPSSPPSSPPSPPPS---PPPSSPPSPPPSSPPSPPP 196 >UniRef50_Q0M671 Cluster: Glycoside hydrolase, family 16:Hemolysin-type calcium-binding region; n=1; Caulobacter sp. K31|Rep: Glycoside hydrolase, family 16:Hemolysin-type calcium-binding region - Caulobacter sp. K31 Length = 608 Score = 41.1 bits (92), Expect = 0.030 Identities = 15/29 (51%), Positives = 16/29 (55%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPPL 537 PPPPP PPPP PPPPPP+ Sbjct: 471 PPPPPPPPPPPPPPPPPPPPPPPPPPPPV 499 Score = 40.7 bits (91), Expect = 0.040 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPP 534 PPPPP PPPP PPPPPP Sbjct: 468 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 495 Score = 40.7 bits (91), Expect = 0.040 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPP 534 PPPPP PPPP PPPPPP Sbjct: 469 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 496 Score = 40.7 bits (91), Expect = 0.040 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPP 534 PPPPP PPPP PPPPPP Sbjct: 470 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 497 Score = 39.5 bits (88), Expect = 0.093 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 PPPPP PPPP PPPPP P Sbjct: 470 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 498 >UniRef50_A4M4S8 Cluster: Putative uncharacterized protein precursor; n=1; Geobacter bemidjiensis Bem|Rep: Putative uncharacterized protein precursor - Geobacter bemidjiensis Bem Length = 210 Score = 41.1 bits (92), Expect = 0.030 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = +3 Query: 423 GXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 G PP PPPPP PPP PPPPP P Sbjct: 89 GEAPPALKLPPPPPPVKLPPPPPPMPVAQPVPPPPPPP 126 >UniRef50_Q948Y7 Cluster: VMP3 protein; n=1; Volvox carteri f. nagariensis|Rep: VMP3 protein - Volvox carteri f. nagariensis Length = 687 Score = 41.1 bits (92), Expect = 0.030 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP P PPP SPPPP PPPP P PP Sbjct: 594 PPSPPPPSPPPPNPPPPSPPPPNPPPPSPPPPSPPPPSPPPPNPP 638 Score = 41.1 bits (92), Expect = 0.030 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP P PPP SPPPP PPPP P PP Sbjct: 624 PPSPPPPSPPPPNPPPPSPPPPSPRPPTPPPPSPPPPRPPPRPPP 668 Score = 40.7 bits (91), Expect = 0.040 Identities = 17/45 (37%), Positives = 18/45 (40%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP P PPP +PPPP PPPP P PP Sbjct: 589 PPSAPPPSPPPPSPPPPNPPPPSPPPPNPPPPSPPPPSPPPPSPP 633 Score = 40.7 bits (91), Expect = 0.040 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP P PPP SPPPP PPPP P PP Sbjct: 609 PPSPPPPNPPPPSPPPPSPPPPSPPPPNPPPPSPPPPSPRPPTPP 653 Score = 39.9 bits (89), Expect = 0.070 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP P PPP PPPP PPPP P PP Sbjct: 613 PPPNPPPPSPPPPSPPPPSPPPPNPPPPSPPPPSPRPPTPPPPSPP 658 Score = 39.5 bits (88), Expect = 0.093 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP P PPP PPPP PPPP P PP Sbjct: 593 PPPSPPPPSPPPPNPPPPSPPPPNPPPPSPPPPSPPPPSPPPPNPP 638 Score = 39.5 bits (88), Expect = 0.093 Identities = 17/45 (37%), Positives = 18/45 (40%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP P PPP +PPPP PPPP P PP Sbjct: 599 PPSPPPPNPPPPSPPPPNPPPPSPPPPSPPPPSPPPPNPPPPSPP 643 Score = 39.5 bits (88), Expect = 0.093 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP P PPP PPPP PPPP P PP Sbjct: 623 PPPSPPPPSPPPPNPPPPSPPPPSPRPPTPPPPSPPPPRPPPRPPP 668 Score = 39.1 bits (87), Expect = 0.12 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP P PPP PPPP PPPP P PP Sbjct: 598 PPPSPPPPNPPPPSPPPPNPPPPSPPPPSPPPPSPPPPNPPPPSPP 643 Score = 39.1 bits (87), Expect = 0.12 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 2/47 (4%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPP--PPXPXXXAXXXXPP 566 PP P PPP SPPPP PPP PP P PP Sbjct: 604 PPNPPPPSPPPPNPPPPSPPPPSPPPPSPPPPNPPPPSPPPPSPRPP 650 Score = 39.1 bits (87), Expect = 0.12 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP P PPP PPPP PPPP P PP Sbjct: 608 PPPSPPPPNPPPPSPPPPSPPPPSPPPPNPPPPSPPPPSPRPPTPP 653 Score = 37.9 bits (84), Expect = 0.28 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP P P P SPPPP PPPP P PP Sbjct: 579 PPSPDPPSPDPPSAPPPSPPPPSPPPPNPPPPSPPPPNPPPPSPP 623 Score = 37.5 bits (83), Expect = 0.37 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP P PP SPPPP PPPP P PP Sbjct: 584 PPSPDPPSAPPPSPPPPSPPPPNPPPPSPPPPNPPPPSPPPPSPP 628 Score = 36.7 bits (81), Expect = 0.65 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +1 Query: 433 PXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 P P PPP PPPP PPPP P PP Sbjct: 589 PPSAPPPSPPPPSPPPPNPPPPSPPPPNPPPPSPPPPSPPPPSPP 633 Score = 36.3 bits (80), Expect = 0.86 Identities = 17/45 (37%), Positives = 18/45 (40%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP P PPP +PPPP PPP P P PP Sbjct: 619 PPSPPPPSPPPPSPPPPNPPPP----SPPPPSPRPPTPPPPSPPP 659 Score = 36.3 bits (80), Expect = 0.86 Identities = 17/46 (36%), Positives = 18/46 (39%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP P PPP + PPPP PP PPP PP Sbjct: 633 PPPNPPPPSPPPPSPRPPTPPPPSP---PPPRPPPRPPPTRRSPPP 675 Score = 35.9 bits (79), Expect = 1.1 Identities = 17/46 (36%), Positives = 18/46 (39%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP P PPP PPPP PP PPP + PP Sbjct: 603 PPPNPPPPSPPPPNPPPPSPPPPSP---PPPSPPPPNPPPPSPPPP 645 Score = 35.9 bits (79), Expect = 1.1 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP P PPP PPPP P PP P PP Sbjct: 618 PPPSPPPPSPPPPSPPPPNPPPPSPPPPSPRPPTPPPPSPPPPRPP 663 Score = 35.5 bits (78), Expect = 1.5 Identities = 18/49 (36%), Positives = 19/49 (38%), Gaps = 4/49 (8%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSP----PPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP P PPP SP PPP PPP P P + PP Sbjct: 494 PPSPVPPTPPPSPRPPPSPRPPNPPPRPPSPRPPPRPPPRPSSPRPPPP 542 Score = 35.5 bits (78), Expect = 1.5 Identities = 17/48 (35%), Positives = 17/48 (35%), Gaps = 2/48 (4%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXP--PPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP P PPP P PPP PPPP P PP Sbjct: 508 PPPSPRPPNPPPRPPSPRPPPRPPPRPSSPRPPPPDPSPPPPSPPSPP 555 Score = 35.1 bits (77), Expect = 2.0 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 P PPP PPPP PPP P P PP Sbjct: 480 PSPPPPSPPPPRPPPPSPVPPTPPPSPRPPPSPRPPNPP 518 Score = 35.1 bits (77), Expect = 2.0 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PP PP PPPP PPPP P PP Sbjct: 521 PPSPRPPPRPPPRPSSPRPPPPDPS----PPPPSPPSPPTSPSPP 561 Score = 34.3 bits (75), Expect = 3.5 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP P P P S PPP PPPP P PP Sbjct: 574 PPSPNPPSPDPPSPDPPSAPPPSPPPPSPPPPNPPPPSPPPPNPP 618 Score = 33.5 bits (73), Expect = 6.1 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP P PPP SP PP P PPP P PP Sbjct: 479 PPSPPPPSPPPPRPPPPSPVPPTPPPS-PRPPPSPRPPNPPPRPP 522 Score = 33.5 bits (73), Expect = 6.1 Identities = 15/45 (33%), Positives = 15/45 (33%) Frame = +1 Query: 433 PXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 P P P P PPPP PPPP P PP Sbjct: 579 PPSPDPPSPDPPSAPPPSPPPPSPPPPNPPPPSPPPPNPPPPSPP 623 Score = 33.1 bits (72), Expect = 8.1 Identities = 15/45 (33%), Positives = 15/45 (33%) Frame = +1 Query: 433 PXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 P P PP PPPP PPPP P PP Sbjct: 584 PPSPDPPSAPPPSPPPPSPPPPNPPPPSPPPPNPPPPSPPPPSPP 628 >UniRef50_Q8L7S5 Cluster: AT4g18560/F28J12_220; n=2; Arabidopsis thaliana|Rep: AT4g18560/F28J12_220 - Arabidopsis thaliana (Mouse-ear cress) Length = 642 Score = 41.1 bits (92), Expect = 0.030 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 PPPPP PPPP PPPPP P Sbjct: 313 PPPPPPPLLQQPPPPPSVSKAPPPPPPPP 341 Score = 40.7 bits (91), Expect = 0.040 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPP 534 P PPPPP PPPP PPPPPP Sbjct: 305 PQKSIPPPPPPPPPPLLQQPPPPPSVSKAPPPPPP 339 Score = 40.3 bits (90), Expect = 0.053 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 PPPPP PPPP PPPPP P Sbjct: 312 PPPPPPPPLLQQPPPPPSVSKAPPPPPPP 340 Score = 37.1 bits (82), Expect = 0.50 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 PPPPP PPP PPPPP P Sbjct: 314 PPPPPPLLQQPPPPPSVSKAPPPPPPPPP 342 Score = 35.5 bits (78), Expect = 1.5 Identities = 18/35 (51%), Positives = 18/35 (51%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPP 534 PP PPPPP K PPPP PPPPPP Sbjct: 317 PPPLLQQPPPPPSVSKA--PPPP------PPPPPP 343 Score = 33.5 bits (73), Expect = 6.1 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +1 Query: 454 PPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PPP PPPP PPPPP + PP Sbjct: 303 PPPQKSIPPPPPPPPPPLLQQPPPPPSVSKAPPPPPPP 340 >UniRef50_A7QGU9 Cluster: Chromosome chr16 scaffold_94, whole genome shotgun sequence; n=2; Vitis vinifera|Rep: Chromosome chr16 scaffold_94, whole genome shotgun sequence - Vitis vinifera (Grape) Length = 341 Score = 41.1 bits (92), Expect = 0.030 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXP 564 PPPPP PPPP PPPPPP A P Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPVKLIASIP 82 Score = 39.5 bits (88), Expect = 0.093 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 PPPPP PPPP PPPPP P Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 73 Score = 39.5 bits (88), Expect = 0.093 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 PPPPP PPPP PPPPP P Sbjct: 46 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 74 Score = 37.9 bits (84), Expect = 0.28 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 435 PXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPP 530 P PPPPP PPPP PPPPP Sbjct: 43 PAPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 74 Score = 37.5 bits (83), Expect = 0.37 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPP 534 P PPP PPPP PPPPPP Sbjct: 43 PAPPPPPPPPPPPPPPPPPPPPPPPPPP 70 Score = 36.3 bits (80), Expect = 0.86 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 P PPP PPPP PPPPP P Sbjct: 43 PAPPPPPPPPPPPPPPPPPPPPPPPPPPP 71 >UniRef50_A5BR16 Cluster: Putative uncharacterized protein; n=1; Vitis vinifera|Rep: Putative uncharacterized protein - Vitis vinifera (Grape) Length = 196 Score = 41.1 bits (92), Expect = 0.030 Identities = 18/35 (51%), Positives = 18/35 (51%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 PP PPPPP SPPPP PPPPP P Sbjct: 11 PPTPLSPPPPPPSP---SPPPPPSPSPSPPPPPSP 42 Score = 37.9 bits (84), Expect = 0.28 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 2/47 (4%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPP--PXPXXXAXXXXPP 566 PP PPPPP PPP PPPP P P PP Sbjct: 20 PPPSPSPPPPPSPSPSPPPPPSPSPPPSPPPPSSPPPPQRPRPLTPP 66 Score = 37.5 bits (83), Expect = 0.37 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPP 534 PP P PPP PPPP P PPPP Sbjct: 17 PPPPPPSPSPPPPPSPSPSPPPPPSPSPPPSPPPP 51 Score = 34.3 bits (75), Expect = 3.5 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 1/36 (2%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGG-XPPPPPXP 536 PP P PPP SPPPP PP PP P Sbjct: 36 PPPPPSPSPPPSPPPPSSPPPPQRPRPLTPPTPPTP 71 Score = 33.9 bits (74), Expect = 4.6 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 P PPPPP SPPPP PPPP PP Sbjct: 30 PSPSPSPPPPPSPSPPPSPPPPSS-----PPPPQRPRPLTPPTPP 69 >UniRef50_Q9VAT0 Cluster: CG1520-PA, isoform A; n=3; Sophophora|Rep: CG1520-PA, isoform A - Drosophila melanogaster (Fruit fly) Length = 527 Score = 41.1 bits (92), Expect = 0.030 Identities = 17/37 (45%), Positives = 18/37 (48%), Gaps = 2/37 (5%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXS--PPPPXXGGGXPPPPPXP 536 PP PPPPP + PPPP PPPPP P Sbjct: 364 PPISTAPPPPPVSAPVVAPPPPPPPPPAAVPPPPPPP 400 Score = 38.7 bits (86), Expect = 0.16 Identities = 17/39 (43%), Positives = 18/39 (46%), Gaps = 3/39 (7%) Frame = +1 Query: 430 PPXGXXXPPPPP---XXXKXXXPPPPXXGXXXPPPPPPL 537 PP PPPPP PPPP PPPPPP+ Sbjct: 363 PPPISTAPPPPPVSAPVVAPPPPPPPPPAAVPPPPPPPM 401 Score = 36.7 bits (81), Expect = 0.65 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 2/47 (4%) Frame = +3 Query: 432 PPXGXXPPPP--PXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 P PPPP P PPPP PPPP P A PP Sbjct: 351 PGAARAPPPPNRPPPISTAPPPPPVSAPVVAPPPPPPPPPAAVPPPP 397 Score = 36.3 bits (80), Expect = 0.86 Identities = 17/47 (36%), Positives = 17/47 (36%), Gaps = 2/47 (4%) Frame = +1 Query: 433 PXGXXXPPPP--PXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 P PPPP P PPPP PPPPP PP Sbjct: 351 PGAARAPPPPNRPPPISTAPPPPPVSAPVVAPPPPPPPPPAAVPPPP 397 >UniRef50_Q61QV1 Cluster: Putative uncharacterized protein CBG06865; n=1; Caenorhabditis briggsae|Rep: Putative uncharacterized protein CBG06865 - Caenorhabditis briggsae Length = 646 Score = 41.1 bits (92), Expect = 0.030 Identities = 25/65 (38%), Positives = 25/65 (38%), Gaps = 6/65 (9%) Frame = -1 Query: 533 GGGGGGXSXPXXGGGGXXXXXXX------GGGGGXXXPXGGXXXXXKXXPPPPPPGGXXX 372 GGGGGG GGGG GGG G GG PPPPP GG Sbjct: 27 GGGGGGCGGGCGGGGGCGGGCGPPPPPPCGGGCGGGGVCGGGGVCAPALPPPPPCGGGGG 86 Query: 371 TPXGG 357 GG Sbjct: 87 GCGGG 91 Score = 39.9 bits (89), Expect = 0.070 Identities = 24/52 (46%), Positives = 24/52 (46%) Frame = -2 Query: 535 GXGGGGGXPPPXXGGGGXXFXXXXGGGGGXXPXGGXXPXFXKXXPPPPPRGG 380 G GGG G PPP GGG GGGG GG PPPPP GG Sbjct: 42 GCGGGCGPPPPPPCGGGC-------GGGGVCGGGGVC---APALPPPPPCGG 83 Score = 34.7 bits (76), Expect = 2.6 Identities = 19/41 (46%), Positives = 19/41 (46%), Gaps = 6/41 (14%) Frame = -2 Query: 535 GXGGGGGX------PPPXXGGGGXXFXXXXGGGGGXXPXGG 431 G GGGG PPP GGGG GGGGG GG Sbjct: 63 GVCGGGGVCAPALPPPPPCGGGGGGCGGGCGGGGGGCGGGG 103 Score = 34.7 bits (76), Expect = 2.6 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = -1 Query: 566 GGXXAXXXXXRGGGGGGXSXPXXGGGGXXXXXXXGGGGGXXXPXGG 429 GG GGGGGG G GG GGGGG GG Sbjct: 103 GGGCGGGGGACGGGGGGCGGGGGGCGGGGGGCGGGGGGGCGGGGGG 148 Score = 34.7 bits (76), Expect = 2.6 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = -1 Query: 566 GGXXAXXXXXRGGGGGGXSXPXXGGGGXXXXXXXGGGGGXXXPXGG 429 GG GGGGGG G GG GGGGG GG Sbjct: 110 GGACGGGGGGCGGGGGGCGGGGGGCGGGGGGGCGGGGGGCGGGGGG 155 Score = 34.3 bits (75), Expect = 3.5 Identities = 20/43 (46%), Positives = 20/43 (46%) Frame = -2 Query: 508 PPXXGGGGXXFXXXXGGGGGXXPXGGXXPXFXKXXPPPPPRGG 380 P GGGG GGGGG GG P PPPPP GG Sbjct: 23 PSLGGGGGGGCGGGCGGGGGC--GGGCGP------PPPPPCGG 57 Score = 33.5 bits (73), Expect = 6.1 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -1 Query: 533 GGGGGGXSXPXXGGGGXXXXXXXGGGGGXXXPXGG 429 GGGGGG GGGG G GGG GG Sbjct: 82 GGGGGGCGGGCGGGGGGCGGGGGGCGGGGGACGGG 116 Score = 33.5 bits (73), Expect = 6.1 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = -2 Query: 565 GGXXXXAXXXGXGGGGGXPPPXXGGGGXXFXXXXGGGGGXXPXGG 431 GG G GGGGG GG G GGGGG GG Sbjct: 95 GGGGCGGGGGGCGGGGGACGGGGGGCGGGGGGCGGGGGGCGGGGG 139 Score = 33.5 bits (73), Expect = 6.1 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = -2 Query: 565 GGXXXXAXXXGXGGGGGXPPPXXGGGGXXFXXXXGGGGGXXPXGG 431 GG G GGGGG GG G GGGGG GG Sbjct: 109 GGGACGGGGGGCGGGGGGCGGGGGGCGGGGGGGCGGGGGGCGGGG 153 >UniRef50_Q0KI93 Cluster: CG12946-PB, isoform B; n=4; Sophophora|Rep: CG12946-PB, isoform B - Drosophila melanogaster (Fruit fly) Length = 630 Score = 41.1 bits (92), Expect = 0.030 Identities = 19/45 (42%), Positives = 19/45 (42%), Gaps = 1/45 (2%) Frame = +3 Query: 435 PXGXXPPPPPXXXXXXSPPPPXXGGGXPP-PPPXPXXXAXXXXPP 566 P PPPP PPPP G PP PPP P A PP Sbjct: 483 PVPVSPPPPTAASVGVPPPPPAPPAGVPPAPPPMPVFGAGGAPPP 527 Score = 40.7 bits (91), Expect = 0.040 Identities = 21/45 (46%), Positives = 22/45 (48%), Gaps = 3/45 (6%) Frame = +3 Query: 441 GXXPPPP-PXXXXXXSPPP-PXXG-GGXPPPPPXPXXXAXXXXPP 566 G PPPP P +PPP P G GG PPPPP P PP Sbjct: 497 GVPPPPPAPPAGVPPAPPPMPVFGAGGAPPPPPPPSSGMAGVPPP 541 Score = 37.5 bits (83), Expect = 0.37 Identities = 15/39 (38%), Positives = 16/39 (41%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PPPP PPPP PP PPP+ PP Sbjct: 488 PPPPTAASVGVPPPPPAPPAGVPPAPPPMPVFGAGGAPP 526 Score = 37.1 bits (82), Expect = 0.50 Identities = 18/44 (40%), Positives = 18/44 (40%), Gaps = 5/44 (11%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXX-----GGGXPPPPPXPXXXAXXXXPP 566 PPPPP P PP GG PPPPP A PP Sbjct: 499 PPPPPAPPAGVPPAPPPMPVFGAGGAPPPPPPPSSGMAGVPPPP 542 Score = 37.1 bits (82), Expect = 0.50 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PP PP P G PPPPP A PP Sbjct: 502 PPAPPAGVPPAPPPMPVFGAGGAPPPPPPPSSGMAGVPP 540 Score = 33.9 bits (74), Expect = 4.6 Identities = 16/40 (40%), Positives = 17/40 (42%), Gaps = 4/40 (10%) Frame = +1 Query: 430 PPXGXXXPPPPPXXX----KXXXPPPPXXGXXXPPPPPPL 537 PP G PPP PPPP G PPPPP+ Sbjct: 505 PPAGVPPAPPPMPVFGAGGAPPPPPPPSSGMAGVPPPPPM 544 Score = 33.5 bits (73), Expect = 6.1 Identities = 16/41 (39%), Positives = 17/41 (41%), Gaps = 3/41 (7%) Frame = +1 Query: 454 PPPPXXXKXXXPPPPXX---GXXXPPPPPPLXXXXXAXXPP 567 PPPP PPPP G PPP P+ A PP Sbjct: 488 PPPPTAASVGVPPPPPAPPAGVPPAPPPMPVFGAGGAPPPP 528 >UniRef50_Q6CD36 Cluster: Similar to sp|P53281 Saccharomyces cerevisiae YGR136w; n=1; Yarrowia lipolytica|Rep: Similar to sp|P53281 Saccharomyces cerevisiae YGR136w - Yarrowia lipolytica (Candida lipolytica) Length = 305 Score = 41.1 bits (92), Expect = 0.030 Identities = 16/33 (48%), Positives = 17/33 (51%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPP 530 PP PPPP +PPPP GG PPPP Sbjct: 210 PPPTQYNPPPPEQYGYQAPPPPGYQGGYQPPPP 242 Score = 33.9 bits (74), Expect = 4.6 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPP 531 PP PPPP PPPP PPPP Sbjct: 209 PPPPTQYNPPPPEQYGYQAPPPPGYQGGYQPPPP 242 >UniRef50_A7F7G2 Cluster: Putative uncharacterized protein; n=2; Sclerotiniaceae|Rep: Putative uncharacterized protein - Sclerotinia sclerotiorum 1980 Length = 931 Score = 41.1 bits (92), Expect = 0.030 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPP 530 PP PPPP PPPP G PPPPP Sbjct: 883 PPPPGWQPPPPGSYGGPPPPPPGSYGAYPPPPP 915 Score = 37.1 bits (82), Expect = 0.50 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPP 531 PP PPPP PPPP PPPPP Sbjct: 882 PPPPPGWQPPPPGSYGGPPPPPPGSYGAYPPPPP 915 Score = 36.3 bits (80), Expect = 0.86 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPPXXXXXG 584 PPPPP PPPP GG PPPP P PP G Sbjct: 882 PPPPPGW----QPPPPGSYGG--PPPPPPGSYGAYPPPPPGYGGG 920 Score = 34.7 bits (76), Expect = 2.6 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +3 Query: 441 GXXPPPPPXXXXXXSPPPPXXGGG 512 G PPPPP PPPP GGG Sbjct: 897 GGPPPPPPGSYGAYPPPPPGYGGG 920 Score = 33.5 bits (73), Expect = 6.1 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PPPPP PPP PPPPPP PP Sbjct: 882 PPPPPGWQ-----PPPPGSYGGPPPPPPGSYGAYPPPPP 915 >UniRef50_A6SD70 Cluster: Putative uncharacterized protein; n=1; Botryotinia fuckeliana B05.10|Rep: Putative uncharacterized protein - Botryotinia fuckeliana B05.10 Length = 1648 Score = 41.1 bits (92), Expect = 0.030 Identities = 22/52 (42%), Positives = 23/52 (44%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 PP G G F PP PPPPP +P P GG PPPPP P Sbjct: 992 PPMPGQGPPGF---NGPPP----PPPPPPPPGMNAPVAPGFGGPPPPPPPPP 1036 Score = 37.9 bits (84), Expect = 0.28 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 P PPPPP PP G PPPPP P Sbjct: 979 PGFNGPPPPPPPPPPMPGQGPPGFNGPPPPPPPPP 1013 Score = 37.5 bits (83), Expect = 0.37 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 441 GXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 G PPPPP PP G PPPPP P Sbjct: 983 GPPPPPPPPPPMPGQGPPGFNGPPPPPPPPPP 1014 >UniRef50_Q6P0D5 Cluster: WW domain-binding protein 11; n=7; Euteleostomi|Rep: WW domain-binding protein 11 - Danio rerio (Zebrafish) (Brachydanio rerio) Length = 640 Score = 41.1 bits (92), Expect = 0.030 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP G P PPP PPP G PPPPP P PP Sbjct: 440 PPPGLPPGPPPRGPPPRLPPPAPP--GMPPPPPPPRAGPPRMAPP 482 Score = 37.1 bits (82), Expect = 0.50 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP G P PPP P PP G PPP P PP Sbjct: 428 PPPGRPPGPPPGPPPGLPPGPPPRGPPPRLPPPAPPGMPPPPPPP 472 >UniRef50_UPI00015B5C8A Cluster: PREDICTED: similar to formin 1,2/cappuccino; n=1; Nasonia vitripennis|Rep: PREDICTED: similar to formin 1,2/cappuccino - Nasonia vitripennis Length = 1271 Score = 40.7 bits (91), Expect = 0.040 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 2/41 (4%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGG--GXPPPPPXPXXXAXXXXPP 566 PPPPP PPPP G PPPPP P PP Sbjct: 559 PPPPPMPGIMQPPPPPPMPGMMSGPPPPPPPMPEMMSGPPP 599 Score = 39.9 bits (89), Expect = 0.070 Identities = 19/50 (38%), Positives = 20/50 (40%), Gaps = 5/50 (10%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPP-----XXGGGXPPPPPXPXXXAXXXXPPXXXXXG 584 PPPPP PPPP G PPPPP P + PP G Sbjct: 558 PPPPPPMPGIMQPPPPPPMPGMMSGPPPPPPPMPEMMSGPPPPPPPPMPG 607 Score = 38.7 bits (86), Expect = 0.16 Identities = 17/41 (41%), Positives = 18/41 (43%), Gaps = 2/41 (4%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXX--PPPPPPLXXXXXAXXPP 567 PPPP PPPP G PPPPPP+ PP Sbjct: 560 PPPPMPGIMQPPPPPPMPGMMSGPPPPPPPMPEMMSGPPPP 600 Score = 38.7 bits (86), Expect = 0.16 Identities = 18/44 (40%), Positives = 18/44 (40%), Gaps = 5/44 (11%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXG-----GGXPPPPPXPXXXAXXXXPP 566 PPPPP PPPP G PPPPP P PP Sbjct: 571 PPPPPMPGMMSGPPPPPPPMPEMMSGPPPPPPPPMPGMMSGPPP 614 Score = 37.5 bits (83), Expect = 0.37 Identities = 21/54 (38%), Positives = 21/54 (38%), Gaps = 6/54 (11%) Frame = +3 Query: 441 GXXPPPPPXXXXXXS----PPPPXXG--GGXPPPPPXPXXXAXXXXPPXXXXXG 584 G PPPPP S PPPP G G P PPP P PP G Sbjct: 596 GPPPPPPPPMPGMMSGPPPPPPPIPGMMTGPPSPPPPPLVATVVGPPPPLPPGG 649 Score = 36.7 bits (81), Expect = 0.65 Identities = 17/45 (37%), Positives = 18/45 (40%), Gaps = 6/45 (13%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXX------GXXXPPPPPPLXXXXXAXXPP 567 PPPPP PPPP PPPPPP+ PP Sbjct: 571 PPPPPMPGMMSGPPPPPPPMPEMMSGPPPPPPPPMPGMMSGPPPP 615 Score = 36.3 bits (80), Expect = 0.86 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 4/46 (8%) Frame = +3 Query: 441 GXXPPPPPXXXXXXSPPPPXX----GGGXPPPPPXPXXXAXXXXPP 566 G PPPPP PPPP G PPPP P PP Sbjct: 582 GPPPPPPPMPEMMSGPPPPPPPPMPGMMSGPPPPPPPIPGMMTGPP 627 Score = 34.7 bits (76), Expect = 2.6 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 4/43 (9%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXX----GXXXPPPPPPLXXXXXAXXPP 567 PPPPP PPPP G PPPPP PP Sbjct: 585 PPPPPMPEMMSGPPPPPPPPMPGMMSGPPPPPPPIPGMMTGPP 627 Score = 33.1 bits (72), Expect = 8.1 Identities = 17/45 (37%), Positives = 19/45 (42%), Gaps = 6/45 (13%) Frame = +1 Query: 451 PPPPPXXXKXX------XPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PP + PPPP G PPPPPP+ PP Sbjct: 542 PPSPPSRPEMLASLPPPPPPPPMPGIMQPPPPPPMPGMMSGPPPP 586 >UniRef50_UPI0000F2CB43 Cluster: PREDICTED: hypothetical protein; n=1; Monodelphis domestica|Rep: PREDICTED: hypothetical protein - Monodelphis domestica Length = 252 Score = 40.7 bits (91), Expect = 0.040 Identities = 20/56 (35%), Positives = 21/56 (37%) Frame = -1 Query: 533 GGGGGGXSXPXXGGGGXXXXXXXGGGGGXXXPXGGXXXXXKXXPPPPPPGGXXXTP 366 GGGGGG GGGG GG GG G + P P PG P Sbjct: 197 GGGGGGGGGGGGGGGGGGGGGGGGGSGGSSSSSGSGGSGGEDRSPEPSPGRRPPPP 252 Score = 37.5 bits (83), Expect = 0.37 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = -1 Query: 533 GGGGGGXSXPXXGGGGXXXXXXXGGGGGXXXPXGG 429 GGGGGG GGGG GGGGG GG Sbjct: 190 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGSGG 224 Score = 36.3 bits (80), Expect = 0.86 Identities = 26/76 (34%), Positives = 27/76 (35%), Gaps = 3/76 (3%) Frame = -1 Query: 563 GXXAXXXXXRGGGGGGXSXPXXGGGGXXXXXXXGGGGGXXXPXGGXXXXXKXXPPPPPPG 384 G A GGGGGG GGGG GGGGG GG G Sbjct: 181 GAAAGGAGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG-----GGGSGGSSSSSGSGGSG 235 Query: 383 GXXXTP---XGGXPPP 345 G +P G PPP Sbjct: 236 GEDRSPEPSPGRRPPP 251 Score = 34.7 bits (76), Expect = 2.6 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = -2 Query: 565 GGXXXXAXXXGXGGGGGXPPPXXGGGGXXFXXXXGGGGGXXPXG 434 G A G GGGGG GGGG GGGGG G Sbjct: 181 GAAAGGAGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGSGG 224 >UniRef50_UPI0000F2B52B Cluster: PREDICTED: similar to diaphanous 1; n=1; Monodelphis domestica|Rep: PREDICTED: similar to diaphanous 1 - Monodelphis domestica Length = 1186 Score = 40.7 bits (91), Expect = 0.040 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 2/47 (4%) Frame = +1 Query: 433 PXGXXXPPPPPXXXKXXXPPPPXXGXXXP--PPPPPLXXXXXAXXPP 567 P G PPPPP PPPP P PPP PL PP Sbjct: 590 PSGINVPPPPPLPGSISIPPPPPPPPPLPVLPPPSPLPLPGSTGIPP 636 Score = 37.9 bits (84), Expect = 0.28 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPP 534 P G PPPP PPP G PPPPPP Sbjct: 627 PLPGSTGIPPPPPLLGGPGIPPPLPGMCLPPPPPP 661 Score = 36.3 bits (80), Expect = 0.86 Identities = 19/53 (35%), Positives = 20/53 (37%), Gaps = 2/53 (3%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXS--PPPPXXGGGXPPPPPXPXXXAXXXXPPXXXXXG 584 PP PPP P + PPPP GG PPP P PP G Sbjct: 615 PPLPVLPPPSPLPLPGSTGIPPPPPLLGGPGIPPPLPGMCLPPPPPPAFGGLG 667 Score = 35.9 bits (79), Expect = 1.1 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 P PP PP PPPP G PPP P PP Sbjct: 578 PSSDTVPPAPPLPSGINVPPPPPLPGSISIPPPPPPPPPLPVLPP 622 Score = 35.1 bits (77), Expect = 2.0 Identities = 16/32 (50%), Positives = 16/32 (50%), Gaps = 3/32 (9%) Frame = +1 Query: 451 PPPPPXXXKXXXPPP---PXXGXXXPPPPPPL 537 PPPPP PPP P G PPPPPL Sbjct: 609 PPPPPPPPLPVLPPPSPLPLPGSTGIPPPPPL 640 Score = 34.7 bits (76), Expect = 2.6 Identities = 17/46 (36%), Positives = 17/46 (36%), Gaps = 1/46 (2%) Frame = +1 Query: 433 PXGXXXPPPPPXXXKXXXPPPPXX-GXXXPPPPPPLXXXXXAXXPP 567 P PP PP PPPP G PPPPP PP Sbjct: 578 PSSDTVPPAPPLPSGINVPPPPPLPGSISIPPPPPPPPPLPVLPPP 623 Score = 33.5 bits (73), Expect = 6.1 Identities = 16/31 (51%), Positives = 16/31 (51%), Gaps = 4/31 (12%) Frame = +3 Query: 450 PPPPPXXXXXXSPPP---PXXGG-GXPPPPP 530 PPPPP PPP P G G PPPPP Sbjct: 609 PPPPPPPPLPVLPPPSPLPLPGSTGIPPPPP 639 >UniRef50_UPI0000D9F058 Cluster: PREDICTED: hypothetical protein; n=1; Macaca mulatta|Rep: PREDICTED: hypothetical protein - Macaca mulatta Length = 149 Score = 40.7 bits (91), Expect = 0.040 Identities = 24/66 (36%), Positives = 25/66 (37%), Gaps = 5/66 (7%) Frame = +3 Query: 384 PRGGGGGXXFXXXGXXPPXGXXPPPPPXXXXXXSPPP---PXXGGGXP--PPPPXPXXXA 548 P G G G G PPPPP PPP GGG P PPPP P + Sbjct: 51 PISPGPGLRGAGGGEAGTVGSLPPPPPPLLPPLPPPPLHLRPTGGGRPEAPPPPSPPASS 110 Query: 549 XXXXPP 566 PP Sbjct: 111 LPVTPP 116 >UniRef50_UPI0000499A11 Cluster: hypothetical protein 42.t00003; n=2; Eukaryota|Rep: hypothetical protein 42.t00003 - Entamoeba histolytica HM-1:IMSS Length = 1575 Score = 40.7 bits (91), Expect = 0.040 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPP 534 PP PPPPP PPPP PPPPPP Sbjct: 1424 PPPTLSMPPPPPPTLSMPPPPPPTLS--MPPPPPP 1456 Score = 40.7 bits (91), Expect = 0.040 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPP 534 PP PPPPP PPPP PPPPPP Sbjct: 1434 PPPTLSMPPPPPPTLSMPPPPPPTLS--MPPPPPP 1466 Score = 40.7 bits (91), Expect = 0.040 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPP 534 PP PPPPP PPPP PPPPPP Sbjct: 1444 PPPTLSMPPPPPPTLSMPPPPPPTLSM--PPPPPP 1476 Score = 40.7 bits (91), Expect = 0.040 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPP 534 PP PPPPP PPPP PPPPPP Sbjct: 1454 PPPTLSMPPPPPPTLSMPPPPPPTLS--MPPPPPP 1486 Score = 40.7 bits (91), Expect = 0.040 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPP 534 PP PPPPP PPPP PPPPPP Sbjct: 1464 PPPTLSMPPPPPPTLSMPPPPPPTLS--MPPPPPP 1496 Score = 38.7 bits (86), Expect = 0.16 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = +1 Query: 433 PXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPP 534 P PPPPP PPPP PPPPPP Sbjct: 1415 PSSIATPPPPPPTLSMPPPPPPTLS--MPPPPPP 1446 Score = 37.9 bits (84), Expect = 0.28 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPP P PP Sbjct: 1425 PPTLSMPPPPPPTLSMPPPPPPTLS---MPPPPPPTLSMPPPPPP 1466 Score = 37.9 bits (84), Expect = 0.28 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPP P PP Sbjct: 1435 PPTLSMPPPPPPTLSMPPPPPPTLS---MPPPPPPTLSMPPPPPP 1476 Score = 37.9 bits (84), Expect = 0.28 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPP P PP Sbjct: 1445 PPTLSMPPPPPPTLSMPPPPPPTLS---MPPPPPPTLSMPPPPPP 1486 Score = 37.9 bits (84), Expect = 0.28 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPP P PP Sbjct: 1455 PPTLSMPPPPPPTLSMPPPPPPTLS---MPPPPPPTLSMPPPPPP 1496 >UniRef50_UPI0000DC1448 Cluster: UPI0000DC1448 related cluster; n=2; Rattus norvegicus|Rep: UPI0000DC1448 UniRef100 entry - Rattus norvegicus Length = 319 Score = 40.7 bits (91), Expect = 0.040 Identities = 18/37 (48%), Positives = 18/37 (48%), Gaps = 2/37 (5%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSP--PPPXXGGGXPPPPPXP 536 PP PPPPP SP PPP PPPPP P Sbjct: 158 PPSLSSPPPPPSPSSLSSPLPPPPPLSPSPPPPPPPP 194 Score = 35.9 bits (79), Expect = 1.1 Identities = 16/46 (34%), Positives = 17/46 (36%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPPP PP P P PP P + PP Sbjct: 111 PPSPPSPPPPPPPLPPSPSPPSPPPPSPPPLPPSPSPPSLSSPLPP 156 Score = 35.5 bits (78), Expect = 1.5 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPP P PPPP P P PP PP Sbjct: 114 PPSPPPPPPPLPPSPSPPSPPPPSPPPLPPSPSPPSLSSPLPPSPP 159 Score = 34.7 bits (76), Expect = 2.6 Identities = 18/47 (38%), Positives = 19/47 (40%), Gaps = 2/47 (4%) Frame = +3 Query: 432 PPXGXXP-PPPPXXXXXXSPPPPXXGG-GXPPPPPXPXXXAXXXXPP 566 PP P PP P SP PP PPPPP P + PP Sbjct: 134 PPPSPPPLPPSPSPPSLSSPLPPSPPSLSSPPPPPSPSSLSSPLPPP 180 Score = 34.7 bits (76), Expect = 2.6 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 P PP PP PP P PPPPPL PP Sbjct: 148 PSLSSPLPPSPPSLSSPPPPPSPSSLSSPLPPPPPLSPSPPPPPPP 193 >UniRef50_UPI0000F31107 Cluster: PREDICTED: Bos taurus similar to Formin homology 2 domain containing 1 (LOC787862), mRNA.; n=1; Bos taurus|Rep: PREDICTED: Bos taurus similar to Formin homology 2 domain containing 1 (LOC787862), mRNA. - Bos Taurus Length = 1125 Score = 40.7 bits (91), Expect = 0.040 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = +1 Query: 439 GXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 G PPPPP PPPP PPPPPPL PP Sbjct: 529 GIPPPPPPPPLLSGSLPPPP------PPPPPPLKSPFPPTPPP 565 Score = 37.5 bits (83), Expect = 0.37 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = +3 Query: 453 PPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PPPP PPPP G PPPPP P PP Sbjct: 531 PPPP-------PPPPLLSGSLPPPPPPPPPPLKSPFPP 561 >UniRef50_Q4RHV8 Cluster: Chromosome 8 SCAF15044, whole genome shotgun sequence; n=2; Tetraodon nigroviridis|Rep: Chromosome 8 SCAF15044, whole genome shotgun sequence - Tetraodon nigroviridis (Green puffer) Length = 1314 Score = 40.7 bits (91), Expect = 0.040 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPP 531 PP PPPPP PPPP G PPPPP Sbjct: 674 PPCSTALPPPPPLFG--CPPPPPALGKMMPPPPP 705 Score = 37.9 bits (84), Expect = 0.28 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PPPPP PPPP G PPPPP PP Sbjct: 670 PPPPPPCSTALPPPPPLFGC---PPPPPALGKMMPPPPP 705 Score = 37.5 bits (83), Expect = 0.37 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPP 528 PP PPPPP K PPPP PP P Sbjct: 683 PPPLFGCPPPPPALGKMMPPPPPFMAPFPPPSP 715 Score = 37.1 bits (82), Expect = 0.50 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +1 Query: 439 GXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPL 537 G PPPPP PPPP PPPPP L Sbjct: 665 GDMIPPPPPPPCSTALPPPPPL-FGCPPPPPAL 696 Score = 36.3 bits (80), Expect = 0.86 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +3 Query: 396 GGGXXFXXXGXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPP 530 G G P PPPPP PPPP G PPPPP Sbjct: 663 GSGDMIPPPPPPPCSTALPPPPP--LFGCPPPPPALGKMMPPPPP 705 Score = 34.3 bits (75), Expect = 3.5 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PPPPP PPPP G PPPPP PP Sbjct: 670 PPPPPPCSTALPPPPPLFG--CPPPPPA-LGKMMPPPPP 705 >UniRef50_Q2NNS2 Cluster: 1629capsid; n=1; Hyphantria cunea nucleopolyhedrovirus|Rep: 1629capsid - Hyphantria cunea nuclear polyhedrosis virus (HcNPV) Length = 539 Score = 40.7 bits (91), Expect = 0.040 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPP 534 PPPPP PPPP PPPPPP Sbjct: 245 PPPPPPNMPPPPPPPPNMPPPPPPPPPP 272 Score = 40.3 bits (90), Expect = 0.053 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = +3 Query: 435 PXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 P PPPPP PPPP PPPPP P Sbjct: 240 PPPPTPPPPPPNMPPPPPPPPNMPPPPPPPPPPP 273 Score = 35.9 bits (79), Expect = 1.1 Identities = 18/36 (50%), Positives = 18/36 (50%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPL 537 PP PPPPP PPPP PPPPPPL Sbjct: 248 PPPNMPPPPPPP----PNMPPPP-----PPPPPPPL 274 >UniRef50_Q9A2R2 Cluster: OmpA family protein; n=5; Caulobacter|Rep: OmpA family protein - Caulobacter crescentus (Caulobacter vibrioides) Length = 449 Score = 40.7 bits (91), Expect = 0.040 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPP 534 PPPPP PPPP PPPPPP Sbjct: 306 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 333 Score = 40.7 bits (91), Expect = 0.040 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPP 534 PPPPP PPPP PPPPPP Sbjct: 307 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 334 Score = 40.7 bits (91), Expect = 0.040 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPP 534 PPPPP PPPP PPPPPP Sbjct: 308 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 335 Score = 40.7 bits (91), Expect = 0.040 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPP 534 PPPPP PPPP PPPPPP Sbjct: 309 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 336 Score = 39.9 bits (89), Expect = 0.070 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXA 548 PPPPP PPPP PPPPP P A Sbjct: 308 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPAFEA 340 >UniRef50_Q8GD27 Cluster: Adhesin FhaB; n=3; cellular organisms|Rep: Adhesin FhaB - Bordetella avium Length = 2621 Score = 40.7 bits (91), Expect = 0.040 Identities = 20/50 (40%), Positives = 20/50 (40%), Gaps = 4/50 (8%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPP----XXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPPP K PPPP PPPPPP PP Sbjct: 2324 PPPPPPPPPPPPKVKKVDPPPPPPPPKVKKVDPPPPPPPPPPKVKKVDPP 2373 Score = 39.5 bits (88), Expect = 0.093 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 454 PPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PPPP PPPP PPPPPP PP Sbjct: 2321 PPPPPPPPPPPPPPPKVKKVDPPPPPPPPKVKKVDPPP 2358 Score = 38.7 bits (86), Expect = 0.16 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PPPPP PPP PPPPP P PP Sbjct: 2321 PPPPPPPPPPPPPPPKVKKVDPPPPPPPPKVKKVDPPPP 2359 Score = 38.3 bits (85), Expect = 0.21 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PPPPP PPP PPPPPP PP Sbjct: 2321 PPPPPPPPPPPPPPPKVKKVDPPPPPPPPKVKKVDPPPP 2359 Score = 37.9 bits (84), Expect = 0.28 Identities = 19/51 (37%), Positives = 19/51 (37%), Gaps = 6/51 (11%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGG------GXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 2388 PPPPPPPPPPPKVKKVDPPPPPPPPPPKVKKVDPPPPPPPPPPKVKKVDPP 2438 Score = 37.9 bits (84), Expect = 0.28 Identities = 19/51 (37%), Positives = 19/51 (37%), Gaps = 6/51 (11%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGG------GXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 2437 PPPPPPPPPPPKVKKVDPPPPPPPPPPKVKKVDPPPPPPPPPPKVKKVDPP 2487 Score = 36.7 bits (81), Expect = 0.65 Identities = 18/46 (39%), Positives = 19/46 (41%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPPP K PPPP PPPP + PP Sbjct: 2323 PPPPPPPPPPPPPKVKKVDPPPP-------PPPPKVKKVDPPPPPP 2361 Score = 36.7 bits (81), Expect = 0.65 Identities = 18/44 (40%), Positives = 18/44 (40%), Gaps = 5/44 (11%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXX-----PPPPPPLXXXXXAXXPP 567 PPPPP K PPPP PPPPPP PP Sbjct: 2459 PPPPPKVKKVDPPPPPPPPPPKVKKVDPPPPPPPPPKVKKVDPP 2502 Score = 36.3 bits (80), Expect = 0.86 Identities = 19/51 (37%), Positives = 19/51 (37%), Gaps = 6/51 (11%) Frame = +1 Query: 433 PXGXXXPPPPPXXXKXXXPPPPXXGXXX------PPPPPPLXXXXXAXXPP 567 P PPPPP K PPPP PPPPPP PP Sbjct: 2388 PPPPPPPPPPPKVKKVDPPPPPPPPPPKVKKVDPPPPPPPPPPKVKKVDPP 2438 Score = 35.9 bits (79), Expect = 1.1 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 6/45 (13%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXX------PPPPPPLXXXXXAXXPP 567 PPPPP K PPPP PPPPPP PP Sbjct: 2345 PPPPPKVKKVDPPPPPPPPPPKVKKVDPPPPPPPPPPKVKKVDPP 2389 Score = 35.9 bits (79), Expect = 1.1 Identities = 19/52 (36%), Positives = 19/52 (36%), Gaps = 7/52 (13%) Frame = +1 Query: 433 PXGXXXPPPPPXXXKXXXPPPPXXGXXX-------PPPPPPLXXXXXAXXPP 567 P PPPPP K PPPP PPPPPP PP Sbjct: 2437 PPPPPPPPPPPKVKKVDPPPPPPPPPPKVKKVDPPPPPPPPPPKVKKVDPPP 2488 Score = 35.9 bits (79), Expect = 1.1 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PPPPP PPPP PPPPP P PP Sbjct: 2470 PPPPPP------PPPPKVKKVDPPPPPPPPPKVKKVDPP 2502 Score = 35.5 bits (78), Expect = 1.5 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 P PPP PPPP PPPP P PP Sbjct: 2319 PSPPPPPPPPPPPPPPPKVKKVDPPPPPPPPKVKKVDPP 2357 Score = 35.5 bits (78), Expect = 1.5 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPPP K PP PPPPPP PP Sbjct: 2321 PPPPPPPPPPPPPPPKVKKVDPP------PPPPPPKVKKVDPPPPP 2360 Score = 35.5 bits (78), Expect = 1.5 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PPPPP K PPPP PPPPP PP Sbjct: 2376 PPPPPPKVKKVDPPPP-------PPPPPPPKVKKVDPPP 2407 Score = 35.5 bits (78), Expect = 1.5 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PPPPP K PPPP PPPPP PP Sbjct: 2425 PPPPPPKVKKVDPPPP-------PPPPPPPKVKKVDPPP 2456 Score = 35.5 bits (78), Expect = 1.5 Identities = 19/56 (33%), Positives = 19/56 (33%), Gaps = 5/56 (8%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGG-----GXPPPPPXPXXXAXXXXPPXXXXXG 584 PP PPPP PPPP PPPPP P PP G Sbjct: 2454 PPPPPPPPPPKVKKVDPPPPPPPPPPKVKKVDPPPPPPPPPKVKKVDPPPKDEVDG 2509 Score = 35.1 bits (77), Expect = 2.0 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 P PPP PPPP PPPPP PP Sbjct: 2319 PSPPPPPPPPPPPPPPPKVKKVDPPPPPPPPKVKKVDPP 2357 Score = 35.1 bits (77), Expect = 2.0 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 7/46 (15%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXX-------PPPPPPLXXXXXAXXPP 567 PPPPP K PPPP PPPPPP PP Sbjct: 2361 PPPPPKVKKVDPPPPPPPPPPKVKKVDPPPPPPPPPPPKVKKVDPP 2406 Score = 35.1 bits (77), Expect = 2.0 Identities = 18/40 (45%), Positives = 18/40 (45%), Gaps = 1/40 (2%) Frame = +1 Query: 451 PPPPPX-XXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PPPPP K PPPP PPPPPP PP Sbjct: 2375 PPPPPPPKVKKVDPPPP-----PPPPPPPKVKKVDPPPPP 2409 Score = 35.1 bits (77), Expect = 2.0 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 7/46 (15%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXX-------PPPPPPLXXXXXAXXPP 567 PPPPP K PPPP PPPPPP PP Sbjct: 2377 PPPPPKVKKVDPPPPPPPPPPPKVKKVDPPPPPPPPPPKVKKVDPP 2422 Score = 35.1 bits (77), Expect = 2.0 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 7/46 (15%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXX-------PPPPPPLXXXXXAXXPP 567 PPPPP K PPPP PPPPPP PP Sbjct: 2410 PPPPPKVKKVDPPPPPPPPPPKVKKVDPPPPPPPPPPPKVKKVDPP 2455 Score = 35.1 bits (77), Expect = 2.0 Identities = 18/40 (45%), Positives = 18/40 (45%), Gaps = 1/40 (2%) Frame = +1 Query: 451 PPPPPX-XXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PPPPP K PPPP PPPPPP PP Sbjct: 2424 PPPPPPPKVKKVDPPPP-----PPPPPPPKVKKVDPPPPP 2458 Score = 35.1 bits (77), Expect = 2.0 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 7/46 (15%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXX-------PPPPPPLXXXXXAXXPP 567 PPPPP K PPPP PPPPPP PP Sbjct: 2426 PPPPPKVKKVDPPPPPPPPPPPKVKKVDPPPPPPPPPPKVKKVDPP 2471 Score = 34.7 bits (76), Expect = 2.6 Identities = 18/51 (35%), Positives = 18/51 (35%), Gaps = 6/51 (11%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXG------GGXPPPPPXPXXXAXXXXPP 566 PP PPPP PPPP PPPPP P PP Sbjct: 2356 PPPPPPPPPPKVKKVDPPPPPPPPPPKVKKVDPPPPPPPPPPPKVKKVDPP 2406 Score = 34.7 bits (76), Expect = 2.6 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PPPPP K PPPP PPPPP PP Sbjct: 2360 PPPPPPKVKKVDPPPP-------PPPPPPKVKKVDPPPP 2391 Score = 34.7 bits (76), Expect = 2.6 Identities = 18/51 (35%), Positives = 18/51 (35%), Gaps = 6/51 (11%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGG------GXPPPPPXPXXXAXXXXPP 566 PP PPPP PPPP PPPPP P PP Sbjct: 2372 PPPPPPPPPPKVKKVDPPPPPPPPPPPKVKKVDPPPPPPPPPPKVKKVDPP 2422 Score = 34.7 bits (76), Expect = 2.6 Identities = 18/51 (35%), Positives = 18/51 (35%), Gaps = 6/51 (11%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXG------GGXPPPPPXPXXXAXXXXPP 566 PP PPPP PPPP PPPPP P PP Sbjct: 2405 PPPPPPPPPPKVKKVDPPPPPPPPPPKVKKVDPPPPPPPPPPPKVKKVDPP 2455 Score = 34.7 bits (76), Expect = 2.6 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PPPPP K PPPP PPPPP PP Sbjct: 2409 PPPPPPKVKKVDPPPP-------PPPPPPKVKKVDPPPP 2440 Score = 34.7 bits (76), Expect = 2.6 Identities = 18/51 (35%), Positives = 18/51 (35%), Gaps = 6/51 (11%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGG------GXPPPPPXPXXXAXXXXPP 566 PP PPPP PPPP PPPPP P PP Sbjct: 2421 PPPPPPPPPPKVKKVDPPPPPPPPPPPKVKKVDPPPPPPPPPPKVKKVDPP 2471 Score = 34.7 bits (76), Expect = 2.6 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PPPPP K PPPP PPPPP PP Sbjct: 2458 PPPPPPKVKKVDPPPP-------PPPPPPKVKKVDPPPP 2489 Score = 34.3 bits (75), Expect = 3.5 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 6/45 (13%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGG------GXPPPPPXPXXXAXXXXPP 566 PPPPP PPPP PPPPP P PP Sbjct: 2345 PPPPPKVKKVDPPPPPPPPPPKVKKVDPPPPPPPPPPKVKKVDPP 2389 Score = 33.9 bits (74), Expect = 4.6 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 2/41 (4%) Frame = +1 Query: 451 PPPPPX--XXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PPPPP K PPPP PPPPPP PP Sbjct: 2342 PPPPPPPPKVKKVDPPPP------PPPPPPKVKKVDPPPPP 2376 Score = 33.9 bits (74), Expect = 4.6 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 2/41 (4%) Frame = +1 Query: 451 PPPPPX--XXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PPPPP K PPPP PPPPPP PP Sbjct: 2358 PPPPPPPPKVKKVDPPPP------PPPPPPKVKKVDPPPPP 2392 Score = 33.9 bits (74), Expect = 4.6 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 2/41 (4%) Frame = +1 Query: 451 PPPPPX--XXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PPPPP K PPPP PPPPPP PP Sbjct: 2407 PPPPPPPPKVKKVDPPPP------PPPPPPKVKKVDPPPPP 2441 >UniRef50_Q0ANI5 Cluster: OmpA/MotB domain protein precursor; n=2; Hyphomonadaceae|Rep: OmpA/MotB domain protein precursor - Maricaulis maris (strain MCS10) Length = 359 Score = 40.7 bits (91), Expect = 0.040 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPP 534 PPPPP PPPP PPPPPP Sbjct: 216 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 243 Score = 40.7 bits (91), Expect = 0.040 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPP 534 PPPPP PPPP PPPPPP Sbjct: 217 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 244 Score = 40.7 bits (91), Expect = 0.040 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPP 534 PPPPP PPPP PPPPPP Sbjct: 218 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 245 >UniRef50_A1SEF2 Cluster: Putative uncharacterized protein; n=1; Nocardioides sp. JS614|Rep: Putative uncharacterized protein - Nocardioides sp. (strain BAA-499 / JS614) Length = 282 Score = 40.7 bits (91), Expect = 0.040 Identities = 18/37 (48%), Positives = 18/37 (48%), Gaps = 2/37 (5%) Frame = +3 Query: 432 PPXGXXPPP--PPXXXXXXSPPPPXXGGGXPPPPPXP 536 PP PPP PP PPPP G G PPPP P Sbjct: 8 PPDQAPPPPLPPPSGDGYGGPPPPTGGYGENPPPPPP 44 Score = 38.3 bits (85), Expect = 0.21 Identities = 17/37 (45%), Positives = 17/37 (45%), Gaps = 2/37 (5%) Frame = +1 Query: 430 PPXGXXXPP--PPPXXXKXXXPPPPXXGXXXPPPPPP 534 PP PP PPP PPPP G PPPPP Sbjct: 7 PPPDQAPPPPLPPPSGDGYGGPPPPTGGYGENPPPPP 43 Score = 35.9 bits (79), Expect = 1.1 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +2 Query: 452 PPPPXXXXKXXXPPPXXXGXXXPPPPXPXXXXXXXXPPP 568 PPPP PPP G PPPP PPP Sbjct: 6 PPPPDQAPPPPLPPPSGDGYGGPPPPTGGYGENPPPPPP 44 Score = 34.3 bits (75), Expect = 3.5 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPPXXXXXG 584 PPPP PPP G G PPPP PP G Sbjct: 6 PPPPDQAPPPPLPPPSGDGYGGPPPPTGGYGENPPPPPPAPSYGG 50 >UniRef50_A1G4V0 Cluster: Putative uncharacterized protein; n=2; Salinispora|Rep: Putative uncharacterized protein - Salinispora arenicola CNS205 Length = 337 Score = 40.7 bits (91), Expect = 0.040 Identities = 17/45 (37%), Positives = 19/45 (42%) Frame = +1 Query: 433 PXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 P G PPP P PPPP P PPPP+ + PP Sbjct: 141 PPGPVPPPPAPPGPPPPVPPPPGPTPVPPFPPPPMTSGDVSGPPP 185 Score = 36.3 bits (80), Expect = 0.86 Identities = 19/54 (35%), Positives = 19/54 (35%), Gaps = 3/54 (5%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXS---PPPPXXGGGXPPPPPXPXXXAXXXXPPXXXXXG 584 PP PP PP PPPP G PP PP P PP G Sbjct: 125 PPVPGPPPTPPAPGPQPPGPVPPPPAPPGPPPPVPPPPGPTPVPPFPPPPMTSG 178 Score = 35.9 bits (79), Expect = 1.1 Identities = 18/48 (37%), Positives = 18/48 (37%) Frame = +3 Query: 423 GXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 G PP PPP P PPPP PP PP P PP Sbjct: 138 GPQPPGPVPPPPAPPGPPPPVPPPPGP-TPVPPFPPPPMTSGDVSGPP 184 >UniRef50_Q9MAV4 Cluster: F24O1.6; n=10; cellular organisms|Rep: F24O1.6 - Arabidopsis thaliana (Mouse-ear cress) Length = 70 Score = 40.7 bits (91), Expect = 0.040 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = +1 Query: 433 PXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPP 534 P PPPP PPPP G PPPPPP Sbjct: 10 PPPFHHPPPPRPPPPEPRPPPPPPGPQPPPPPPP 43 Score = 39.9 bits (89), Expect = 0.070 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPP 530 PP PPPP PPPP G PPPPP Sbjct: 10 PPPFHHPPPPRPPPPEPRPPPPPPGPQPPPPPP 42 Score = 39.5 bits (88), Expect = 0.093 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 PP PPP P PPPP PPPPP P Sbjct: 11 PPFHHPPPPRPPPPEPRPPPPPPGPQPPPPPPPRP 45 Score = 37.9 bits (84), Expect = 0.28 Identities = 17/36 (47%), Positives = 18/36 (50%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPL 537 PP PPPPP + PPPP P PPPPL Sbjct: 21 PPPPEPRPPPPPPGPQPPPPPPP-----RPDPPPPL 51 >UniRef50_Q9LRJ8 Cluster: Genomic DNA, chromosome 3, P1 clone:MZN24; n=3; Arabidopsis thaliana|Rep: Genomic DNA, chromosome 3, P1 clone:MZN24 - Arabidopsis thaliana (Mouse-ear cress) Length = 178 Score = 40.7 bits (91), Expect = 0.040 Identities = 17/44 (38%), Positives = 19/44 (43%) Frame = +3 Query: 435 PXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 P PPPP +PPPP PPPPP P + PP Sbjct: 118 PPPEFSPPPPDLDTTTAPPPPSTDIPIPPPPPAPVSASPPLTPP 161 Score = 36.3 bits (80), Expect = 0.86 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 454 PPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PPPP PPPP PPPPP PP Sbjct: 124 PPPPDLDTTTAPPPPSTDIPIPPPPPAPVSASPPLTPP 161 >UniRef50_Q6MWG9 Cluster: B1160F02.7 protein; n=3; Oryza sativa|Rep: B1160F02.7 protein - Oryza sativa subsp. japonica (Rice) Length = 906 Score = 40.7 bits (91), Expect = 0.040 Identities = 17/42 (40%), Positives = 18/42 (42%) Frame = +3 Query: 441 GXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 G PPPPP +P PP G G PPPP PP Sbjct: 346 GSGPPPPPPPAAPAAPRPPGPGPGPPPPPGAAGRGGGGPPPP 387 Score = 38.7 bits (86), Expect = 0.16 Identities = 18/44 (40%), Positives = 19/44 (43%), Gaps = 5/44 (11%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXX-----GGGXPPPPPXPXXXAXXXXPP 566 PPPPP +PPPP G G PPPP P PP Sbjct: 321 PPPPPAHPAAPAPPPPAPSPSAAGAGSGPPPPPPPAAPAAPRPP 364 Score = 37.9 bits (84), Expect = 0.28 Identities = 19/53 (35%), Positives = 19/53 (35%), Gaps = 2/53 (3%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPP--PXXGGGXPPPPPXPXXXAXXXXPPXXXXXG 584 PP P PP PPP GGG PPPP P PP G Sbjct: 354 PPAAPAAPRPPGPGPGPPPPPGAAGRGGGGPPPPALPGGPRARGPPPFKKSPG 406 Score = 35.9 bits (79), Expect = 1.1 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 7/39 (17%) Frame = +1 Query: 439 GXXXPPPPPXXXKXXXPPPPXX-------GXXXPPPPPP 534 G PPPPP PPPP G PPPPPP Sbjct: 317 GTGAPPPPPAHPAAPAPPPPAPSPSAAGAGSGPPPPPPP 355 Score = 35.9 bits (79), Expect = 1.1 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PPPPP P PP G PPPP PP Sbjct: 349 PPPPPPPAAPAAPRPPGPGPGPPPPPGAAGRGGGGPPPP 387 >UniRef50_Q08194 Cluster: Cysteine-rich extensin-like protein-1; n=4; Nicotiana tabacum|Rep: Cysteine-rich extensin-like protein-1 - Nicotiana tabacum (Common tobacco) Length = 209 Score = 40.7 bits (91), Expect = 0.040 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PPPPP SPPPP P PPP P PP Sbjct: 82 PPPPPRPRPCPSPPPPPRPRPCPSPPPPPQPRPRPSPPP 120 Score = 39.1 bits (87), Expect = 0.12 Identities = 18/46 (39%), Positives = 19/46 (41%), Gaps = 1/46 (2%) Frame = +1 Query: 433 PXGXXXPPPPPXXXKXXXPPPPXXGXXXP-PPPPPLXXXXXAXXPP 567 P PPPPP PPPP P PPPPP + PP Sbjct: 76 PRPCPSPPPPPRPRPCPSPPPPPRPRPCPSPPPPPQPRPRPSPPPP 121 Score = 37.5 bits (83), Expect = 0.37 Identities = 17/34 (50%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXP-PPPPXPXXXA 548 PPPPP SPPPP P PPPP P A Sbjct: 94 PPPPPRPRPCPSPPPPPQPRPRPSPPPPSPPPPA 127 Score = 34.7 bits (76), Expect = 2.6 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP P P P PPPP P PPPP PP Sbjct: 63 PPWPCPPPRPRPRPRPCPSPPPPPRPRPCPSPPPPPRPRPCPSPPP 108 Score = 34.3 bits (75), Expect = 3.5 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PPPPP P P PPPPP P PP Sbjct: 60 PPPPPWPCPPPRPRPRPRPCPSPPPPPRPRPCPSPPPPP 98 Score = 33.9 bits (74), Expect = 4.6 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 4/49 (8%) Frame = +3 Query: 432 PPXGXXP-PPP---PXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP P PPP P SPPPP P PPP P PP Sbjct: 60 PPPPPWPCPPPRPRPRPRPCPSPPPPPRPRPCPSPPPPPRPRPCPSPPP 108 Score = 33.5 bits (73), Expect = 6.1 Identities = 17/49 (34%), Positives = 18/49 (36%), Gaps = 3/49 (6%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXK---XXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPP P PPPP PPPPP + PP Sbjct: 61 PPPPWPCPPPRPRPRPRPCPSPPPPPRPRPCPSPPPPPRPRPCPSPPPP 109 Score = 33.5 bits (73), Expect = 6.1 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 PPPPP SPPPP PPPP P Sbjct: 106 PPPPPQPRPRPSPPPPS------PPPPAP 128 >UniRef50_O65514 Cluster: Putative glycine-rich cell wall protein; n=1; Arabidopsis thaliana|Rep: Putative glycine-rich cell wall protein - Arabidopsis thaliana (Mouse-ear cress) Length = 221 Score = 40.7 bits (91), Expect = 0.040 Identities = 20/46 (43%), Positives = 20/46 (43%) Frame = -1 Query: 566 GGXXAXXXXXRGGGGGGXSXPXXGGGGXXXXXXXGGGGGXXXPXGG 429 GG RGGGGGG GGGG GGGGG GG Sbjct: 142 GGSGNGSGRGRGGGGGGGGGGGGGGGGGGGGGGGGGGGGGSDGKGG 187 Score = 37.9 bits (84), Expect = 0.28 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = -1 Query: 533 GGGGGGXSXPXXGGGGXXXXXXXGGGGGXXXPXGG 429 GGGGGG GGGG GGGGG GG Sbjct: 154 GGGGGGGGGGGGGGGGGGGGGGGGGGGGSDGKGGG 188 Score = 36.7 bits (81), Expect = 0.65 Identities = 18/45 (40%), Positives = 19/45 (42%) Frame = -1 Query: 566 GGXXAXXXXXRGGGGGGXSXPXXGGGGXXXXXXXGGGGGXXXPXG 432 GG + RG GGGG GGGG GGGGG G Sbjct: 140 GGGGSGNGSGRGRGGGGGGGGGGGGGGGGGGGGGGGGGGGGGSDG 184 Score = 34.3 bits (75), Expect = 3.5 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -1 Query: 533 GGGGGGXSXPXXGGGGXXXXXXXGGGGGXXXPXGG 429 GGG G S GGGG GGGGG GG Sbjct: 141 GGGSGNGSGRGRGGGGGGGGGGGGGGGGGGGGGGG 175 Score = 34.3 bits (75), Expect = 3.5 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -1 Query: 533 GGGGGGXSXPXXGGGGXXXXXXXGGGGGXXXPXGG 429 GGGGGG GGGG GGG G GG Sbjct: 163 GGGGGGGGGGGGGGGGGGGSDGKGGGWGFGFGWGG 197 Score = 33.9 bits (74), Expect = 4.6 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = -1 Query: 566 GGXXAXXXXXRGGGGGGXSXPXXGGGGXXXXXXXGGGGGXXXPXGG 429 GG GG G G GGGG GGGGG GG Sbjct: 131 GGGGGGGGGGGGGSGNGSGRGRGGGGGGGGGGGGGGGGGGGGGGGG 176 Score = 33.5 bits (73), Expect = 6.1 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = -2 Query: 565 GGXXXXAXXXGXGGGGGXPPPXXGGGGXXFXXXXGGGGGXXPXGG 431 GG G GGGGG GGGG GGGGG GG Sbjct: 141 GGGSGNGSGRGRGGGGGG----GGGGGGGGGGGGGGGGGGGGGGG 181 Score = 33.5 bits (73), Expect = 6.1 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -2 Query: 535 GXGGGGGXPPPXXGGGGXXFXXXXGGGGGXXPXGG 431 G GGGGG GGGG GGGG GG Sbjct: 154 GGGGGGGGGGGGGGGGGGGGGGGGGGGGSDGKGGG 188 Score = 33.1 bits (72), Expect = 8.1 Identities = 18/48 (37%), Positives = 18/48 (37%) Frame = -2 Query: 565 GGXXXXAXXXGXGGGGGXPPPXXGGGGXXFXXXXGGGGGXXPXGGXXP 422 GG G GGGGG GGGG GG G GG P Sbjct: 153 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGSDGKGGGWGFGFGWGGDGP 200 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.313 0.147 0.512 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 674,090,581 Number of Sequences: 1657284 Number of extensions: 19422904 Number of successful extensions: 362425 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 34394 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 186632 length of database: 575,637,011 effective HSP length: 99 effective length of database: 411,565,895 effective search space used: 66262109095 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.8 bits)
- SilkBase 1999-2023 -