BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_FL5_O15 (782 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value U77974-1|AAB36556.1| 276|Tribolium castaneum transcription fact... 23 2.8 AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc fin... 23 3.6 >U77974-1|AAB36556.1| 276|Tribolium castaneum transcription factor homolog protein. Length = 276 Score = 23.0 bits (47), Expect = 2.8 Identities = 12/39 (30%), Positives = 12/39 (30%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PPPPP P PP PL PP Sbjct: 163 PPPPPVYTHHYARYHPYPNFGVPPAGIPLQNPGLNLNPP 201 Score = 21.8 bits (44), Expect = 6.4 Identities = 9/24 (37%), Positives = 10/24 (41%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPP 521 PPPPP + P G PP Sbjct: 163 PPPPPVYTHHYARYHPYPNFGVPP 186 >AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc finger protein protein. Length = 456 Score = 22.6 bits (46), Expect = 3.6 Identities = 8/18 (44%), Positives = 9/18 (50%) Frame = +3 Query: 483 SPPPPXXGGGXPPPPPXP 536 +P P GG PP P P Sbjct: 262 APSPTAGAGGLPPQVPSP 279 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.313 0.147 0.512 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 151,087 Number of Sequences: 336 Number of extensions: 3822 Number of successful extensions: 8 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 21168876 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.8 bits)
- SilkBase 1999-2023 -