BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_FL5_O15 (782 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) 48 1e-05 SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) 47 1e-05 SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) 47 1e-05 SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) 46 3e-05 SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) 46 3e-05 SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_812| Best HMM Match : FH2 (HMM E-Value=0) 45 8e-05 SB_31782| Best HMM Match : FH2 (HMM E-Value=1.2e-08) 44 1e-04 SB_33909| Best HMM Match : FH2 (HMM E-Value=0) 43 3e-04 SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) 43 3e-04 SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) 42 4e-04 SB_19987| Best HMM Match : MFMR (HMM E-Value=1.4) 42 4e-04 SB_13021| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) 41 0.001 SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) 41 0.001 SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_23015| Best HMM Match : WW (HMM E-Value=2.8e-16) 40 0.002 SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.004 SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_56047| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_52556| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_10571| Best HMM Match : Cas1p (HMM E-Value=1.8e-26) 39 0.005 SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) 38 0.007 SB_57724| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 38 0.012 SB_28644| Best HMM Match : zf-CCCH (HMM E-Value=1.5e-05) 37 0.016 SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.021 SB_58757| Best HMM Match : GRP (HMM E-Value=0.0041) 36 0.028 SB_52222| Best HMM Match : SAPS (HMM E-Value=2.1e-37) 36 0.037 SB_9896| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.037 SB_47508| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.049 SB_7731| Best HMM Match : Extensin_2 (HMM E-Value=1.2) 35 0.085 SB_38313| Best HMM Match : XYPPX (HMM E-Value=0.069) 34 0.11 SB_22158| Best HMM Match : Lipoprotein_15 (HMM E-Value=8.4) 34 0.11 SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.11 SB_46162| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.11 SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_27885| Best HMM Match : Cytadhesin_P30 (HMM E-Value=0.051) 34 0.15 SB_37033| Best HMM Match : Annexin (HMM E-Value=0) 33 0.20 SB_18024| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.20 SB_14625| Best HMM Match : Cytadhesin_P30 (HMM E-Value=0.056) 33 0.20 SB_4337| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.20 SB_44584| Best HMM Match : DEAD_2 (HMM E-Value=0.12) 33 0.26 SB_37501| Best HMM Match : SCP (HMM E-Value=1.2e-19) 33 0.26 SB_28396| Best HMM Match : RRM_1 (HMM E-Value=0.00035) 33 0.26 SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_40573| Best HMM Match : RRM_1 (HMM E-Value=1.8e-39) 33 0.34 SB_45152| Best HMM Match : DUF320 (HMM E-Value=2.9) 32 0.46 SB_41910| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.46 SB_37008| Best HMM Match : MAM (HMM E-Value=1.3999e-42) 32 0.46 SB_1800| Best HMM Match : LEA_4 (HMM E-Value=7.4) 32 0.46 SB_18600| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.46 SB_14242| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.60 SB_20734| Best HMM Match : Abi_HHR (HMM E-Value=3.59994e-42) 32 0.60 SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.80 SB_1160| Best HMM Match : RRM_1 (HMM E-Value=1.5e-07) 31 0.80 SB_44923| Best HMM Match : Fibrillarin (HMM E-Value=0) 31 0.80 SB_32451| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.80 SB_20869| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.80 SB_10615| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.80 SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0) 31 1.1 SB_37864| Best HMM Match : Extensin_2 (HMM E-Value=0.064) 31 1.1 SB_34030| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_3802| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_43690| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_39302| Best HMM Match : SH3_2 (HMM E-Value=1.9e-38) 31 1.1 SB_18993| Best HMM Match : DEAD (HMM E-Value=9.3e-41) 31 1.1 SB_11832| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_59302| Best HMM Match : Collagen (HMM E-Value=0) 31 1.4 SB_47949| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.4 SB_35885| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.4 SB_28395| Best HMM Match : RRM_1 (HMM E-Value=3.9e-25) 31 1.4 SB_20442| Best HMM Match : Chitin_bind_3 (HMM E-Value=7.4e-05) 31 1.4 SB_17289| Best HMM Match : GRP (HMM E-Value=0.00022) 31 1.4 SB_17044| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.4 SB_5325| Best HMM Match : Drf_FH1 (HMM E-Value=0.41) 31 1.4 SB_17864| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.4 SB_52012| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_51555| Best HMM Match : ATP-cone (HMM E-Value=3.3) 30 1.8 SB_45304| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_38223| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_9057| Best HMM Match : Nucleoplasmin (HMM E-Value=3.6) 30 1.8 SB_53638| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_47980| Best HMM Match : EGF_CA (HMM E-Value=7.6e-20) 30 1.8 SB_44156| Best HMM Match : Extensin_2 (HMM E-Value=0.05) 30 1.8 SB_31643| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_4771| Best HMM Match : DEAD (HMM E-Value=0.015) 30 1.8 SB_53717| Best HMM Match : Furin-like (HMM E-Value=0.05) 30 2.4 SB_47282| Best HMM Match : RCSD (HMM E-Value=0.53) 30 2.4 SB_43066| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.4 SB_31227| Best HMM Match : RIO1 (HMM E-Value=0.13) 30 2.4 SB_29861| Best HMM Match : RRM_1 (HMM E-Value=1.10002e-42) 30 2.4 SB_11994| Best HMM Match : ERM (HMM E-Value=0.28) 30 2.4 SB_8600| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.4 SB_2840| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.4 SB_29069| Best HMM Match : Furin-like (HMM E-Value=0.042) 30 2.4 SB_23532| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.4 SB_42034| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.2 SB_7446| Best HMM Match : SH2 (HMM E-Value=2.7e-22) 29 3.2 SB_6280| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.2 SB_1157| Best HMM Match : RRM_1 (HMM E-Value=1.2e-11) 29 3.2 SB_51034| Best HMM Match : Extensin_2 (HMM E-Value=0.038) 29 4.2 SB_32093| Best HMM Match : MCM (HMM E-Value=0.004) 29 4.2 SB_58158| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_30592| Best HMM Match : MAM (HMM E-Value=2.66247e-44) 29 4.2 SB_21461| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_6245| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_3200| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_58920| Best HMM Match : GRP (HMM E-Value=0.35) 29 5.6 SB_48719| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_24696| Best HMM Match : F5_F8_type_C (HMM E-Value=0.00023) 29 5.6 SB_20622| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) 29 5.6 SB_19519| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_11868| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) 29 5.6 SB_50413| Best HMM Match : GRP (HMM E-Value=0.15) 29 5.6 SB_32600| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_26709| Best HMM Match : CtnDOT_TraJ (HMM E-Value=8.8) 29 5.6 SB_10945| Best HMM Match : Pinin_SDK_memA (HMM E-Value=8.9) 28 7.4 SB_47680| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_25368| Best HMM Match : PID (HMM E-Value=2.7e-22) 28 7.4 SB_25090| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_7937| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_46050| Best HMM Match : RRM_1 (HMM E-Value=1.7e-33) 28 9.8 SB_43284| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.8 SB_33565| Best HMM Match : SET (HMM E-Value=3.99931e-42) 28 9.8 SB_26939| Best HMM Match : Drf_FH1 (HMM E-Value=9.2) 28 9.8 SB_26646| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.8 SB_5433| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.8 SB_5243| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.8 SB_56440| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.8 SB_45599| Best HMM Match : GRP (HMM E-Value=0.22) 28 9.8 SB_39475| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.8 SB_38456| Best HMM Match : BTB (HMM E-Value=8.8e-26) 28 9.8 SB_37045| Best HMM Match : Drf_FH1 (HMM E-Value=0.95) 28 9.8 SB_23696| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.8 SB_15225| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.8 SB_11420| Best HMM Match : MBOAT (HMM E-Value=6.9e-06) 28 9.8 >SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1000 Score = 47.6 bits (108), Expect = 1e-05 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP G PPPPP PPP GG P PP P A PP Sbjct: 914 PPGGSVPPPPPPPGGNAPLPPPPPGGSAPSQPPPPGGNAPPPPPP 958 Score = 46.0 bits (104), Expect = 3e-05 Identities = 21/45 (46%), Positives = 22/45 (48%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP G PPPP +PPP GGG PP PP P A PP Sbjct: 946 PPPGGNAPPPPPPPGGSAPPP---GGGAPPLPPPPGGSAPPPPPP 987 Score = 44.8 bits (101), Expect = 8e-05 Identities = 21/41 (51%), Positives = 21/41 (51%), Gaps = 2/41 (4%) Frame = +3 Query: 432 PPXGXXP--PPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXA 548 PP G P PPPP PPPP GG PPPPP P A Sbjct: 925 PPGGNAPLPPPPPGGSAPSQPPPP--GGNAPPPPPPPGGSA 963 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/49 (40%), Positives = 20/49 (40%), Gaps = 4/49 (8%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPP----PPXPXXXAXXXXPP 566 PP G P PP PPPP GG PPP PP P PP Sbjct: 936 PPGGSAPSQPPPPGGNAPPPPPPPGGSAPPPGGGAPPLPPPPGGSAPPP 984 Score = 41.1 bits (92), Expect = 0.001 Identities = 22/61 (36%), Positives = 22/61 (36%) Frame = -1 Query: 530 GGGGGXSXPXXGGGGXXXXXXXGGGGGXXXPXGGXXXXXKXXPPPPPPGGXXXTPXGGXP 351 GG P GG GG P G PPPPPPGG P GG P Sbjct: 916 GGSVPPPPPPPGGNAPLPPPPPGGSAPSQPPPPGG----NAPPPPPPPGGSAPPPGGGAP 971 Query: 350 P 348 P Sbjct: 972 P 972 Score = 41.1 bits (92), Expect = 0.001 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 4/56 (7%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXXPP----PPPXXXXXXSPPPPXXGGGXPPPPPXP 536 PP GG G P PP PPP PPPP PPPPP P Sbjct: 935 PPPGGSAPSQPPPPGGNAPPPPPPPGGSAPPPGGGAPPLPPPPGGSAPPPPPPPPP 990 Score = 39.5 bits (88), Expect = 0.003 Identities = 20/52 (38%), Positives = 21/52 (40%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 PP G G PP G PP P +PPPP PPPPP P Sbjct: 947 PPGGNAPPPPPPPGGSAPPPGGGAPPLPPPPGGSAPPPPP----PPPPPPPP 994 Score = 39.1 bits (87), Expect = 0.004 Identities = 17/36 (47%), Positives = 18/36 (50%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPL 537 PP G P PPP PPPP PPPPPP+ Sbjct: 965 PPGGGAPPLPPPPGGSAPPPPPPP-----PPPPPPM 995 Score = 38.3 bits (85), Expect = 0.007 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = +3 Query: 435 PXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 P G P PPPP GG P PPP P A PP Sbjct: 904 PGGSESPSASPPGGSVPPPPPPPGGNAPLPPPPPGGSAPSQPPP 947 Score = 38.3 bits (85), Expect = 0.007 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPP 534 PP PPP PPPP PPPPPP Sbjct: 955 PPPPPGGSAPPPGGGAPPLPPPPGGSAPPPPPPPP 989 Score = 34.7 bits (76), Expect = 0.085 Identities = 22/61 (36%), Positives = 22/61 (36%) Frame = -1 Query: 527 GGGGXSXPXXGGGGXXXXXXXGGGGGXXXPXGGXXXXXKXXPPPPPPGGXXXTPXGGXPP 348 GG S P GG GG P GG P PPPPGG P PP Sbjct: 938 GGSAPSQPPPPGGNAPPPPPPPGGSAPP-PGGGAP------PLPPPPGGSAPPPPPPPPP 990 Query: 347 P 345 P Sbjct: 991 P 991 Score = 33.5 bits (73), Expect = 0.20 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = -2 Query: 523 GGGXPPPXXGGGGXXFXXXXGGGGGXXPXGGXXPXFXKXXPPPPP 389 GG PPP GG G P GG P PPPPP Sbjct: 949 GGNAPPPPPPPGGSAPPPGGGAPPLPPPPGGSAPPPPPPPPPPPP 993 Score = 32.7 bits (71), Expect = 0.34 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = -3 Query: 354 PPPXXGXKXXXXXXPPXKKXPPPPPXGGXGXP 259 PPP G PP PPPPP G P Sbjct: 933 PPPPPGGSAPSQPPPPGGNAPPPPPPPGGSAP 964 Score = 32.3 bits (70), Expect = 0.46 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = -3 Query: 354 PPPXXGXKXXXXXXPPXKKXPPPPPXGGXGXP 259 PPP G P PPPPP GG P Sbjct: 934 PPPPGGSAPSQPPPPGGNAPPPPPPPGGSAPP 965 Score = 30.7 bits (66), Expect = 1.4 Identities = 15/45 (33%), Positives = 16/45 (35%) Frame = -1 Query: 521 GGXSXPXXGGGGXXXXXXXGGGGGXXXPXGGXXXXXKXXPPPPPP 387 GG + P G GG P GG PPPPPP Sbjct: 949 GGNAPPPPPPPGGSAPPPGGGAPPLPPPPGGSAPPPPPPPPPPPP 993 Score = 29.1 bits (62), Expect = 4.2 Identities = 21/68 (30%), Positives = 22/68 (32%), Gaps = 3/68 (4%) Frame = -1 Query: 530 GGGGGXSXPXXGGGGXXXXXXXGGGGGXXXPXGGXXXXXKXXPPPPPPGGXXXTPX---G 360 GG S GG GG P G + PPPPGG P G Sbjct: 905 GGSESPSASPPGGSVPPPPPPPGGNAPLPPPPPGGSAPSQ----PPPPGGNAPPPPPPPG 960 Query: 359 GXPPPXXG 336 G PP G Sbjct: 961 GSAPPPGG 968 Score = 28.7 bits (61), Expect = 5.6 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = +3 Query: 423 GXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 G P P P S PP PPPPP P A PP Sbjct: 891 GSFPRRNESPSQTPGGSESPSASPPGGSV--PPPPPPPGGNAPLPPPP 936 Score = 28.3 bits (60), Expect = 7.4 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = -3 Query: 354 PPPXXGXKXXXXXXPPXKKXP-PPPPXGGXGXP 259 PPP G PP P PPP GG P Sbjct: 922 PPPPPGGNAPLPPPPPGGSAPSQPPPPGGNAPP 954 >SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) Length = 341 Score = 47.6 bits (108), Expect = 1e-05 Identities = 20/35 (57%), Positives = 20/35 (57%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 PP G PPPPP PPPP GG PPPPP P Sbjct: 308 PPPGGAPPPPPPP-----PPPPPGDGGAPPPPPPP 337 Score = 46.8 bits (106), Expect = 2e-05 Identities = 17/29 (58%), Positives = 18/29 (62%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 PPPPP +PPPP GG PPPPP P Sbjct: 292 PPPPPADGSAPAPPPPPPPGGAPPPPPPP 320 Score = 43.6 bits (98), Expect = 2e-04 Identities = 16/29 (55%), Positives = 16/29 (55%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 PPPP PPPP GG PPPPP P Sbjct: 293 PPPPADGSAPAPPPPPPPGGAPPPPPPPP 321 Score = 42.3 bits (95), Expect = 4e-04 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = +1 Query: 439 GXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPP 534 G PPPPP PPPP PPPPPP Sbjct: 288 GAPVPPPPPADGSAPAPPPPPPPGGAPPPPPP 319 Score = 39.1 bits (87), Expect = 0.004 Identities = 17/35 (48%), Positives = 17/35 (48%), Gaps = 3/35 (8%) Frame = +3 Query: 435 PXGXXPPPP---PXXXXXXSPPPPXXGGGXPPPPP 530 P PPPP P PPPP GG PPPPP Sbjct: 302 PAPPPPPPPGGAPPPPPPPPPPPPGDGGAPPPPPP 336 Score = 38.7 bits (86), Expect = 0.005 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP P PPP PPPP PPPPPP A PP Sbjct: 295 PPADGSAPAPPPPPPPGGAPPPP------PPPPPPPPGDGGAPPPP 334 Score = 36.7 bits (81), Expect = 0.021 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = -1 Query: 461 GGGGXXXPXGGXXXXXKXXPPPPPPGGXXXTPXGGXPPP 345 GGG P PPPPPPGG P PPP Sbjct: 286 GGGAPVPPPPPADGSAPAPPPPPPPGGAPPPPPPPPPPP 324 Score = 36.3 bits (80), Expect = 0.028 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 4/47 (8%) Frame = +1 Query: 439 GXXXPPPPP----XXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 G P PPP PPPP G PPPPPP PP Sbjct: 286 GGGAPVPPPPPADGSAPAPPPPPPPGGAPPPPPPPPPPPPGDGGAPP 332 Score = 35.1 bits (77), Expect = 0.065 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = -1 Query: 458 GGGXXXPXGGXXXXXKXXPPPPPPGGXXXTPXGGXPPPXXG 336 GGG P PPPPPP G P PPP G Sbjct: 286 GGGAPVPPPPPADGSAPAPPPPPPPGGAPPPPPPPPPPPPG 326 Score = 33.9 bits (74), Expect = 0.15 Identities = 18/45 (40%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 P G P PPP +PPPP PPPPP A PP Sbjct: 296 PADGSAPAPPPPPPPGGAPPPPPP----PPPPPPGDGGAPPPPPP 336 Score = 32.3 bits (70), Expect = 0.46 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = -1 Query: 464 GGGGGXXXPXGGXXXXXKXXPPPPPPGGXXXTPXGGXPPPXXG 336 GGG P PPPPP G P PPP G Sbjct: 286 GGGAPVPPPPPADGSAPAPPPPPPPGGAPPPPPPPPPPPPGDG 328 Score = 31.9 bits (69), Expect = 0.60 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +3 Query: 423 GXXPPXGXXPPPPPXXXXXXSPPPP 497 G PP PPPPP PPPP Sbjct: 312 GAPPPPPPPPPPPPGDGGAPPPPPP 336 Score = 31.5 bits (68), Expect = 0.80 Identities = 14/34 (41%), Positives = 14/34 (41%), Gaps = 1/34 (2%) Frame = +3 Query: 486 PPPPXXGGGX-PPPPPXPXXXAXXXXPPXXXXXG 584 PPPP G PPPPP P PP G Sbjct: 293 PPPPADGSAPAPPPPPPPGGAPPPPPPPPPPPPG 326 Score = 29.5 bits (63), Expect = 3.2 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = -1 Query: 404 PPPPPPGGXXXTPXGGXPPP 345 PPPPPP GG PPP Sbjct: 314 PPPPPPPPPPPPGDGGAPPP 333 Score = 29.1 bits (62), Expect = 4.2 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -3 Query: 354 PPPXXGXKXXXXXXPPXKKXPPPPPXGGXGXP 259 PPP G PP PPPPP G G P Sbjct: 306 PPPPPGGA------PPPPPPPPPPPPGDGGAP 331 Score = 28.3 bits (60), Expect = 7.4 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = -3 Query: 354 PPPXXGXKXXXXXXPPXKKXPPPPP 280 PPP G PP PPPPP Sbjct: 294 PPPADGSAPAPPPPPPPGGAPPPPP 318 Score = 27.9 bits (59), Expect = 9.8 Identities = 12/32 (37%), Positives = 13/32 (40%) Frame = +3 Query: 489 PPPXXGGGXPPPPPXPXXXAXXXXPPXXXXXG 584 P GGG P PPP P + PP G Sbjct: 281 PDIVTGGGAPVPPPPPADGSAPAPPPPPPPGG 312 >SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) Length = 768 Score = 47.2 bits (107), Expect = 1e-05 Identities = 20/36 (55%), Positives = 20/36 (55%) Frame = +3 Query: 423 GXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPP 530 G PP PPPPP PPPP GGG PPPPP Sbjct: 673 GGAPP----PPPPPLPGGAAPPPPPPIGGGAPPPPP 704 Score = 44.8 bits (101), Expect = 8e-05 Identities = 17/32 (53%), Positives = 17/32 (53%) Frame = +1 Query: 439 GXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPP 534 G PPPPP PPPP G PPPPPP Sbjct: 674 GAPPPPPPPLPGGAAPPPPPPIGGGAPPPPPP 705 Score = 44.4 bits (100), Expect = 1e-04 Identities = 20/50 (40%), Positives = 22/50 (44%), Gaps = 4/50 (8%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXX----PPPPXXGXXXPPPPPPLXXXXXAXXPP 567 P G PPPPP + PPPP G PPPPPP+ PP Sbjct: 656 PEAGPPPPPPPPPGGQAGGAPPPPPPPLPGGAAPPPPPPIGGGAPPPPPP 705 Score = 37.5 bits (83), Expect = 0.012 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXXPPPPPXXXXXXSPPPPXXGG 509 PP G GG P PPPPP PPPP GG Sbjct: 667 PPGGQAGGAPPPPPPPLPGGAAPPPPPPIGGGAPPPPPPGFGG 709 Score = 35.1 bits (77), Expect = 0.065 Identities = 18/44 (40%), Positives = 19/44 (43%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXXPPPPPXXXXXXSPPPPXXGGG 512 PP GG G P G PPPPP +PPPP G G Sbjct: 666 PPPGGQAGGAPPPPPPPLPGGAAPPPPPPIGGG-APPPPPPGFG 708 Score = 32.7 bits (71), Expect = 0.34 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 4/36 (11%) Frame = -1 Query: 440 PXGGXXXXXKXXPPPPPPGGXXXTP----XGGXPPP 345 P GG PPPP PGG P GG PPP Sbjct: 667 PPGGQAGGAPPPPPPPLPGGAAPPPPPPIGGGAPPP 702 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -1 Query: 404 PPPPPPGGXXXTPXGGXPPP 345 PPPPPPGG GG PPP Sbjct: 663 PPPPPPGG----QAGGAPPP 678 Score = 29.1 bits (62), Expect = 4.2 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = -1 Query: 464 GGGGGXXXPXGGXXXXXKXXPPPPPPGGXXXTPXGGXPPPXXG 336 GG G P PPPPPP G P PPP G Sbjct: 669 GGQAGGAPPPPPPPLPGGAAPPPPPPIGGGAPP---PPPPGFG 708 Score = 27.9 bits (59), Expect = 9.8 Identities = 14/37 (37%), Positives = 14/37 (37%), Gaps = 5/37 (13%) Frame = -3 Query: 354 PPPXXGXKXXXXXXPPXK-----KXPPPPPXGGXGXP 259 PPP G PP PPPPP GG P Sbjct: 665 PPPPGGQAGGAPPPPPPPLPGGAAPPPPPPIGGGAPP 701 >SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) Length = 457 Score = 47.2 bits (107), Expect = 1e-05 Identities = 20/46 (43%), Positives = 20/46 (43%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPPP PPPP PPPPPP A PP Sbjct: 396 PPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPPALRLACAPP 441 Score = 45.6 bits (103), Expect = 5e-05 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 372 PPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPP 416 Score = 45.6 bits (103), Expect = 5e-05 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPPP P PP Sbjct: 383 PPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPP 427 Score = 45.2 bits (102), Expect = 6e-05 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPPP PPPP PPPPPP PP Sbjct: 371 PPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPP 416 Score = 45.2 bits (102), Expect = 6e-05 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPPP PPPP PPPPPP PP Sbjct: 382 PPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPP 427 Score = 44.4 bits (100), Expect = 1e-04 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP P PPP PPPP PPPPP P A PP Sbjct: 381 PPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPP 425 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXA 548 PP PPPPP PPPP PPPPP P A Sbjct: 395 PPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPPA 433 Score = 44.0 bits (99), Expect = 1e-04 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPP P PPPP PPPPPP A PP Sbjct: 378 PPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPP 423 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/46 (39%), Positives = 19/46 (41%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PP PP + PPPP PPPPPP PP Sbjct: 379 PPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPP 424 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPP P PPPP PPPPPP PP Sbjct: 384 PPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPP 429 Score = 42.3 bits (95), Expect = 4e-04 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP P PPP P PP Sbjct: 365 PPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPP 409 Score = 42.3 bits (95), Expect = 4e-04 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPPP P PP Sbjct: 366 PPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPP 410 Score = 42.3 bits (95), Expect = 4e-04 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPPP PP P PPPPPP PP Sbjct: 373 PPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPP 418 Score = 42.3 bits (95), Expect = 4e-04 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PP PP PPPP PPPPP P PP Sbjct: 386 PPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPP 430 Score = 41.9 bits (94), Expect = 6e-04 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPP PPPP PPPPPP PP Sbjct: 370 PPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPP 415 Score = 41.9 bits (94), Expect = 6e-04 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP P PPP PPPP PPPPPP PP Sbjct: 380 PPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPP 425 Score = 38.7 bits (86), Expect = 0.005 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP PPP P P PP Sbjct: 391 PPPQPPPPPPPPPPPPPPPPPPPP---PPPPAPPPPPPPPPPPPP 432 Score = 37.5 bits (83), Expect = 0.012 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPPP PPPP PPP PP PP Sbjct: 389 PPPPPQPPPPPPPPPPPPPPPPP--PPPPPPPAPPPPPPPPPPPPP 432 Score = 35.1 bits (77), Expect = 0.065 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = +1 Query: 439 GXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 G PPPP PPPP PPPPPP PP Sbjct: 360 GINMSPPPP-----PPPPPPPPSPPPPPPPPPPSPPPPPQPPP 397 Score = 34.7 bits (76), Expect = 0.085 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +2 Query: 431 PPXGXXXPPPPXXXXKXXXPPPXXXGXXXPPPPXPXXXXXXXXPPP 568 PP PPPP PPP PPPP P PPP Sbjct: 375 PPSPPPPPPPP---PPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPP 417 Score = 29.1 bits (62), Expect = 4.2 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +2 Query: 452 PPPPXXXXKXXXPPPXXXGXXXPPPPXPXXXXXXXXPPP 568 PPPP PPP PP P P PPP Sbjct: 366 PPPPPPPPPPPSPPPPPP--PPPPSPPPPPQPPPPPPPP 402 >SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) Length = 480 Score = 46.0 bits (104), Expect = 3e-05 Identities = 17/34 (50%), Positives = 18/34 (52%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPP 531 PP PPPPP + PPPP G PPPPP Sbjct: 312 PPLNATPPPPPPSRDQVPLPPPPLRGQIAPPPPP 345 Score = 44.0 bits (99), Expect = 1e-04 Identities = 17/39 (43%), Positives = 18/39 (46%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PPPPP +PPPP G PPPPP PP Sbjct: 194 PPPPPHSRHGSAPPPPERSSGPPPPPPGRGPSQRSLAPP 232 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/39 (41%), Positives = 17/39 (43%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PPPPP PPPP PPPPP + PP Sbjct: 194 PPPPPHSRHGSAPPPPERSSGPPPPPPGRGPSQRSLAPP 232 Score = 37.5 bits (83), Expect = 0.012 Identities = 16/33 (48%), Positives = 17/33 (51%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPP 530 P G PPPP +PPPP G PPPPP Sbjct: 257 PTSGGEPPPPKN-----APPPPKRGSSNPPPPP 284 Score = 37.1 bits (82), Expect = 0.016 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP P PPP PPPP P PPPPL PP Sbjct: 301 PPSRDQAPAPPPPLNATPPPPPPSRDQV-PLPPPPLRGQIAPPPPP 345 Score = 35.5 bits (78), Expect = 0.049 Identities = 16/39 (41%), Positives = 17/39 (43%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PP + PPPP PPPPPP PP Sbjct: 298 PPLPPSRDQAPAPPPPLNAT--PPPPPPSRDQVPLPPPP 334 Score = 35.1 bits (77), Expect = 0.065 Identities = 19/43 (44%), Positives = 19/43 (44%), Gaps = 9/43 (20%) Frame = +1 Query: 430 PPXGXXXPPPP---------PXXXKXXXPPPPXXGXXXPPPPP 531 PP G PPPP P K PPPP G PPPPP Sbjct: 243 PPPGENRPPPPMRGPTSGGEPPPPKNA-PPPPKRGSSNPPPPP 284 Score = 34.3 bits (75), Expect = 0.11 Identities = 22/68 (32%), Positives = 23/68 (33%), Gaps = 6/68 (8%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXXPPPPPXXXXXXSPPP---PXXGGGXPPP---PPXPXX 542 PP G G P P P P PPP P GG PPP PP P Sbjct: 216 PPPPPGRGPSQRSLAPPPTGSSRPLPAPPPGENRPPPPMRGPTSGGEPPPPKNAPPPPKR 275 Query: 543 XAXXXXPP 566 + PP Sbjct: 276 GSSNPPPP 283 Score = 34.3 bits (75), Expect = 0.11 Identities = 18/62 (29%), Positives = 19/62 (30%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXX 560 PP G F G P P P +PPPP P PP P Sbjct: 283 PPTRGPPSNSFTTQGPPLPPSRDQAPAPPPPLNATPPPPPPSRDQVPLPPPPLRGQIAPP 342 Query: 561 PP 566 PP Sbjct: 343 PP 344 Score = 33.9 bits (74), Expect = 0.15 Identities = 19/48 (39%), Positives = 20/48 (41%), Gaps = 9/48 (18%) Frame = +3 Query: 450 PPPPPXXXXXXS-----PPPPXXG----GGXPPPPPXPXXXAXXXXPP 566 PPPPP S PPPP GG PPPPP + PP Sbjct: 341 PPPPPISKPPTSTRSAPPPPPGRAPQPLGGPPPPPPGRRPPSGKINPP 388 Score = 33.1 bits (72), Expect = 0.26 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +2 Query: 452 PPPPXXXXKXXXPPPXXXGXXXPPPPXPXXXXXXXXPPP 568 PPPP PPP PPPP PPP Sbjct: 195 PPPPHSRHGSAPPPPERSSGPPPPPPGRGPSQRSLAPPP 233 Score = 32.7 bits (71), Expect = 0.34 Identities = 19/52 (36%), Positives = 20/52 (38%), Gaps = 6/52 (11%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPP---PXXGXXXPPP---PPPLXXXXXAXXPP 567 PP G P P P + PPP P G PPP PPP PP Sbjct: 232 PPTGSSRPLPAPPPGENRPPPPMRGPTSGGEPPPPKNAPPPPKRGSSNPPPP 283 Score = 32.7 bits (71), Expect = 0.34 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = -1 Query: 398 PPPPGGXXXTPXGGXPPPXXGXK 330 PPPP G P GG PPP G + Sbjct: 357 PPPPPGRAPQPLGGPPPPPPGRR 379 Score = 31.5 bits (68), Expect = 0.80 Identities = 26/89 (29%), Positives = 27/89 (30%), Gaps = 12/89 (13%) Frame = -1 Query: 566 GGXXAXXXXXRGGGGG--GXSXPXXGGGGXXXXXXXG----GGGGXXXPXGGXXXXXKXX 405 GG + GGGGG G GGGG G G G Sbjct: 65 GGNLSSSSSSTGGGGGFSGGGGGSMGGGGLGGLFAGGMPKLRPAGERKAAGAGPRGPALK 124 Query: 404 PP------PPPPGGXXXTPXGGXPPPXXG 336 PP PPP P G PPP G Sbjct: 125 PPGFRTTAPPPKNSSPPPPFGAPPPPDRG 153 Score = 31.5 bits (68), Expect = 0.80 Identities = 17/43 (39%), Positives = 18/43 (41%), Gaps = 8/43 (18%) Frame = +1 Query: 430 PPXGXXXPPPPPXXX-----KXXXPPPPXXGXXX---PPPPPP 534 P G PPPPP + PPPP PPPPPP Sbjct: 334 PLRGQIAPPPPPISKPPTSTRSAPPPPPGRAPQPLGGPPPPPP 376 Score = 31.1 bits (67), Expect = 1.1 Identities = 18/52 (34%), Positives = 19/52 (36%), Gaps = 6/52 (11%) Frame = +1 Query: 430 PPXGXXXP-PPPPXXXKXXXPPPPXXGX-----XXPPPPPPLXXXXXAXXPP 567 PP P PPPP + PPPP PPPPP PP Sbjct: 322 PPSRDQVPLPPPPLRGQIAPPPPPISKPPTSTRSAPPPPPGRAPQPLGGPPP 373 Score = 30.7 bits (66), Expect = 1.4 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 7/35 (20%) Frame = +1 Query: 451 PPPP---PXXXKXXXPPPPXX----GXXXPPPPPP 534 PPPP P PPPP G PPPPPP Sbjct: 358 PPPPGRAPQPLGGPPPPPPGRRPPSGKINPPPPPP 392 Score = 30.3 bits (65), Expect = 1.8 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +3 Query: 423 GXXPPXGXXPPPPPXXXXXXSPPPPXXG 506 G PP PPPP PPPP G Sbjct: 260 GGEPPPPKNAPPPPKRGSSNPPPPPTRG 287 Score = 30.3 bits (65), Expect = 1.8 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = +1 Query: 433 PXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPP 534 P PPPPP + PP PPPPPP Sbjct: 365 PQPLGGPPPPPPGRR-----PPSGKINPPPPPPP 393 Score = 29.9 bits (64), Expect = 2.4 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +3 Query: 441 GXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 G PPPP S PP G P P P P Sbjct: 214 GPPPPPPGRGPSQRSLAPPPTGSSRPLPAPPP 245 Score = 29.9 bits (64), Expect = 2.4 Identities = 15/37 (40%), Positives = 16/37 (43%) Frame = -3 Query: 363 GGXPPPXXGXKXXXXXXPPXKKXPPPPPXGGXGXPXF 253 GG PPP G + P K PPPPP P F Sbjct: 369 GGPPPPPPGRRP-----PSGKINPPPPPPPAMDKPSF 400 Score = 29.5 bits (63), Expect = 3.2 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPPP 530 PPPPP PPPP G PPP Sbjct: 2 PPPPPPPGP---PPPPSAPSGPVKPPP 25 Score = 29.5 bits (63), Expect = 3.2 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPP 534 PPPPP PPPP P PPP Sbjct: 2 PPPPPPPG----PPPPPSAPSGPVKPPP 25 Score = 29.5 bits (63), Expect = 3.2 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = -3 Query: 354 PPPXXGXKXXXXXXPPXKKXPPPPPXGGXGXP 259 PPP PP K PPPP G P Sbjct: 250 PPPPMRGPTSGGEPPPPKNAPPPPKRGSSNPP 281 Score = 29.1 bits (62), Expect = 4.2 Identities = 16/44 (36%), Positives = 16/44 (36%), Gaps = 6/44 (13%) Frame = +1 Query: 454 PPPPXXXKXXXPPPPXXG------XXXPPPPPPLXXXXXAXXPP 567 PPPP PPPP G PP PP A PP Sbjct: 270 PPPPKRGSSNPPPPPTRGPPSNSFTTQGPPLPPSRDQAPAPPPP 313 Score = 29.1 bits (62), Expect = 4.2 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = +3 Query: 456 PPPXXXXXXSPPPPXXGGGXPPPPP 530 P P +PPP G PPPPP Sbjct: 454 PRPASSSRGAPPPVPPSRGPPPPPP 478 Score = 28.7 bits (61), Expect = 5.6 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPP 530 PP PPPP + P G PPPPP Sbjct: 140 PPPPFGAPPPPDRGGQLAKKPSQ--GSFPPPPP 170 Score = 28.3 bits (60), Expect = 7.4 Identities = 23/93 (24%), Positives = 23/93 (24%) Frame = -3 Query: 537 KGXGGGGXXXPXXXGGGXXXFXXXXGGGGXLXPXGGXXXXXXKXXXXXXXXXXXXXXXGG 358 K GG GG F GGGG GG G Sbjct: 61 KSSSGGNLSSSSSSTGGGGGFS---GGGGGSMGGGGLGGLFAGGMPKLRPAGERKAAGAG 117 Query: 357 XPPPXXGXKXXXXXXPPXKKXPPPPPXGGXGXP 259 P PP K PPPP G P Sbjct: 118 PRGPALKPPGFRTTAPPPKNSSPPPPFGAPPPP 150 Score = 28.3 bits (60), Expect = 7.4 Identities = 11/29 (37%), Positives = 11/29 (37%) Frame = -3 Query: 360 GXPPPXXGXKXXXXXXPPXKKXPPPPPXG 274 G PPP P PPPPP G Sbjct: 193 GPPPPPHSRHGSAPPPPERSSGPPPPPPG 221 Score = 28.3 bits (60), Expect = 7.4 Identities = 11/30 (36%), Positives = 13/30 (43%) Frame = -3 Query: 354 PPPXXGXKXXXXXXPPXKKXPPPPPXGGXG 265 PPP + PP + PPPP G G Sbjct: 194 PPPPPHSRHGSAPPPPERSSGPPPPPPGRG 223 Score = 28.3 bits (60), Expect = 7.4 Identities = 14/34 (41%), Positives = 14/34 (41%), Gaps = 5/34 (14%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPP-----PPPXP 536 PPPP PPP G PP PPP P Sbjct: 358 PPPPGRAPQPLGGPPPPPPGRRPPSGKINPPPPP 391 Score = 27.9 bits (59), Expect = 9.8 Identities = 17/55 (30%), Positives = 17/55 (30%), Gaps = 9/55 (16%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXX---------PPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPP K PPPP PPPP PP Sbjct: 166 PPPPPMGKPPPPSGNKPTFGNSRTSTNGPPPPPHSRHGSAPPPPERSSGPPPPPP 220 Score = 27.9 bits (59), Expect = 9.8 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = -3 Query: 360 GXPPPXXGXKXXXXXXPPXKKXPPPPPXGGXG 265 G PPP G K PPPPP G Sbjct: 172 GKPPPPSGNKPTFGNSRTSTNGPPPPPHSRHG 203 >SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) Length = 392 Score = 46.0 bits (104), Expect = 3e-05 Identities = 17/34 (50%), Positives = 18/34 (52%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPP 531 PP PPPPP + PPPP G PPPPP Sbjct: 224 PPLNATPPPPPPSRDQVPLPPPPLRGQIAPPPPP 257 Score = 44.0 bits (99), Expect = 1e-04 Identities = 17/39 (43%), Positives = 18/39 (46%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PPPPP +PPPP G PPPPP PP Sbjct: 106 PPPPPHSRHGSAPPPPERSSGPPPPPPGRGPSQRSLAPP 144 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/39 (41%), Positives = 17/39 (43%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PPPPP PPPP PPPPP + PP Sbjct: 106 PPPPPHSRHGSAPPPPERSSGPPPPPPGRGPSQRSLAPP 144 Score = 37.5 bits (83), Expect = 0.012 Identities = 16/33 (48%), Positives = 17/33 (51%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPP 530 P G PPPP +PPPP G PPPPP Sbjct: 169 PTSGGEPPPPKN-----APPPPKRGSSNPPPPP 196 Score = 37.1 bits (82), Expect = 0.016 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP P PPP PPPP P PPPPL PP Sbjct: 213 PPSRDQAPAPPPPLNATPPPPPPSRDQV-PLPPPPLRGQIAPPPPP 257 Score = 35.5 bits (78), Expect = 0.049 Identities = 16/39 (41%), Positives = 17/39 (43%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PP + PPPP PPPPPP PP Sbjct: 210 PPLPPSRDQAPAPPPPLNAT--PPPPPPSRDQVPLPPPP 246 Score = 35.1 bits (77), Expect = 0.065 Identities = 19/43 (44%), Positives = 19/43 (44%), Gaps = 9/43 (20%) Frame = +1 Query: 430 PPXGXXXPPPP---------PXXXKXXXPPPPXXGXXXPPPPP 531 PP G PPPP P K PPPP G PPPPP Sbjct: 155 PPPGENRPPPPMRGPTSGGEPPPPKNA-PPPPKRGSSNPPPPP 196 Score = 34.3 bits (75), Expect = 0.11 Identities = 22/68 (32%), Positives = 23/68 (33%), Gaps = 6/68 (8%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXXPPPPPXXXXXXSPPP---PXXGGGXPPP---PPXPXX 542 PP G G P P P P PPP P GG PPP PP P Sbjct: 128 PPPPPGRGPSQRSLAPPPTGSSRPLPAPPPGENRPPPPMRGPTSGGEPPPPKNAPPPPKR 187 Query: 543 XAXXXXPP 566 + PP Sbjct: 188 GSSNPPPP 195 Score = 34.3 bits (75), Expect = 0.11 Identities = 21/63 (33%), Positives = 21/63 (33%), Gaps = 1/63 (1%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXX-PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXX 557 PP G F G PP P PP PPPP P PPP P Sbjct: 195 PPTRGPPSNSFTTQGPPLPPSRDQAPAPPPPLNATPPPPPPSRDQVPLPPP-PLRGQIAP 253 Query: 558 XPP 566 PP Sbjct: 254 PPP 256 Score = 33.9 bits (74), Expect = 0.15 Identities = 19/48 (39%), Positives = 20/48 (41%), Gaps = 9/48 (18%) Frame = +3 Query: 450 PPPPPXXXXXXS-----PPPPXXG----GGXPPPPPXPXXXAXXXXPP 566 PPPPP S PPPP GG PPPPP + PP Sbjct: 253 PPPPPISKPPTSTRSAPPPPPGRAPQPLGGPPPPPPGRRPPSGKINPP 300 Score = 33.1 bits (72), Expect = 0.26 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +2 Query: 452 PPPPXXXXKXXXPPPXXXGXXXPPPPXPXXXXXXXXPPP 568 PPPP PPP PPPP PPP Sbjct: 107 PPPPHSRHGSAPPPPERSSGPPPPPPGRGPSQRSLAPPP 145 Score = 32.7 bits (71), Expect = 0.34 Identities = 19/52 (36%), Positives = 20/52 (38%), Gaps = 6/52 (11%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPP---PXXGXXXPPP---PPPLXXXXXAXXPP 567 PP G P P P + PPP P G PPP PPP PP Sbjct: 144 PPTGSSRPLPAPPPGENRPPPPMRGPTSGGEPPPPKNAPPPPKRGSSNPPPP 195 Score = 32.7 bits (71), Expect = 0.34 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = -1 Query: 398 PPPPGGXXXTPXGGXPPPXXGXK 330 PPPP G P GG PPP G + Sbjct: 269 PPPPPGRAPQPLGGPPPPPPGRR 291 Score = 31.5 bits (68), Expect = 0.80 Identities = 17/43 (39%), Positives = 18/43 (41%), Gaps = 8/43 (18%) Frame = +1 Query: 430 PPXGXXXPPPPPXXX-----KXXXPPPPXXGXXX---PPPPPP 534 P G PPPPP + PPPP PPPPPP Sbjct: 246 PLRGQIAPPPPPISKPPTSTRSAPPPPPGRAPQPLGGPPPPPP 288 Score = 31.1 bits (67), Expect = 1.1 Identities = 18/52 (34%), Positives = 19/52 (36%), Gaps = 6/52 (11%) Frame = +1 Query: 430 PPXGXXXP-PPPPXXXKXXXPPPPXXGX-----XXPPPPPPLXXXXXAXXPP 567 PP P PPPP + PPPP PPPPP PP Sbjct: 234 PPSRDQVPLPPPPLRGQIAPPPPPISKPPTSTRSAPPPPPGRAPQPLGGPPP 285 Score = 30.7 bits (66), Expect = 1.4 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 7/35 (20%) Frame = +1 Query: 451 PPPP---PXXXKXXXPPPPXX----GXXXPPPPPP 534 PPPP P PPPP G PPPPPP Sbjct: 270 PPPPGRAPQPLGGPPPPPPGRRPPSGKINPPPPPP 304 Score = 30.3 bits (65), Expect = 1.8 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +3 Query: 423 GXXPPXGXXPPPPPXXXXXXSPPPPXXG 506 G PP PPPP PPPP G Sbjct: 172 GGEPPPPKNAPPPPKRGSSNPPPPPTRG 199 Score = 30.3 bits (65), Expect = 1.8 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = +1 Query: 433 PXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPP 534 P PPPPP + PP PPPPPP Sbjct: 277 PQPLGGPPPPPPGRR-----PPSGKINPPPPPPP 305 Score = 29.9 bits (64), Expect = 2.4 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +3 Query: 441 GXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 G PPPP S PP G P P P P Sbjct: 126 GPPPPPPGRGPSQRSLAPPPTGSSRPLPAPPP 157 Score = 29.9 bits (64), Expect = 2.4 Identities = 15/37 (40%), Positives = 16/37 (43%) Frame = -3 Query: 363 GGXPPPXXGXKXXXXXXPPXKKXPPPPPXGGXGXPXF 253 GG PPP G + P K PPPPP P F Sbjct: 281 GGPPPPPPGRRP-----PSGKINPPPPPPPAMDKPSF 312 Score = 29.5 bits (63), Expect = 3.2 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = -3 Query: 354 PPPXXGXKXXXXXXPPXKKXPPPPPXGGXGXP 259 PPP PP K PPPP G P Sbjct: 162 PPPPMRGPTSGGEPPPPKNAPPPPKRGSSNPP 193 Score = 29.1 bits (62), Expect = 4.2 Identities = 16/44 (36%), Positives = 16/44 (36%), Gaps = 6/44 (13%) Frame = +1 Query: 454 PPPPXXXKXXXPPPPXXG------XXXPPPPPPLXXXXXAXXPP 567 PPPP PPPP G PP PP A PP Sbjct: 182 PPPPKRGSSNPPPPPTRGPPSNSFTTQGPPLPPSRDQAPAPPPP 225 Score = 29.1 bits (62), Expect = 4.2 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = +3 Query: 456 PPPXXXXXXSPPPPXXGGGXPPPPP 530 P P +PPP G PPPPP Sbjct: 366 PRPASSSRGAPPPVPPSRGPPPPPP 390 Score = 28.7 bits (61), Expect = 5.6 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPP 530 PP PPPP + P G PPPPP Sbjct: 52 PPPPFGAPPPPDRGGQLAKKPSQ--GSFPPPPP 82 Score = 28.3 bits (60), Expect = 7.4 Identities = 11/29 (37%), Positives = 11/29 (37%) Frame = -3 Query: 360 GXPPPXXGXKXXXXXXPPXKKXPPPPPXG 274 G PPP P PPPPP G Sbjct: 105 GPPPPPHSRHGSAPPPPERSSGPPPPPPG 133 Score = 28.3 bits (60), Expect = 7.4 Identities = 11/30 (36%), Positives = 13/30 (43%) Frame = -3 Query: 354 PPPXXGXKXXXXXXPPXKKXPPPPPXGGXG 265 PPP + PP + PPPP G G Sbjct: 106 PPPPPHSRHGSAPPPPERSSGPPPPPPGRG 135 Score = 28.3 bits (60), Expect = 7.4 Identities = 14/34 (41%), Positives = 14/34 (41%), Gaps = 5/34 (14%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPP-----PPPXP 536 PPPP PPP G PP PPP P Sbjct: 270 PPPPGRAPQPLGGPPPPPPGRRPPSGKINPPPPP 303 Score = 27.9 bits (59), Expect = 9.8 Identities = 17/55 (30%), Positives = 17/55 (30%), Gaps = 9/55 (16%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXX---------PPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPP K PPPP PPPP PP Sbjct: 78 PPPPPMGKPPPPSGNKPTFGNSRTSTNGPPPPPHSRHGSAPPPPERSSGPPPPPP 132 Score = 27.9 bits (59), Expect = 9.8 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = -3 Query: 360 GXPPPXXGXKXXXXXXPPXKKXPPPPPXGGXG 265 G PPP G K PPPPP G Sbjct: 84 GKPPPPSGNKPTFGNSRTSTNGPPPPPHSRHG 115 >SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 46.0 bits (104), Expect = 3e-05 Identities = 21/46 (45%), Positives = 21/46 (45%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPPP K PPPP G PPPPPP PP Sbjct: 358 PPPTNNTPPPPPPTNKPPPPPPPTNG---PPPPPPPTNGPPPPPPP 400 Score = 45.6 bits (103), Expect = 5e-05 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP G PPPPP P PP Sbjct: 369 PPTNKPPPPPPPTNGPPPPPPPTNG---PPPPPPPTNGPPPPPPP 410 Score = 41.9 bits (94), Expect = 6e-04 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP PPPP G PPPPP P PP Sbjct: 359 PPTNNTPPPPPPTNKPPPPPPP--TNG-PPPPPPPTNGPPPPPPP 400 Score = 40.3 bits (90), Expect = 0.002 Identities = 22/58 (37%), Positives = 22/58 (37%) Frame = +3 Query: 393 GGGGXXFXXXGXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 GGGG PP P PPP PPPP PPPPP P PP Sbjct: 340 GGGGVN----PPPPPTNNPPSPPPPTNNTPPPPPPT---NKPPPPPPPTNGPPPPPPP 390 Score = 39.1 bits (87), Expect = 0.004 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPP 531 PP PP PP PPPP PPPPP Sbjct: 347 PPPPTNNPPSPPPPTNNTPPPPPPTNKPPPPPPP 380 Score = 32.7 bits (71), Expect = 0.34 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXG 506 PP PPPPP PPPP G Sbjct: 389 PPTNGPPPPPPPTNGPPPPPPPTNG 413 Score = 32.3 bits (70), Expect = 0.46 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPP 521 PP PPPPP PPPP G PP Sbjct: 388 PPPTNGPPPPPPPTNGPPPPPPPTNG--PP 415 Score = 30.7 bits (66), Expect = 1.4 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +2 Query: 452 PPPPXXXXKXXXPPPXXXGXXXPPPPXPXXXXXXXXPPP 568 PPPP PPP PPPP P PPP Sbjct: 377 PPPPTN-----GPPPPPPPTNGPPPPPPPTNGPPPPPPP 410 Score = 29.9 bits (64), Expect = 2.4 Identities = 16/48 (33%), Positives = 16/48 (33%), Gaps = 5/48 (10%) Frame = +2 Query: 440 GXXXPPPPXXXXKXXXP-----PPXXXGXXXPPPPXPXXXXXXXXPPP 568 G PPPP P PP PPPP P PPP Sbjct: 343 GVNPPPPPTNNPPSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPP 390 Score = 28.7 bits (61), Expect = 5.6 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = -3 Query: 354 PPPXXGXKXXXXXXPPXKKXPPPPPXGGXGXP 259 PPP PP PPPPP G P Sbjct: 374 PPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPP 405 Score = 28.7 bits (61), Expect = 5.6 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = -3 Query: 354 PPPXXGXKXXXXXXPPXKKXPPPPPXGGXGXP 259 PPP PP PPPPP G P Sbjct: 384 PPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPP 415 Score = 28.7 bits (61), Expect = 5.6 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPP 522 PP PPPPP PPPP PP Sbjct: 387 PPPPTNGPPPPPPPTNGPPPPPP--PTNGPP 415 Score = 28.3 bits (60), Expect = 7.4 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = -3 Query: 360 GXPPPXXGXKXXXXXXPPXKKXPPPPP 280 G PPP PP PPPPP Sbjct: 383 GPPPPPPPTNGPPPPPPPTNGPPPPPP 409 Score = 27.9 bits (59), Expect = 9.8 Identities = 11/28 (39%), Positives = 11/28 (39%) Frame = -3 Query: 363 GGXPPPXXGXKXXXXXXPPXKKXPPPPP 280 GG PP PP PPPPP Sbjct: 342 GGVNPPPPPTNNPPSPPPPTNNTPPPPP 369 Score = 27.9 bits (59), Expect = 9.8 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = -3 Query: 354 PPPXXGXKXXXXXXPPXKKXPPPPPXGGXGXP 259 PPP K P PPPPP G P Sbjct: 366 PPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPP 397 >SB_812| Best HMM Match : FH2 (HMM E-Value=0) Length = 1430 Score = 44.8 bits (101), Expect = 8e-05 Identities = 18/35 (51%), Positives = 18/35 (51%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 P G PPPPP PPPP GGG P PP P Sbjct: 647 PFFGGIPPPPPGGGMFPPPPPPPPGGGVPGPPKPP 681 Score = 36.7 bits (81), Expect = 0.021 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = +3 Query: 459 PPXXXXXXSPPPPXXGGGXPPPPPXP 536 PP PPPP GG PPPPP P Sbjct: 644 PPNPFFGGIPPPPPGGGMFPPPPPPP 669 Score = 36.7 bits (81), Expect = 0.021 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 441 GXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 G PPPP PPPP GG PP P P Sbjct: 651 GIPPPPPGGGMFPPPPPPPPGGGVPGPPKPPP 682 Score = 32.7 bits (71), Expect = 0.34 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +3 Query: 456 PPPXXXXXXSPPPPXXGGGXPPPPPXP 536 PP PPPP G PPPPP P Sbjct: 644 PPNPFFGGIPPPPPGGGMFPPPPPPPP 670 Score = 31.1 bits (67), Expect = 1.1 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -1 Query: 458 GGGXXXPXGGXXXXXKXXPPPPPPGGXXXTPXGGXPP 348 GG P GG PPPPPPGG P PP Sbjct: 650 GGIPPPPPGGGMFPP---PPPPPPGGGVPGPPKPPPP 683 Score = 29.1 bits (62), Expect = 4.2 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -3 Query: 363 GGXPPPXXGXKXXXXXXPPXKKXPPPPPXGGXGXP 259 GG PPP G PP PPPPP GG P Sbjct: 650 GGIPPPPPGG----GMFPPP---PPPPPGGGVPGP 677 >SB_31782| Best HMM Match : FH2 (HMM E-Value=1.2e-08) Length = 1052 Score = 44.4 bits (100), Expect = 1e-04 Identities = 17/32 (53%), Positives = 17/32 (53%) Frame = +3 Query: 435 PXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPP 530 P PPPPP PPPP GG PPPPP Sbjct: 190 PWTSVPPPPPPGPGGIPPPPPPIRGGVPPPPP 221 Score = 37.5 bits (83), Expect = 0.012 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPP 531 PPPPP PPPP PPPPP Sbjct: 195 PPPPPPGPGGIPPPPPPIRGGVPPPPP 221 Score = 33.9 bits (74), Expect = 0.15 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGG 509 P G PPPPP PPPP GG Sbjct: 200 PGPGGIPPPPPPIRGGVPPPPPMGGG 225 Score = 33.5 bits (73), Expect = 0.20 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +3 Query: 486 PPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PPPP G G PPPP P PP Sbjct: 195 PPPPPPGPGGIPPPPPPIRGGVPPPPP 221 Score = 32.7 bits (71), Expect = 0.34 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = +3 Query: 435 PXGXXPPPPPXXXXXXSPPPPXXGGG 512 P G PPPPP PPPP GGG Sbjct: 202 PGGIPPPPPPIRGGV--PPPPPMGGG 225 Score = 31.1 bits (67), Expect = 1.1 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXG 507 PP PPPPP PPPP G Sbjct: 199 PPGPGGIPPPPPPIRGGVPPPPPMGG 224 Score = 29.9 bits (64), Expect = 2.4 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +1 Query: 487 PPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PPPP G PPPPP PP Sbjct: 195 PPPPPPGPGGIPPPPPPIRGGVPPPPP 221 Score = 29.5 bits (63), Expect = 3.2 Identities = 13/29 (44%), Positives = 14/29 (48%), Gaps = 1/29 (3%) Frame = -3 Query: 354 PPPXXGXKXXXXXXPPXKKX-PPPPPXGG 271 PPP G PP + PPPPP GG Sbjct: 196 PPPPPGPGGIPPPPPPIRGGVPPPPPMGG 224 Score = 28.7 bits (61), Expect = 5.6 Identities = 13/25 (52%), Positives = 13/25 (52%), Gaps = 5/25 (20%) Frame = -1 Query: 404 PPPPPPGGXXXTP-----XGGXPPP 345 PPPPPPG P GG PPP Sbjct: 195 PPPPPPGPGGIPPPPPPIRGGVPPP 219 >SB_33909| Best HMM Match : FH2 (HMM E-Value=0) Length = 1063 Score = 42.7 bits (96), Expect = 3e-04 Identities = 21/51 (41%), Positives = 21/51 (41%), Gaps = 3/51 (5%) Frame = +3 Query: 423 GXXPPXGXXPPPPPXXXXXXSPPP---PXXGGGXPPPPPXPXXXAXXXXPP 566 G P PPPPP PPP P G PPPPP P A PP Sbjct: 707 GTLPMPPPPPPPPPGCAGLPPPPPSPQPGCAGLPPPPPPPPPGCAGLPPPP 757 Score = 38.7 bits (86), Expect = 0.005 Identities = 19/46 (41%), Positives = 19/46 (41%), Gaps = 1/46 (2%) Frame = +1 Query: 433 PXGXXXPPPPPXXXKXXXPPP-PXXGXXXPPPPPPLXXXXXAXXPP 567 P PPPPP PPP P G PPPPP A PP Sbjct: 710 PMPPPPPPPPPGCAGLPPPPPSPQPGCAGLPPPPPPPPPGCAGLPP 755 Score = 37.9 bits (84), Expect = 0.009 Identities = 20/50 (40%), Positives = 20/50 (40%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPP 530 PP G G P PPPPP PPPP G PPPPP Sbjct: 717 PPPPGCAGLPPPPPSPQPGCAGLPPPPP-------PPPPGCAGLPPPPPP 759 Score = 36.3 bits (80), Expect = 0.028 Identities = 20/48 (41%), Positives = 20/48 (41%), Gaps = 3/48 (6%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGG---XPPPPPXPXXXAXXXXPPXXXXXG 584 PPPPP PPPP G PPPPP P A PP G Sbjct: 694 PPPPPP------PPPPLLSGTLPMPPPPPPPPPGCAGLPPPPPSPQPG 735 Score = 35.5 bits (78), Expect = 0.049 Identities = 17/42 (40%), Positives = 18/42 (42%), Gaps = 6/42 (14%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXX------PPPPXXGXXXPPPPPPL 537 PP PPPPP PPPP PPPPPP+ Sbjct: 719 PPGCAGLPPPPPSPQPGCAGLPPPPPPPPPGCAGLPPPPPPI 760 Score = 33.1 bits (72), Expect = 0.26 Identities = 18/51 (35%), Positives = 18/51 (35%), Gaps = 6/51 (11%) Frame = +3 Query: 432 PPXGXXPPPP------PXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPP P PPP G PPP P P PP Sbjct: 694 PPPPPPPPPPLLSGTLPMPPPPPPPPPGCAGLPPPPPSPQPGCAGLPPPPP 744 Score = 33.1 bits (72), Expect = 0.26 Identities = 16/42 (38%), Positives = 16/42 (38%), Gaps = 3/42 (7%) Frame = +2 Query: 452 PPPPXXXXKXXXPP---PXXXGXXXPPPPXPXXXXXXXXPPP 568 PPPP PP P G PPPP P PPP Sbjct: 717 PPPPGCAGLPPPPPSPQPGCAGLPPPPPPPPPGCAGLPPPPP 758 Score = 29.1 bits (62), Expect = 4.2 Identities = 16/40 (40%), Positives = 16/40 (40%), Gaps = 1/40 (2%) Frame = +2 Query: 452 PPPPXXXXKXXXPPPXXXGXXXPPP-PXPXXXXXXXXPPP 568 PPPP PPP G PPP P P PPP Sbjct: 712 PPPPPP------PPPGCAGLPPPPPSPQPGCAGLPPPPPP 745 >SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) Length = 739 Score = 42.7 bits (96), Expect = 3e-04 Identities = 19/35 (54%), Positives = 19/35 (54%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 P G PPPPP PPPP GG PPPPP P Sbjct: 190 PMAGMPPPPPP-------PPPPGFPGGAPPPPPPP 217 Score = 38.7 bits (86), Expect = 0.005 Identities = 17/35 (48%), Positives = 18/35 (51%) Frame = +3 Query: 423 GXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPP 527 G PP PPPPP +PPPP G PPPP Sbjct: 193 GMPPPP---PPPPPPGFPGGAPPPPPPPFGAPPPP 224 Score = 35.1 bits (77), Expect = 0.065 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPP 528 PPPPP PPPP PPPP Sbjct: 199 PPPPPPGFPGGAPPPPPPPFGAPPPP 224 Score = 33.1 bits (72), Expect = 0.26 Identities = 14/28 (50%), Positives = 15/28 (53%) Frame = +3 Query: 435 PXGXXPPPPPXXXXXXSPPPPXXGGGXP 518 P G PPPPP +PPPP GG P Sbjct: 207 PGGAPPPPPPPFG---APPPPALNGGPP 231 Score = 31.9 bits (69), Expect = 0.60 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPPL 537 PPPPP PPP PPPP L Sbjct: 198 PPPPPPPGFPGGAPPPPPPPFGAPPPPAL 226 Score = 30.7 bits (66), Expect = 1.4 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPP 534 PPPPP PPPP PPPPP Sbjct: 195 PPPPP-------PPPPPGFPGGAPPPPP 215 Score = 30.3 bits (65), Expect = 1.8 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = -1 Query: 404 PPPPPPGGXXXTPXGGXPPP 345 PPPPPP P G PPP Sbjct: 195 PPPPPPPPPPGFPGGAPPPP 214 Score = 29.5 bits (63), Expect = 3.2 Identities = 15/29 (51%), Positives = 15/29 (51%), Gaps = 2/29 (6%) Frame = +1 Query: 454 PPPPXXXKXXXPPPPXXG--XXXPPPPPP 534 PPPP PPPP G PPPPPP Sbjct: 195 PPPP-------PPPPPPGFPGGAPPPPPP 216 Score = 28.3 bits (60), Expect = 7.4 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +1 Query: 490 PPPXXGXXXPPPPPPLXXXXXAXXPP 567 P P G PPPPPP PP Sbjct: 188 PSPMAGMPPPPPPPPPPGFPGGAPPP 213 Score = 27.9 bits (59), Expect = 9.8 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +3 Query: 489 PPPXXGGGXPPPPPXPXXXAXXXXPPXXXXXG 584 P P G PPPPP P PP G Sbjct: 188 PSPMAGMPPPPPPPPPPGFPGGAPPPPPPPFG 219 >SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) Length = 514 Score = 42.3 bits (95), Expect = 4e-04 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPP 531 PP PPPPP PPP G PPPPP Sbjct: 298 PPPSRGAPPPPPSRGSAPPPPPARMGTAPPPPPP 331 Score = 42.3 bits (95), Expect = 4e-04 Identities = 19/45 (42%), Positives = 21/45 (46%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPPP +PPPP G PPPP P + PP Sbjct: 299 PPSRGAPPPPPSRGS--APPPPPARMGTAPPPPPPSRSSQRPPPP 341 Score = 42.3 bits (95), Expect = 4e-04 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = +3 Query: 423 GXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPP 530 G PP PPP PPPP GG PPPPP Sbjct: 344 GAPPPPSMGMAPPPVGGAAPPPPPPPPVGGPPPPPP 379 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/45 (42%), Positives = 20/45 (44%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPP +PPPP G PPPPP A PP Sbjct: 290 PPSRGAAPPPPSRG---APPPPPSRGSAPPPPPARMGTAPPPPPP 331 Score = 40.3 bits (90), Expect = 0.002 Identities = 25/70 (35%), Positives = 25/70 (35%), Gaps = 9/70 (12%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPX--GXXPPPPPXXXXXXSPPP-------PXXGGGXPPPPPX 533 PP G G PP G PPPPP PPP P G PPPPP Sbjct: 338 PPPPSRGAPPPPSMGMAPPPVGGAAPPPPPPPPVGGPPPPPPPIEGRPPSSLGNPPPPPP 397 Query: 534 PXXXAXXXXP 563 P A P Sbjct: 398 PGRGAPPPGP 407 Score = 39.9 bits (89), Expect = 0.002 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPP PPP G PPPPP P PP Sbjct: 339 PPPSRGAPPPPSMGMA---PPPVGGAAPPPPPPPPVGGPPPPPPP 380 Score = 39.5 bits (88), Expect = 0.003 Identities = 27/78 (34%), Positives = 27/78 (34%), Gaps = 10/78 (12%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPX-----GXXPPPPPXXXXXXSPPPPXXGGGXPPPP-----P 530 PP G G PP G PPPPP PPPP G PPPP P Sbjct: 298 PPPSRGAPPPPPSRGSAPPPPPARMGTAPPPPPPSRSSQRPPPPSRGA--PPPPSMGMAP 355 Query: 531 XPXXXAXXXXPPXXXXXG 584 P A PP G Sbjct: 356 PPVGGAAPPPPPPPPVGG 373 Score = 38.3 bits (85), Expect = 0.007 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPP 531 PP PPP PPPP G PPPPP Sbjct: 347 PPPSMGMAPPPVGGAAPPPPPPPPVGGPPPPPPP 380 Score = 37.9 bits (84), Expect = 0.009 Identities = 31/122 (25%), Positives = 34/122 (27%), Gaps = 6/122 (4%) Frame = +3 Query: 183 KGXFPPPPXKXXSPPPPXFXKKXKXXXXXXXXXXXXXXXXXXXXXXXXXFXXXXXXXXXX 362 +G PPPP + PPPP + Sbjct: 293 RGAAPPPPSRGAPPPPP---SRGSAPPPPPARMGTAPPPPPPSRSSQRPPPPSRGAPPPP 349 Query: 363 XXXXXXPPRGGGGGXXFXXXGXXPPXGXXPPPP------PXXXXXXSPPPPXXGGGXPPP 524 PP GG PP G PPPP P PPPP G G PPP Sbjct: 350 SMGMAPPPVGGAA----PPPPPPPPVGGPPPPPPPIEGRPPSSLGNPPPPPPPGRGAPPP 405 Query: 525 PP 530 P Sbjct: 406 GP 407 Score = 35.9 bits (79), Expect = 0.037 Identities = 15/33 (45%), Positives = 16/33 (48%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPP 528 PP PPPP + PPPP G PPPP Sbjct: 289 PPPSRGAAPPPPS--RGAPPPPPSRGSAPPPPP 319 Score = 35.9 bits (79), Expect = 0.037 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 2/52 (3%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXX--PPPPPXXXXXXSPPPPXXGGGXPPPPP 530 PP G PP PPPPP PPPP PPPP Sbjct: 290 PPSRGAAPPPPSRGAPPPPPSRGSAPPPPPARMGTAPPPPPPSRSSQRPPPP 341 Score = 35.5 bits (78), Expect = 0.049 Identities = 19/45 (42%), Positives = 20/45 (44%), Gaps = 6/45 (13%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPP------PPPPLXXXXXAXXPP 567 PPPPP + PPPP G PP PPPP A PP Sbjct: 287 PPPPPS--RGAAPPPPSRGAPPPPPSRGSAPPPPPARMGTAPPPP 329 Score = 35.5 bits (78), Expect = 0.049 Identities = 16/40 (40%), Positives = 18/40 (45%), Gaps = 4/40 (10%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXX----PPPPXXGXXXPPPPPPL 537 PP G PPPPP + PPPP PPP P+ Sbjct: 369 PPVGGPPPPPPPIEGRPPSSLGNPPPPPPPGRGAPPPGPM 408 Score = 29.5 bits (63), Expect = 3.2 Identities = 19/63 (30%), Positives = 20/63 (31%), Gaps = 2/63 (3%) Frame = -1 Query: 518 GXSXPXXGGGGXXXXXXX--GGGGGXXXPXGGXXXXXKXXPPPPPPGGXXXTPXGGXPPP 345 G + P GG GG P G PPPPPP G P G P Sbjct: 352 GMAPPPVGGAAPPPPPPPPVGGPPPPPPPIEGRPPSSLGNPPPPPPPGRGAPPPGPMIPG 411 Query: 344 XXG 336 G Sbjct: 412 RAG 414 Score = 29.1 bits (62), Expect = 4.2 Identities = 24/110 (21%), Positives = 27/110 (24%), Gaps = 1/110 (0%) Frame = +3 Query: 183 KGXFPPPPXKXXSPPPPXFXKKXKXXXXXXXXXXXXXXXXXXXXXXXXXFXXXXXXXXXX 362 +G PPPP + +PPPP Sbjct: 302 RGAPPPPPSRGSAPPPPPARMGTAPPPPPPSRSSQRPPPPSRGAPPPPSMGMAPPPVGGA 361 Query: 363 XXXXXXPPRGGGGGXXFXXXGXXPPXGXX-PPPPPXXXXXXSPPPPXXGG 509 PP GG PP PPPPP PP P G Sbjct: 362 APPPPPPPPVGGPPPPPPPIEGRPPSSLGNPPPPPPPGRGAPPPGPMIPG 411 Score = 29.1 bits (62), Expect = 4.2 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = -3 Query: 363 GGXPPPXXGXKXXXXXXPPXKKXPPPPP 280 G PPP G PP PPPPP Sbjct: 352 GMAPPPVGGAAPPPPPPPPVGGPPPPPP 379 Score = 28.7 bits (61), Expect = 5.6 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = -3 Query: 360 GXPPPXXGXKXXXXXXPPXKKXPPPPPXGGXGXP 259 G PP G PP PPPPP G P Sbjct: 352 GMAPPPVGGAAPPPPPPPPVGGPPPPPPPIEGRP 385 Score = 27.9 bits (59), Expect = 9.8 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = -3 Query: 354 PPPXXGXKXXXXXXPPXKKXPPPPPXGGXGXP 259 PPP G PP + PPPPP G P Sbjct: 289 PPPSRGAAPP----PPSRGAPPPPPSRGSAPP 316 Score = 27.9 bits (59), Expect = 9.8 Identities = 11/30 (36%), Positives = 13/30 (43%) Frame = -3 Query: 363 GGXPPPXXGXKXXXXXXPPXKKXPPPPPXG 274 G PPP + PP + PPPP G Sbjct: 323 GTAPPPPPPSRSSQRPPPPSRGAPPPPSMG 352 Score = 27.9 bits (59), Expect = 9.8 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = -3 Query: 363 GGXPPPXXGXKXXXXXXPPXKKXPPPPPXGGXGXP 259 GG PPP + P PPPPP G G P Sbjct: 372 GGPPPPPPPIEGRP---PSSLGNPPPPPPPGRGAP 403 >SB_19987| Best HMM Match : MFMR (HMM E-Value=1.4) Length = 330 Score = 42.3 bits (95), Expect = 4e-04 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = +3 Query: 423 GXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 G G PPPPP PPPP PPPPP P Sbjct: 292 GMFASSGFQPPPPPPTDFAPPPPPPEPTSELPPPPPPP 329 Score = 33.9 bits (74), Expect = 0.15 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 6/45 (13%) Frame = +1 Query: 451 PPPPPXXX------KXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PPPPP PPPP PPPPPP PP Sbjct: 283 PPPPPSNTPGMFASSGFQPPPPPPTDFAPPPPPPEPTSELPPPPP 327 Score = 33.5 bits (73), Expect = 0.20 Identities = 17/46 (36%), Positives = 17/46 (36%), Gaps = 7/46 (15%) Frame = +3 Query: 450 PPPPPXXXXXX-------SPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PPPPP PPPP PPPPP P PP Sbjct: 283 PPPPPSNTPGMFASSGFQPPPPPPTDFAPPPPPPEPTSELPPPPPP 328 Score = 31.5 bits (68), Expect = 0.80 Identities = 15/39 (38%), Positives = 16/39 (41%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PPPPP + P G PPPP P A PP Sbjct: 280 PPPPPPPPS--NTPGMFASSGFQPPPPPPTDFAPPPPPP 316 >SB_13021| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 964 Score = 42.3 bits (95), Expect = 4e-04 Identities = 21/50 (42%), Positives = 21/50 (42%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPP 530 PP G G G G PP PPP PPPP G G PPPP Sbjct: 559 PPPGAGQGG-----GPPPPGAGQGGPPPPGAGQEGPPPPGAGQGGGPPPP 603 Score = 40.7 bits (91), Expect = 0.001 Identities = 20/62 (32%), Positives = 21/62 (33%) Frame = +1 Query: 346 GGGXPPXGVXSXXXXXXXXXXFXXXXXXPPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPP 525 GGG PP G P G PPPP + PPPP G P Sbjct: 500 GGGPPPPGAGQGGGPPPPGAGQGWGQPPPGAGQGGGPPPPGAGQGGGPPPPGAGQGWGQP 559 Query: 526 PP 531 PP Sbjct: 560 PP 561 Score = 40.7 bits (91), Expect = 0.001 Identities = 20/62 (32%), Positives = 21/62 (33%) Frame = +1 Query: 346 GGGXPPXGVXSXXXXXXXXXXFXXXXXXPPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPP 525 GGG PP G P G PPPP + PPP G PP Sbjct: 511 GGGPPPPGAGQGWGQPPPGAGQGGGPPPPGAGQGGGPPPPGAGQGWGQPPPGAGQGGGPP 570 Query: 526 PP 531 PP Sbjct: 571 PP 572 Score = 39.5 bits (88), Expect = 0.003 Identities = 23/62 (37%), Positives = 24/62 (38%) Frame = -2 Query: 565 GGXXXXAXXXGXGGGGGXPPPXXGGGGXXFXXXXGGGGGXXPXGGXXPXFXKXXPPPPPR 386 GG G G GGG PPP G GG G G G P G + PPPP Sbjct: 486 GGQGWGQPPPGAGQGGGPPPPGAGQGGGPPPPGAGQGWGQPPPGA-----GQGGGPPPPG 540 Query: 385 GG 380 G Sbjct: 541 AG 542 Score = 39.5 bits (88), Expect = 0.003 Identities = 22/58 (37%), Positives = 22/58 (37%), Gaps = 8/58 (13%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXXPP--------PPPXXXXXXSPPPPXXGGGXPPPPP 530 PP G G G G G PP PPP PPPP G G PPPP Sbjct: 493 PPPGAGQGGGPPPPGAGQGGGPPPPGAGQGWGQPPPGAGQGGGPPPPGAGQGGGPPPP 550 Score = 39.5 bits (88), Expect = 0.003 Identities = 21/62 (33%), Positives = 22/62 (35%) Frame = +1 Query: 346 GGGXPPXGVXSXXXXXXXXXXFXXXXXXPPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPP 525 GGG PP G P G PPPP + PPPP G PP Sbjct: 544 GGGPPPPGAGQGWGQPPPGAGQGGGPPPPGAGQGGPPPPGAGQEG--PPPPGAGQGGGPP 601 Query: 526 PP 531 PP Sbjct: 602 PP 603 Score = 39.5 bits (88), Expect = 0.003 Identities = 22/51 (43%), Positives = 22/51 (43%), Gaps = 1/51 (1%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPX-GXXPPPPPXXXXXXSPPPPXXGGGXPPPPP 530 PP G G G G PP G PPPP PPPP G G PPP Sbjct: 570 PPPGAGQG------GPPPPGAGQEGPPPPGAGQGGGPPPPGAGQGWGLPPP 614 Score = 38.3 bits (85), Expect = 0.007 Identities = 25/72 (34%), Positives = 25/72 (34%), Gaps = 7/72 (9%) Frame = -1 Query: 530 GGGGGXSXPXXGGGGXXXXXXXGGGGGXXXPXGGXXXXXKXXPP-------PPPPGGXXX 372 GGG G P G G G G G P G PP PPPPG Sbjct: 485 GGGQGWGQPPPGAGQGGGPPPPGAGQGGGPPPPGAGQGWGQPPPGAGQGGGPPPPGAG-- 542 Query: 371 TPXGGXPPPXXG 336 GG PPP G Sbjct: 543 -QGGGPPPPGAG 553 Score = 37.9 bits (84), Expect = 0.009 Identities = 22/58 (37%), Positives = 23/58 (39%), Gaps = 6/58 (10%) Frame = -2 Query: 535 GXGGGGGXPPPXXGGGGXXFXXXXGGGGGXXPXGG------XXPXFXKXXPPPPPRGG 380 G G G G PPP G GG G GGG P G P + PPPP G Sbjct: 518 GAGQGWGQPPPGAGQGGGPPPPGAGQGGGPPPPGAGQGWGQPPPGAGQGGGPPPPGAG 575 Score = 37.5 bits (83), Expect = 0.012 Identities = 19/62 (30%), Positives = 20/62 (32%) Frame = +1 Query: 346 GGGXPPXGVXSXXXXXXXXXXFXXXXXXPPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPP 525 G G PP G P G PPP + PPPP G PP Sbjct: 489 GWGQPPPGAGQGGGPPPPGAGQGGGPPPPGAGQGWGQPPPGAGQGGGPPPPGAGQGGGPP 548 Query: 526 PP 531 PP Sbjct: 549 PP 550 Score = 37.5 bits (83), Expect = 0.012 Identities = 21/52 (40%), Positives = 21/52 (40%), Gaps = 2/52 (3%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXX--PPPPPXXXXXXSPPPPXXGGGXPPPPP 530 PP G G G G PP PPPP PPPP G G PPP Sbjct: 515 PPPGAGQGW-----GQPPPGAGQGGGPPPPGAGQGGGPPPPGAGQGWGQPPP 561 Score = 36.3 bits (80), Expect = 0.028 Identities = 21/56 (37%), Positives = 22/56 (39%), Gaps = 4/56 (7%) Frame = -2 Query: 535 GXGGGGGXPPPXXGGGGXXFXXXXGGGGGXXPXGG----XXPXFXKXXPPPPPRGG 380 G G G G PPP G GG G GG P G P + PPPP G Sbjct: 551 GAGQGWGQPPPGAGQGGGPPPPGAGQGGPPPPGAGQEGPPPPGAGQGGGPPPPGAG 606 Score = 35.9 bits (79), Expect = 0.037 Identities = 22/68 (32%), Positives = 22/68 (32%), Gaps = 3/68 (4%) Frame = -1 Query: 530 GGGGGXSXPXXGGGGXXXXXXXGGGGGXXXPXGGXXXXXKXXPPPPPPGGXXXTP---XG 360 G G G P G G G G G P G PP GG P G Sbjct: 518 GAGQGWGQPPPGAGQGGGPPPPGAGQGGGPPPPGAGQGWGQPPPGAGQGGGPPPPGAGQG 577 Query: 359 GXPPPXXG 336 G PPP G Sbjct: 578 GPPPPGAG 585 Score = 35.1 bits (77), Expect = 0.065 Identities = 19/47 (40%), Positives = 20/47 (42%), Gaps = 2/47 (4%) Frame = +3 Query: 396 GGGXXFXXXGXXPPXGXX--PPPPPXXXXXXSPPPPXXGGGXPPPPP 530 GGG + G PP PPPP PPPP G G PPP Sbjct: 485 GGGQGW---GQPPPGAGQGGGPPPPGAGQGGGPPPPGAGQGWGQPPP 528 Score = 35.1 bits (77), Expect = 0.065 Identities = 25/78 (32%), Positives = 25/78 (32%), Gaps = 13/78 (16%) Frame = -1 Query: 530 GGGGGXSXPXXGGGGXXXXXXXGGGGGXXXPXGGXXXXXKXXPP------PPPPGGXXXT 369 G G G P G G G G G P G PP PPPPG Sbjct: 529 GAGQGGGPPPPGAGQGGGPPPPGAGQGWGQPPPGAGQGGGPPPPGAGQGGPPPPGAGQEG 588 Query: 368 P-------XGGXPPPXXG 336 P GG PPP G Sbjct: 589 PPPPGAGQGGGPPPPGAG 606 Score = 34.7 bits (76), Expect = 0.085 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPP 531 PP PPPP + PPPP G PPP Sbjct: 581 PPGAGQEGPPPPGAGQGGGPPPPGAGQGWGLPPP 614 Score = 34.3 bits (75), Expect = 0.11 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPP 531 P G PPP + PPPP G PPPP Sbjct: 484 PGGGQGWGQPPPGAGQGGGPPPPGAGQGGGPPPP 517 Score = 34.3 bits (75), Expect = 0.11 Identities = 27/103 (26%), Positives = 28/103 (27%) Frame = +2 Query: 260 GXPXPPXGGGGGXFXFGGXXXXXFFXPXXGGGXPPXXXXXXXXXXXXXXXFXKXXXXPPX 439 G P P G G G G P G G P + PP Sbjct: 513 GPPPPGAGQGWGQPPPGAGQGGGPPPPGAGQGGGPPPPGAGQGWGQPPPGAGQGGGPPPP 572 Query: 440 GXXXPPPPXXXXKXXXPPPXXXGXXXPPPPXPXXXXXXXXPPP 568 G PP PPP G PPP P PPP Sbjct: 573 GAGQGGPPPPGAGQEGPPPPGAGQGGGPPP-PGAGQGWGLPPP 614 Score = 33.9 bits (74), Expect = 0.15 Identities = 26/105 (24%), Positives = 29/105 (27%), Gaps = 2/105 (1%) Frame = -3 Query: 567 GGGXXXXXXXKGXGGGGXXXPXXXGGGXXXFXXXXGGGGXLXPXGGXXXXXXKXXXXXXX 388 G G G G GG P G G G GG P G Sbjct: 496 GAGQGGGPPPPGAGQGGGPPPPGAGQGWGQPPPGAGQGGGPPPPGAGQGGGPPPPGAGQG 555 Query: 387 XXXXXXXXG--GXPPPXXGXKXXXXXXPPXKKXPPPPPXGGXGXP 259 G G PPP + ++ PPPP G G P Sbjct: 556 WGQPPPGAGQGGGPPPPGAGQGGPPPPGAGQEGPPPPGAGQGGGP 600 Score = 33.5 bits (73), Expect = 0.20 Identities = 24/71 (33%), Positives = 24/71 (33%), Gaps = 3/71 (4%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXXP---PPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAX 551 PP G G G G PP G PPPP PPP G G PP P Sbjct: 526 PPPGAGQG------GGPPPPGAGQGGGPPPPGAGQGWGQPPPGAGQGG--GPPPPGAGQG 577 Query: 552 XXXPPXXXXXG 584 PP G Sbjct: 578 GPPPPGAGQEG 588 Score = 29.5 bits (63), Expect = 3.2 Identities = 27/106 (25%), Positives = 28/106 (26%), Gaps = 3/106 (2%) Frame = -3 Query: 567 GGGXXXXXXXKGXGGGGXXXPXXXGGGXXXFXXXXGGGGXLXPXGGXXXXXXKXXXXXXX 388 G G G G G P G G G GG P G Sbjct: 507 GAGQGGGPPPPGAGQGWGQPPPGAGQGGGPPPPGAGQGGGPPPPGAGQGWGQPPPGAGQG 566 Query: 387 XXXXXXXXG--GXPPPXXGXKXXXXXXPPXKKXPPPPPXG-GXGXP 259 G G PPP G + PPPP G G G P Sbjct: 567 GGPPPPGAGQGGPPPPGAGQEGPPPPGAGQGGGPPPPGAGQGWGLP 612 >SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) Length = 593 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = +3 Query: 423 GXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXA 548 G PP PPPPP PPPP PPPPP P A Sbjct: 461 GQAPPPPPPPPPPPPPPPPPPPPPPPPF--PPPPPPTPLHLA 500 Score = 40.7 bits (91), Expect = 0.001 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPP 534 PPPPP PPPP PPPPPP Sbjct: 467 PPPPPPPPPPPPPPPPPPPPPFPPPPPP 494 Score = 34.3 bits (75), Expect = 0.11 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +1 Query: 439 GXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPP 534 G PPPP PPPP PPPPPP Sbjct: 459 GVGQAPPPPPPPPPPPPPPP---PPPPPPPPP 487 Score = 33.9 bits (74), Expect = 0.15 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = +3 Query: 441 GXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 G PPPPP PPPP PPPPP P PP Sbjct: 461 GQAPPPPPPPPP---PPPP------PPPPPPPPPPPFPPPPP 493 >SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1597 Score = 40.7 bits (91), Expect = 0.001 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPP 534 PPPPP PPPP PPPPPP Sbjct: 684 PPPPPPPPPPPPPPPPPPQPSTPPPPPP 711 Score = 37.9 bits (84), Expect = 0.009 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +1 Query: 433 PXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPP 534 P PPPPP PPPP PPPPP Sbjct: 677 PIQTMVPPPPPPPPPPPPPPPPPPPQPSTPPPPP 710 Score = 37.9 bits (84), Expect = 0.009 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPPP 530 PPPPP PPPP PPPPP Sbjct: 685 PPPPPPPPPPPPPPPPPQPSTPPPPPP 711 Score = 37.1 bits (82), Expect = 0.016 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 PPPPP PPPP PPPP P Sbjct: 686 PPPPPPPPPPPPPPPPQPSTPPPPPPSTP 714 Score = 33.1 bits (72), Expect = 0.26 Identities = 15/36 (41%), Positives = 17/36 (47%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPL 537 PP PPPPP + PPPP PP PP+ Sbjct: 687 PPPPPPPPPPPPPPPQPSTPPPP------PPSTPPV 716 Score = 32.7 bits (71), Expect = 0.34 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +3 Query: 456 PPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 P P PPPP PPPPP P PP Sbjct: 675 PIPIQTMVPPPPPPPPPPPPPPPPPPPQPSTPPPPPP 711 Score = 32.3 bits (70), Expect = 0.46 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +1 Query: 457 PPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 P P PPPP PPPPPP PP Sbjct: 675 PIPIQTMVPPPPPPPPPPPPPPPPPPPQPSTPPPPPP 711 Score = 31.1 bits (67), Expect = 1.1 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPP 497 PP PPPPP +PPPP Sbjct: 688 PPPPPPPPPPPPPPQPSTPPPP 709 Score = 30.3 bits (65), Expect = 1.8 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +3 Query: 453 PPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 PPPP PPPP PPPPP P Sbjct: 683 PPPP-------PPPPPPPPPPPPPPPQP 703 Score = 28.3 bits (60), Expect = 7.4 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +3 Query: 453 PPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 P P PPPP PPPPP P + PP Sbjct: 675 PIPIQTMVPPPPPPPPP--PPPPPPPPPPQPSTPPPPP 710 >SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) Length = 305 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/49 (38%), Positives = 20/49 (40%), Gaps = 4/49 (8%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXX----GGGXPPPPPXPXXXAXXXXPP 566 P PPPPP +PPPP GG PPPPP PP Sbjct: 120 PSQAPSPPPPPTSPATRAPPPPPPIAPATGGPPPPPPIAPATGGPPPPP 168 Score = 40.7 bits (91), Expect = 0.001 Identities = 21/64 (32%), Positives = 22/64 (34%) Frame = +1 Query: 337 PXXGGGXPPXGVXSXXXXXXXXXXFXXXXXXPPXGXXXPPPPPXXXKXXXPPPPXXGXXX 516 P GG PP + PP G PPPPP PPPP Sbjct: 159 PATGGPPPPPPIAPAATVPAPAVPLAAASPPPPSGGPPPPPPPPPPP---PPPPILELAA 215 Query: 517 PPPP 528 PPPP Sbjct: 216 PPPP 219 Score = 39.5 bits (88), Expect = 0.003 Identities = 18/48 (37%), Positives = 19/48 (39%), Gaps = 3/48 (6%) Frame = +1 Query: 433 PXGXXXPPPPPXXXKXXXPPPPXX---GXXXPPPPPPLXXXXXAXXPP 567 P PPPPP PPPP PPPPPP+ PP Sbjct: 120 PSQAPSPPPPPTSPATRAPPPPPPIAPATGGPPPPPPIAPATGGPPPP 167 Score = 37.5 bits (83), Expect = 0.012 Identities = 17/37 (45%), Positives = 17/37 (45%), Gaps = 4/37 (10%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPP----XXGGGXPPPPP 530 P PPPPP PPPP GG PPPPP Sbjct: 133 PATRAPPPPPPIAPATGGPPPPPPIAPATGGPPPPPP 169 Score = 37.5 bits (83), Expect = 0.012 Identities = 19/45 (42%), Positives = 19/45 (42%), Gaps = 10/45 (22%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSP----------PPPXXGGGXPPPPPXP 536 P G PPPPP P PPP GG PPPPP P Sbjct: 159 PATGGPPPPPPIAPAATVPAPAVPLAAASPPPPSGGPPPPPPPPP 203 Score = 36.7 bits (81), Expect = 0.021 Identities = 18/42 (42%), Positives = 18/42 (42%), Gaps = 4/42 (9%) Frame = +3 Query: 423 GXXPPXGXXP----PPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 G PP P P P SPPPP G PPPPP P Sbjct: 163 GPPPPPPIAPAATVPAPAVPLAAASPPPPSGGPPPPPPPPPP 204 Score = 34.3 bits (75), Expect = 0.11 Identities = 16/44 (36%), Positives = 17/44 (38%), Gaps = 5/44 (11%) Frame = +1 Query: 451 PPPP-----PXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PPPP P PPP PPPPPP+ PP Sbjct: 111 PPPPRAPETPSQAPSPPPPPTSPATRAPPPPPPIAPATGGPPPP 154 Score = 34.3 bits (75), Expect = 0.11 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPP 527 PP PPPP PPPP PPPP Sbjct: 188 PPPPSGGPPPPPPPPPPPPPPPILELAAPPPP 219 Score = 33.1 bits (72), Expect = 0.26 Identities = 18/44 (40%), Positives = 18/44 (40%), Gaps = 5/44 (11%) Frame = +3 Query: 450 PPPPPXXXXXXS----PPPPXXG-GGXPPPPPXPXXXAXXXXPP 566 PPPPP S PPPP PPPP P A PP Sbjct: 110 PPPPPRAPETPSQAPSPPPPPTSPATRAPPPPPPIAPATGGPPP 153 Score = 32.7 bits (71), Expect = 0.34 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 3/47 (6%) Frame = +1 Query: 433 PXGXXXPPPPPXXXKXXXPPPPXX---GXXXPPPPPPLXXXXXAXXP 564 P PPPPP PPPP PPPPPP A P Sbjct: 133 PATRAPPPPPPIAPATGGPPPPPPIAPATGGPPPPPP--IAPAATVP 177 Score = 31.5 bits (68), Expect = 0.80 Identities = 16/46 (34%), Positives = 16/46 (34%), Gaps = 2/46 (4%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXS--PPPPXXGGGXPPPPPXPXXXAXXXXP 563 P G PPPPP PPPP P P P A P Sbjct: 146 PATGGPPPPPPIAPATGGPPPPPPIAPAATVPAPAVPLAAASPPPP 191 Score = 30.7 bits (66), Expect = 1.4 Identities = 18/52 (34%), Positives = 19/52 (36%), Gaps = 7/52 (13%) Frame = +1 Query: 433 PXGXXXPPPPPXXXK--XXXPPPPXXGXXXP-----PPPPPLXXXXXAXXPP 567 P G P P P + PPPP P PPPPP A PP Sbjct: 90 PAGVEAPTPTPMVAQSVAPTPPPPPRAPETPSQAPSPPPPPTSPATRAPPPP 141 Score = 25.0 bits (52), Expect(2) = 0.84 Identities = 9/18 (50%), Positives = 9/18 (50%) Frame = -1 Query: 440 PXGGXXXXXKXXPPPPPP 387 P GG PPPPPP Sbjct: 191 PSGGPPPPPPPPPPPPPP 208 Score = 25.0 bits (52), Expect(2) = 0.84 Identities = 9/20 (45%), Positives = 9/20 (45%) Frame = -1 Query: 404 PPPPPPGGXXXTPXGGXPPP 345 PPPPPP PPP Sbjct: 200 PPPPPPPPPPILELAAPPPP 219 >SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 290 Score = 40.3 bits (90), Expect = 0.002 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 1/47 (2%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXP-PPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPPP P PPP PPP PP A PP Sbjct: 96 PPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPP 142 Score = 37.1 bits (82), Expect = 0.016 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 1/47 (2%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXP-PPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PP PP P PPP PPP PP A PP Sbjct: 175 PPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPPNPPYPPPPNAPNPP 221 Score = 36.3 bits (80), Expect = 0.028 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 PP PPPP PPPP PPPP P Sbjct: 205 PPPNPPYPPPPNAPNPPYPPPPNAPNPPYPPPPNP 239 Score = 35.9 bits (79), Expect = 0.037 Identities = 17/47 (36%), Positives = 18/47 (38%), Gaps = 2/47 (4%) Frame = +3 Query: 432 PPXGXXPPPP--PXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPP P +P PP PPPP P PP Sbjct: 119 PPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPPPNPPYPPPLYPPPP 165 Score = 35.5 bits (78), Expect = 0.049 Identities = 15/35 (42%), Positives = 16/35 (45%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 PP P PPP +PPPP PP PP P Sbjct: 149 PPPPNPPYPPPLYPPPPNPPPPNAPYPPPPYPPPP 183 Score = 35.1 bits (77), Expect = 0.065 Identities = 18/48 (37%), Positives = 18/48 (37%), Gaps = 2/48 (4%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPP--PPXXGXXXPPPPPPLXXXXXAXXPP 567 PP P PPP PP PP PPP PP A PP Sbjct: 158 PPLYPPPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNPP 205 Score = 34.3 bits (75), Expect = 0.11 Identities = 18/50 (36%), Positives = 19/50 (38%), Gaps = 1/50 (2%) Frame = +3 Query: 390 GGGGGXXFXXXGXXPPXGXXP-PPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 GG F PP P PPPP +PP P PPPP P Sbjct: 81 GGHPPTNFSPNPPYPPPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPPPNP 130 Score = 34.3 bits (75), Expect = 0.11 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 PP PPP P PPPP PP PP P Sbjct: 157 PPPLYPPPPNPPPPNAPYPPPPYPPPPNPPYPPPP 191 Score = 34.3 bits (75), Expect = 0.11 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 4/39 (10%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPP----PPPP 534 PP PPP P PPPP PP PPPP Sbjct: 169 PPNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPP 207 Score = 33.9 bits (74), Expect = 0.15 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPP PPPP PP PP P PP Sbjct: 162 PPPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPP 206 Score = 33.5 bits (73), Expect = 0.20 Identities = 16/40 (40%), Positives = 16/40 (40%), Gaps = 1/40 (2%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPP-PPPPLXXXXXAXXPP 567 PP PP PPPP PP PPPP PP Sbjct: 92 PPYPPPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPP 131 Score = 33.5 bits (73), Expect = 0.20 Identities = 17/48 (35%), Positives = 17/48 (35%), Gaps = 2/48 (4%) Frame = +1 Query: 430 PPXGXXXPPP--PPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPP PP P PP PPPP P PP Sbjct: 118 PPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPPPNPPYPPPLYPPPP 165 Score = 33.5 bits (73), Expect = 0.20 Identities = 17/48 (35%), Positives = 17/48 (35%), Gaps = 2/48 (4%) Frame = +1 Query: 430 PPXGXXXPPPP--PXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPP P P PP PP PPP PP Sbjct: 189 PPPNPPYPPPPNAPNPPPPNPPYPPPPNAPNPPYPPPPNAPNPPYPPP 236 Score = 33.5 bits (73), Expect = 0.20 Identities = 17/47 (36%), Positives = 17/47 (36%), Gaps = 2/47 (4%) Frame = +3 Query: 432 PPXGXXPPPP--PXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPP P P PP PP PP P PP Sbjct: 190 PPNPPYPPPPNAPNPPPPNPPYPPPPNAPNPPYPPPPNAPNPPYPPP 236 Score = 33.5 bits (73), Expect = 0.20 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPP 531 PP PPPP PPPP PPPP Sbjct: 204 PPPPNPPYPPPPNAPNPPYPPPPNAPNPPYPPPP 237 Score = 33.1 bits (72), Expect = 0.26 Identities = 17/47 (36%), Positives = 17/47 (36%), Gaps = 1/47 (2%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXP-PPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PP PP P PPP PPP P A PP Sbjct: 104 PPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPP 150 Score = 33.1 bits (72), Expect = 0.26 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PP P P PP PPPP P A PP Sbjct: 134 PPPNAPYPPSPNAPYPPPPNPPYPPPLYPPPPNPPPPNAPYPPPP 178 Score = 32.7 bits (71), Expect = 0.34 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PP P PPPP PPP PP A PP Sbjct: 84 PPTNFSPNPPYPPPPYPPYPPPPPY---PPPPNPPYPPPPNAPYPP 126 Score = 32.7 bits (71), Expect = 0.34 Identities = 16/46 (34%), Positives = 16/46 (34%), Gaps = 1/46 (2%) Frame = +1 Query: 433 PXGXXXPPPPPXXXKXXXPPPPXXGXXXPP-PPPPLXXXXXAXXPP 567 P PPP P PPPP P PPPP PP Sbjct: 144 PNAPYPPPPNPPYPPPLYPPPPNPPPPNAPYPPPPYPPPPNPPYPP 189 Score = 32.3 bits (70), Expect = 0.46 Identities = 19/51 (37%), Positives = 19/51 (37%), Gaps = 6/51 (11%) Frame = +3 Query: 432 PPXGXXPPPP----PXXXXXXSPPPPXXGGGXP--PPPPXPXXXAXXXXPP 566 PP PPPP P PPPP P PPPP P PP Sbjct: 127 PPNPPYPPPPNAPYPPSPNAPYPPPPNPPYPPPLYPPPPNPPPPNAPYPPP 177 Score = 32.3 bits (70), Expect = 0.46 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 PP PPPP PPPP PP PP P Sbjct: 181 PPPNPPYPPPPNPPY---PPPPNAPNPPPPNPPYP 212 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 PP PP PP PPPP PP PP P Sbjct: 100 PPYPPPPPYPPPPNPPY-PPPPNAPYPPPPNPPYP 133 Score = 30.3 bits (65), Expect = 1.8 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +3 Query: 435 PXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 P PP PP PPPP PP P P PP Sbjct: 92 PPYPPPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPP 135 Score = 29.9 bits (64), Expect = 2.4 Identities = 15/46 (32%), Positives = 15/46 (32%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PP P P PP PPPP P PP Sbjct: 133 PPPPNAPYPPSPNAPYPPPPNPPYPPPLYPPPPNPPPPNAPYPPPP 178 Score = 29.5 bits (63), Expect = 3.2 Identities = 15/46 (32%), Positives = 15/46 (32%) Frame = +2 Query: 431 PPXGXXXPPPPXXXXKXXXPPPXXXGXXXPPPPXPXXXXXXXXPPP 568 PP PPPP PPP PPPP P P Sbjct: 197 PPPNAPNPPPPNPPYP---PPPNAPNPPYPPPPNAPNPPYPPPPNP 239 Score = 29.1 bits (62), Expect = 4.2 Identities = 14/46 (30%), Positives = 14/46 (30%) Frame = +2 Query: 431 PPXGXXXPPPPXXXXKXXXPPPXXXGXXXPPPPXPXXXXXXXXPPP 568 PP PPPP PP P PP P PP Sbjct: 110 PPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPPPNPP 155 Score = 28.3 bits (60), Expect = 7.4 Identities = 17/47 (36%), Positives = 17/47 (36%), Gaps = 2/47 (4%) Frame = +1 Query: 433 PXGXXXPPPPPXXXKXXXPPPPXXGXXXPP--PPPPLXXXXXAXXPP 567 P P PPP PPPP PP P PP A PP Sbjct: 188 PPPPNPPYPPP--PNAPNPPPPNPPYPPPPNAPNPPYPPPPNAPNPP 232 >SB_23015| Best HMM Match : WW (HMM E-Value=2.8e-16) Length = 678 Score = 39.9 bits (89), Expect = 0.002 Identities = 17/35 (48%), Positives = 17/35 (48%), Gaps = 1/35 (2%) Frame = +1 Query: 430 PPXGXXXPPP-PPXXXKXXXPPPPXXGXXXPPPPP 531 PP G PPP PP PPPP PPPPP Sbjct: 557 PPPGVDIPPPLPPSEDPKPPPPPPEPPEECPPPPP 591 Score = 35.9 bits (79), Expect = 0.037 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 PPPPP P PP PPPPP P Sbjct: 554 PPPPPPGVDIPPPLPPSEDPKPPPPPPEP 582 Score = 34.7 bits (76), Expect = 0.085 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 454 PPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PPPP PP P PPPPPP PP Sbjct: 554 PPPPPPGVDIPPPLPPSEDPKPPPPPPEPPEECPPPPP 591 Score = 32.3 bits (70), Expect = 0.46 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +3 Query: 453 PPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PPPP PP P PPPPP PP Sbjct: 554 PPPPPPGVDIPPPLPPSEDPKPPPPPPEPPEECPPPPP 591 Score = 31.5 bits (68), Expect = 0.80 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 P P PPPP G PPP PP PP Sbjct: 542 PAVAPAVTPSEEPPPPPPGVDIPPPLPPSEDPKPPPPPP 580 Score = 28.3 bits (60), Expect = 7.4 Identities = 13/39 (33%), Positives = 13/39 (33%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 P P PPPP G PPP P PP Sbjct: 542 PAVAPAVTPSEEPPPPPPGVDIPPPLPPSEDPKPPPPPP 580 >SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 39.1 bits (87), Expect = 0.004 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPL 537 PP PPPP PPPP PPPPPPL Sbjct: 57 PPAAAPAAPPPPAAAPAA-PPPPAAPPAAPPPPPPL 91 Score = 35.9 bits (79), Expect = 0.037 Identities = 16/39 (41%), Positives = 17/39 (43%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PPP P +PPPP PPPP P A PP Sbjct: 53 PPPSPPAAAPAAPPPPAAAPAAPPPPAAP-PAAPPPPPP 90 Score = 35.9 bits (79), Expect = 0.037 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 P PPPP PPP PPPPP P Sbjct: 58 PAAAPAAPPPPAAAPAAPPPPAAPPAAPPPPPPLP 92 Score = 35.9 bits (79), Expect = 0.037 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPPP PPPP PPPPP PP Sbjct: 67 PPAAAPAAPPPPAAPPAAPPPPPP--LPAPPPPPAQPAPQPPPAPP 110 Score = 34.7 bits (76), Expect = 0.085 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 2/47 (4%) Frame = +3 Query: 432 PPXGXXP--PPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP P PPPP PPPP PPPPP PP Sbjct: 66 PPPAAAPAAPPPPAAPPAAPPPPPPLPA--PPPPPAQPAPQPPPAPP 110 Score = 31.9 bits (69), Expect = 0.60 Identities = 15/41 (36%), Positives = 15/41 (36%), Gaps = 2/41 (4%) Frame = +1 Query: 451 PPPPPXXXKXXXP--PPPXXGXXXPPPPPPLXXXXXAXXPP 567 PPPPP P PPP PPPP PP Sbjct: 50 PPPPPPSPPAAAPAAPPPPAAAPAAPPPPAAPPAAPPPPPP 90 >SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1324 Score = 38.7 bits (86), Expect = 0.005 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 PP PPPPP PPPP PPPPP P Sbjct: 1157 PPPPPPPPPPPPSSPSPPPPPPP-----PPPPPTP 1186 Score = 28.3 bits (60), Expect = 7.4 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = -1 Query: 404 PPPPPPGGXXXTPXGGXPPP 345 PPPPPP P PPP Sbjct: 1163 PPPPPPSSPSPPPPPPPPPP 1182 >SB_56047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 440 Score = 38.7 bits (86), Expect = 0.005 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PPPPP PPP PPPPPL A PP Sbjct: 280 PPPPPPLTGGMLPPPFGGHPAAAPPPPPLPAGVPAPPPP 318 Score = 37.5 bits (83), Expect = 0.012 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = +3 Query: 435 PXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPPXXXXXG 584 P PPPPP PP PPPPP P PP G Sbjct: 276 PTSQPPPPPPLTGGMLPPPFGGHPAAAPPPPPLPAGVPAPPPPPPPPMLG 325 Score = 35.5 bits (78), Expect = 0.049 Identities = 15/35 (42%), Positives = 16/35 (45%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 P G PPP +PPPP G P PPP P Sbjct: 285 PLTGGMLPPPFGGHPAAAPPPPPLPAGVPAPPPPP 319 Score = 33.5 bits (73), Expect = 0.20 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 2/37 (5%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXX--GXXXPPPPPP 534 PP PPP PPPP G PPPPPP Sbjct: 284 PPLTGGMLPPPFGGHPAAAPPPPPLPAGVPAPPPPPP 320 Score = 29.5 bits (63), Expect = 3.2 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXP 518 PP GG G P PPP P PPPP G P Sbjct: 282 PPPPLTGGMLPPPFGGHPAAAPPPPPLPAGVPAPPPPPPPPMLGGP 327 Score = 28.7 bits (61), Expect = 5.6 Identities = 12/20 (60%), Positives = 12/20 (60%), Gaps = 2/20 (10%) Frame = -1 Query: 404 PPPPPP--GGXXXTPXGGXP 351 PPPPPP GG P GG P Sbjct: 280 PPPPPPLTGGMLPPPFGGHP 299 Score = 28.3 bits (60), Expect = 7.4 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = -1 Query: 458 GGGXXXPXGGXXXXXKXXPPPPPPGGXXXTPXGGXPPPXXGXK 330 GG P GG PPPP P G P PP G K Sbjct: 288 GGMLPPPFGGHPAAAP--PPPPLPAGVPAPPPPPPPPMLGGPK 328 >SB_52556| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 255 Score = 38.7 bits (86), Expect = 0.005 Identities = 15/36 (41%), Positives = 16/36 (44%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPL 537 PP P PP PPPP PPPPPP+ Sbjct: 215 PPEPDYLEPTPPPPAAPAPPPPPAAAPPPPPPPPPV 250 Score = 27.9 bits (59), Expect = 9.8 Identities = 13/37 (35%), Positives = 14/37 (37%) Frame = +3 Query: 456 PPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP +PPPP PPPPP PP Sbjct: 215 PPEPDYLEPTPPPP--AAPAPPPPPAAAPPPPPPPPP 249 >SB_10571| Best HMM Match : Cas1p (HMM E-Value=1.8e-26) Length = 765 Score = 38.7 bits (86), Expect = 0.005 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = -1 Query: 566 GGXXAXXXXXRGGGGGGXSXPXXGGGGXXXXXXXGGGGGXXXPXGG 429 GG GGGGGG GGGG GGGGG GG Sbjct: 659 GGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGG 704 Score = 36.7 bits (81), Expect = 0.021 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = -1 Query: 566 GGXXAXXXXXRGGGGGGXSXPXXGGGGXXXXXXXGGGGGXXXPXGG 429 GG GGGGGG GGGG GGGGG G Sbjct: 663 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAG 708 Score = 35.1 bits (77), Expect = 0.065 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = -2 Query: 565 GGXXXXAXXXGXGGGGGXPPPXXGGGGXXFXXXXGGGGGXXPXGG 431 GG G GGGGG GGGG GGGGG G Sbjct: 662 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAG 706 Score = 34.3 bits (75), Expect = 0.11 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = -1 Query: 566 GGXXAXXXXXRGGGGGGXSXPXXGGGGXXXXXXXGGGGGXXXPXGG 429 GG GGGGGG GGGG GGG G G Sbjct: 665 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAGAG 710 Score = 32.7 bits (71), Expect = 0.34 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -2 Query: 535 GXGGGGGXPPPXXGGGGXXFXXXXGGGGGXXPXGG 431 G GG GG GGGG GGGGG GG Sbjct: 657 GDGGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 691 Score = 31.9 bits (69), Expect = 0.60 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = -1 Query: 566 GGXXAXXXXXRGGGGGGXSXPXXGGGGXXXXXXXGGGGGXXXPXG 432 GG GGGGGG GGGG G G G G Sbjct: 670 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAGAGDDDG 714 Score = 30.3 bits (65), Expect = 1.8 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = -2 Query: 565 GGXXXXAXXXGXGGGGGXPPPXXGGGGXXFXXXXGGGGGXXPXGG 431 GG G GGGGG GGGG G G G G Sbjct: 672 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAGAGDDDGDG 716 Score = 29.1 bits (62), Expect = 4.2 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -3 Query: 567 GGGXXXXXXXKGXGGGGXXXPXXXGGGXXXFXXXXGGGG 451 GGG G GGGG GGG GGGG Sbjct: 662 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 700 Score = 29.1 bits (62), Expect = 4.2 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -3 Query: 567 GGGXXXXXXXKGXGGGGXXXPXXXGGGXXXFXXXXGGGG 451 GGG G GGGG GGG GGGG Sbjct: 663 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 701 >SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) Length = 867 Score = 38.3 bits (85), Expect = 0.007 Identities = 18/51 (35%), Positives = 19/51 (37%), Gaps = 5/51 (9%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXP-----PPPPPLXXXXXAXXPP 567 PP PPPPP PPPP P P PPP+ PP Sbjct: 211 PPPSPPPPPPPPSPSPPRPPPPPPPSPPRPLAAKLPEPPPIPNMPPTLPPP 261 Score = 37.9 bits (84), Expect = 0.009 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPP 534 PPPPP PPPP P PPPP Sbjct: 205 PPPPPRPPPSPPPPPPPPSPSPPRPPPP 232 Score = 37.9 bits (84), Expect = 0.009 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PP PP SP PP PP PP P PP Sbjct: 206 PPPPRPPPSPPPPPPPPSPSPPRPPPPPPPSPPRPLAAKLPEPPP 250 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +1 Query: 433 PXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPP 534 P PPPPP PPPP PP PPP Sbjct: 198 PSQITQPPPPPPRPPPSPPPPPPPPSPSPPRPPP 231 Score = 37.5 bits (83), Expect = 0.012 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 PPPPP PPPP P PPP P Sbjct: 205 PPPPPRPPPSPPPPPPPPSPSPPRPPPPP 233 Score = 36.3 bits (80), Expect = 0.028 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPP 534 PP PPP P PPPP PPPPPP Sbjct: 204 PPPPPPRPPPSP----PPPPPPPSPSPPRPPPPPP 234 Score = 34.3 bits (75), Expect = 0.11 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = +3 Query: 441 GXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 G P P PPPP PPPPP P PP Sbjct: 191 GTSHPTSPSQITQPPPPPPRPPPSPPPPPPPPSPSPPRPPPP 232 Score = 32.7 bits (71), Expect = 0.34 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +1 Query: 454 PPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 P P PPPP PPPPPP PP Sbjct: 195 PTSPSQITQPPPPPPRPPPSPPPPPPPPSPSPPRPPPP 232 >SB_57724| Best HMM Match : F5_F8_type_C (HMM E-Value=0) Length = 3804 Score = 37.5 bits (83), Expect = 0.012 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = -1 Query: 533 GGGGGGXSXPXXGGGGXXXXXXXGGGGGXXXPXGG 429 GGGGGG GGGG GGGGG GG Sbjct: 132 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 166 Score = 35.5 bits (78), Expect = 0.049 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = -2 Query: 535 GXGGGGGXPPPXXGGGGXXFXXXXGGGGGXXPXGG 431 G GGGGG GGGG GGGGG GG Sbjct: 132 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 166 Score = 33.1 bits (72), Expect = 0.26 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -2 Query: 535 GXGGGGGXPPPXXGGGGXXFXXXXGGGGGXXPXG 434 G GGGGG GGGG GGGGG G Sbjct: 135 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGDG 168 Score = 32.7 bits (71), Expect = 0.34 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -1 Query: 533 GGGGGGXSXPXXGGGGXXXXXXXGGGGGXXXPXG 432 GGGGGG GGGG GGG G G Sbjct: 141 GGGGGGGGGGGGGGGGGGGGGGGGGGDGDEDDDG 174 Score = 31.5 bits (68), Expect = 0.80 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = -1 Query: 566 GGXXAXXXXXRGGGGGGXSXPXXGGGGXXXXXXXGGGGG 450 GG GGGGGG GGGG GGGGG Sbjct: 132 GGGGGGGGGGGGGGGGGGG----GGGGGGGGGGGGGGGG 166 >SB_28644| Best HMM Match : zf-CCCH (HMM E-Value=1.5e-05) Length = 267 Score = 37.1 bits (82), Expect = 0.016 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = -2 Query: 565 GGXXXXAXXXGXGGGGGXPPPXXGGGGXXFXXXXGGGGGXXPXGG 431 GG G GGGGG GGGG F GGGGG GG Sbjct: 84 GGGFGGGGGFGGGGGGGF----GGGGGGGFGGGGGGGGGFGGGGG 124 Score = 34.7 bits (76), Expect = 0.085 Identities = 17/44 (38%), Positives = 18/44 (40%) Frame = -1 Query: 533 GGGGGGXSXPXXGGGGXXXXXXXGGGGGXXXPXGGXXXXXKXXP 402 GGG GG GGGG GGGGG GG + P Sbjct: 90 GGGFGGGGGGGFGGGGGGGFGGGGGGGGGFGGGGGGGFGSRARP 133 Score = 33.9 bits (74), Expect = 0.15 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = -2 Query: 565 GGXXXXAXXXGXGGGGGXPPPXXGGGGXXFXXXXGGGGG 449 GG G GGGGG GGGG F GGG G Sbjct: 90 GGGFGGGGGGGFGGGGGGGFGGGGGGGGGFGGGGGGGFG 128 Score = 32.7 bits (71), Expect = 0.34 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = -1 Query: 566 GGXXAXXXXXRGGGGGGXSXPXXGGGGXXXXXXXGGGGG 450 GG GG GGG GGGG GGGGG Sbjct: 88 GGGGGFGGGGGGGFGGGGGGGFGGGGGGGGGFGGGGGGG 126 Score = 32.3 bits (70), Expect = 0.46 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = -2 Query: 547 AXXXGXGGGGGXPPPXXGGGGXXFXXXXGGGGGXXPXGG 431 A G GGG G GGGG F GGG G GG Sbjct: 78 ASVGGRGGGFGGGGGFGGGGGGGFGGGGGGGFGGGGGGG 116 Score = 31.5 bits (68), Expect = 0.80 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = -1 Query: 536 RGGGGGGXSXPXXGGGGXXXXXXXGGGGGXXXPXGG 429 RGGG GG GGGG GG GG GG Sbjct: 83 RGGGFGGGGGFGGGGGGGFGGGGGGGFGGGGGGGGG 118 Score = 31.5 bits (68), Expect = 0.80 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -1 Query: 530 GGGGGXSXPXXGGGGXXXXXXXGGGGGXXXPXGG 429 GGGGG GG G GGGGG GG Sbjct: 88 GGGGGFGGGGGGGFGGGGGGGFGGGGGGGGGFGG 121 Score = 29.5 bits (63), Expect = 3.2 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -3 Query: 567 GGGXXXXXXXKGXGGGGXXXPXXXGGGXXXFXXXXGGG 454 GGG G GGGG GGG F GGG Sbjct: 89 GGGGFGGGGGGGFGGGGGGGFGGGGGGGGGFGGGGGGG 126 >SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 550 Score = 36.7 bits (81), Expect = 0.021 Identities = 23/64 (35%), Positives = 23/64 (35%), Gaps = 2/64 (3%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPP--PPPXPXXXAXX 554 PP GG G PP G PPP PPPP G PP PP P Sbjct: 460 PPPGGMRGMP------PPPMGMYPPPRGFPPPPFGPPPPFYRGPPPPRGMPPPPRQRMPS 513 Query: 555 XXPP 566 PP Sbjct: 514 QGPP 517 Score = 29.9 bits (64), Expect = 2.4 Identities = 15/45 (33%), Positives = 15/45 (33%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP G P PPPP G PPPP PP Sbjct: 441 PPHGMPQGGGPPQLPPNLPPPPGGMRGMPPPPMGMYPPPRGFPPP 485 Score = 29.1 bits (62), Expect = 4.2 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 7/45 (15%) Frame = +3 Query: 453 PPPPXXXXXXSPPPP---XXGGGXP--PP--PPXPXXXAXXXXPP 566 PPPP P PP GGG P PP PP P PP Sbjct: 428 PPPPQHTGPPQPRPPHGMPQGGGPPQLPPNLPPPPGGMRGMPPPP 472 Score = 28.7 bits (61), Expect = 5.6 Identities = 11/27 (40%), Positives = 12/27 (44%) Frame = -3 Query: 360 GXPPPXXGXKXXXXXXPPXKKXPPPPP 280 G PPP G PP + PPPP Sbjct: 481 GFPPPPFGPPPPFYRGPPPPRGMPPPP 507 Score = 27.9 bits (59), Expect = 9.8 Identities = 16/44 (36%), Positives = 17/44 (38%), Gaps = 4/44 (9%) Frame = -1 Query: 464 GGGGGXXXPXGGXXXXXKXXPPPP----PPGGXXXTPXGGXPPP 345 GG G P G + PPPP PP P G PPP Sbjct: 463 GGMRGMPPPPMGMYPPPRGFPPPPFGPPPPFYRGPPPPRGMPPP 506 Score = 27.9 bits (59), Expect = 9.8 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = -3 Query: 360 GXPPPXXGXKXXXXXXPPXKKXPPPPPXGGXGXP 259 G PPP G PP PPPP G P Sbjct: 467 GMPPPPMGMYPPPRGFPPPPFGPPPPFYRGPPPP 500 >SB_58757| Best HMM Match : GRP (HMM E-Value=0.0041) Length = 154 Score = 36.3 bits (80), Expect = 0.028 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = -1 Query: 566 GGXXAXXXXXRGGGGGGXSXPXXGGGGXXXXXXXGGGGGXXXPXGG 429 GG GGGGGG GGGG GG GG GG Sbjct: 65 GGGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGG 110 Score = 34.7 bits (76), Expect = 0.085 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -1 Query: 533 GGGGGGXSXPXXGGGGXXXXXXXGGGGGXXXPXGG 429 GGGGGG GGGG G GGG GG Sbjct: 63 GGGGGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGG 97 Score = 34.7 bits (76), Expect = 0.085 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -1 Query: 533 GGGGGGXSXPXXGGGGXXXXXXXGGGGGXXXPXGG 429 GGGGGG GGGG GGGG GG Sbjct: 64 GGGGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGG 98 Score = 33.5 bits (73), Expect = 0.20 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = -1 Query: 566 GGXXAXXXXXRGGGGGGXSXPXXGGGGXXXXXXXGGGGGXXXPXGG 429 GG GGGGGG GGG GGG G GG Sbjct: 64 GGGGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGG 109 Score = 33.5 bits (73), Expect = 0.20 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = -1 Query: 566 GGXXAXXXXXRGGGGGGXSXPXXGGGGXXXXXXXGGGGGXXXPXGG 429 GG GGGGGG GG G GGGG GG Sbjct: 67 GGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGGGG 112 Score = 33.1 bits (72), Expect = 0.26 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = -1 Query: 566 GGXXAXXXXXRGGGGGGXSXPXXGGGGXXXXXXXGGGGGXXXPXGG 429 GG GGGGGG G G GGGGG GG Sbjct: 62 GGGGGGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGG 107 Score = 33.1 bits (72), Expect = 0.26 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = -1 Query: 566 GGXXAXXXXXRGGGGGGXSXPXXGGGGXXXXXXXGGGGGXXXPXGG 429 GG GGGGGG G GG GGGG GG Sbjct: 63 GGGGGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGG 108 Score = 33.1 bits (72), Expect = 0.26 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = -1 Query: 566 GGXXAXXXXXRGGGGGGXSXPXXGGGGXXXXXXXGGGGGXXXPXGG 429 GG GGGGGG GGG G GGG GG Sbjct: 66 GGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGGG 111 Score = 28.3 bits (60), Expect = 7.4 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = -2 Query: 565 GGXXXXAXXXGXGGGGGXPPPXXGGGGXXFXXXXGGGGG 449 GG G GGGG GGGG GGGGG Sbjct: 76 GGGGGGGGDDGDGGGGDG---GGGGGGGDGGGGGGGGGG 111 Score = 27.9 bits (59), Expect = 9.8 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = -3 Query: 567 GGGXXXXXXXKGXGGGGXXXPXXXGGGXXXFXXXXGGGGXLXPXGG 430 GGG G GGGG GGG GG G GG Sbjct: 64 GGGGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGG 109 Score = 27.9 bits (59), Expect = 9.8 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = -3 Query: 567 GGGXXXXXXXKGXGGGGXXXPXXXGGGXXXFXXXXGGGGXLXPXGG 430 GGG G GGGG GGG G GG GG Sbjct: 65 GGGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGG 110 Score = 27.9 bits (59), Expect = 9.8 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = -3 Query: 567 GGGXXXXXXXKGXGGGGXXXPXXXGGGXXXFXXXXGGGGXLXPXGG 430 GGG G GGGG G G GGGG GG Sbjct: 67 GGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGGGG 112 >SB_52222| Best HMM Match : SAPS (HMM E-Value=2.1e-37) Length = 1063 Score = 35.9 bits (79), Expect = 0.037 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = -1 Query: 566 GGXXAXXXXXRGGGGGGXSXPXXGGGGXXXXXXXGGGGGXXXPXGG 429 GG GGGGGG GGGG G GGG GG Sbjct: 776 GGDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGG 821 Score = 35.9 bits (79), Expect = 0.037 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = -1 Query: 566 GGXXAXXXXXRGGGGGGXSXPXXGGGGXXXXXXXGGGGGXXXPXGG 429 GG GGGGGG G GG GGGGG GG Sbjct: 779 GGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGG 824 Score = 35.5 bits (78), Expect = 0.049 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -1 Query: 566 GGXXAXXXXXRGGGGGGXSXPXXGGGGXXXXXXXGGGG 453 GG A GGGGGG GGGG GGGG Sbjct: 839 GGGYADGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 876 Score = 35.1 bits (77), Expect = 0.065 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -1 Query: 530 GGGGGXSXPXXGGGGXXXXXXXGGGGGXXXPXGG 429 GGGGG GGGG GGGGG GG Sbjct: 769 GGGGGGDGGDGGGGGDGGGGGGGGGGGGGGGGGG 802 Score = 35.1 bits (77), Expect = 0.065 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = -1 Query: 566 GGXXAXXXXXRGGGGGGXSXPXXGGGGXXXXXXXGGGGGXXXPXGG 429 GG GGGGGG GGG GGGGG GG Sbjct: 780 GGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGG 825 Score = 35.1 bits (77), Expect = 0.065 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = -1 Query: 533 GGGGGGXSXPXXGGGGXXXXXXXGGGGG 450 GGGGGG GGGG GGGGG Sbjct: 847 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 874 Score = 35.1 bits (77), Expect = 0.065 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = -1 Query: 533 GGGGGGXSXPXXGGGGXXXXXXXGGGGG 450 GGGGGG GGGG GGGGG Sbjct: 848 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 875 Score = 35.1 bits (77), Expect = 0.065 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = -1 Query: 533 GGGGGGXSXPXXGGGGXXXXXXXGGGGG 450 GGGGGG GGGG GGGGG Sbjct: 849 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 876 Score = 33.5 bits (73), Expect = 0.20 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = -1 Query: 566 GGXXAXXXXXRGGGGGGXSXPXXGGGGXXXXXXXGGGGGXXXPXGG 429 GG GG GGG GGGG GG GG GG Sbjct: 790 GGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGGG 835 Score = 33.5 bits (73), Expect = 0.20 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -2 Query: 535 GXGGGGGXPPPXXGGGGXXFXXXXGGGGGXXPXGG 431 G G GGG GGGG GGGGG GG Sbjct: 835 GFGDGGGYADGDGGGGGGGGGGGGGGGGGGGGGGG 869 Score = 32.7 bits (71), Expect = 0.34 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = -2 Query: 565 GGXXXXAXXXGXGGGGGXPPPXXGGGGXXFXXXXGGGGGXXPXGG 431 GG G GGGGG G G GGGGG GG Sbjct: 785 GGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGG 829 Score = 32.7 bits (71), Expect = 0.34 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = -1 Query: 566 GGXXAXXXXXRGGGGGGXSXPXXGGGGXXXXXXXGGGGGXXXPXGG 429 GG GGG GG GGGG GGG G GG Sbjct: 789 GGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGG 834 Score = 32.7 bits (71), Expect = 0.34 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = -1 Query: 566 GGXXAXXXXXRGGGGGGXSXPXXGGGGXXXXXXXGGGGG 450 GG G GGGG GGGG GGGGG Sbjct: 834 GGFGDGGGYADGDGGGGGGGGGGGGGGGGGGGGGGGGGG 872 Score = 32.7 bits (71), Expect = 0.34 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = -1 Query: 530 GGGGGXSXPXXGGGGXXXXXXXGGGGGXXXPXGG 429 G GGG + GGGG GGGGG GG Sbjct: 837 GDGGGYADGDGGGGGGGGGGGGGGGGGGGGGGGG 870 Score = 32.3 bits (70), Expect = 0.46 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = -1 Query: 566 GGXXAXXXXXRGGGGGGXSXPXXGGGGXXXXXXXGGGGGXXXPXGG 429 GG GGG GG GGGG GGG G GG Sbjct: 770 GGGGGDGGDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGG 815 Score = 31.9 bits (69), Expect = 0.60 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -1 Query: 533 GGGGGGXSXPXXGGGGXXXXXXXGGGGGXXXPXGG 429 GGGGGG GGG G GGG GG Sbjct: 814 GGGGGGGGGGGGDGGGYGDGGGFGDGGGYADGDGG 848 Score = 31.9 bits (69), Expect = 0.60 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = -1 Query: 566 GGXXAXXXXXRGGGGGGXSXPXXGGGGXXXXXXXGGGGGXXXPXGG 429 GG G G GG GGGG GGGGG GG Sbjct: 824 GGDGGGYGDGGGFGDGGGYADGDGGGGGGGGGGGGGGGGGGGGGGG 869 Score = 31.9 bits (69), Expect = 0.60 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = -2 Query: 565 GGXXXXAXXXGXGGGGGXPPPXXGGGGXXFXXXXGGGGGXXPXGG 431 GG G GGG GGGG GGGGG GG Sbjct: 827 GGGYGDGGGFGDGGGYADGDGGGGGGGGGGGGGGGGGGGGGGGGG 871 Score = 31.9 bits (69), Expect = 0.60 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = -2 Query: 535 GXGGGGGXPPPXXGGGGXXFXXXXGGGGGXXPXGG 431 G GGGGG GGGG GGGGG GG Sbjct: 845 GDGGGGGG---GGGGGGGGGGGGGGGGGGGGGGGG 876 Score = 31.5 bits (68), Expect = 0.80 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -1 Query: 533 GGGGGGXSXPXXGGGGXXXXXXXGGGGGXXXPXGG 429 G GGG GGGG GGGGG GG Sbjct: 837 GDGGGYADGDGGGGGGGGGGGGGGGGGGGGGGGGG 871 Score = 31.1 bits (67), Expect = 1.1 Identities = 16/45 (35%), Positives = 17/45 (37%) Frame = -2 Query: 565 GGXXXXAXXXGXGGGGGXPPPXXGGGGXXFXXXXGGGGGXXPXGG 431 GG G G GGG G G + GGGGG GG Sbjct: 813 GGGGGGGGGGGGGDGGGYGDGGGFGDGGGYADGDGGGGGGGGGGG 857 Score = 31.1 bits (67), Expect = 1.1 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = -2 Query: 565 GGXXXXAXXXGXGGGGGXPPPXXGGGGXXFXXXXGGGGGXXPXGG 431 GG G GGG G GGG GGGGG GG Sbjct: 815 GGGGGGGGGGGDGGGYGDGGGFGDGGGYADGDGGGGGGGGGGGGG 859 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = -3 Query: 567 GGGXXXXXXXKGXGGGGXXXPXXXGGGXXXFXXXXGGGGXLXPXGG 430 GGG G GGGG GGG GGGG GG Sbjct: 780 GGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGG 825 Score = 29.9 bits (64), Expect = 2.4 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = -1 Query: 566 GGXXAXXXXXRGGGGGGXSXPXXGGGGXXXXXXXGGGGGXXXPXGG 429 GG GG G G GGG GGGGG GG Sbjct: 823 GGGDGGGYGDGGGFGDGGGYADGDGGGGGGGGGGGGGGGGGGGGGG 868 Score = 29.5 bits (63), Expect = 3.2 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = -1 Query: 566 GGXXAXXXXXRGGGGGGXSXPXXGGGGXXXXXXXGGGGGXXXPXGG 429 GG G GGGG GGGG G G G GG Sbjct: 772 GGGDGGDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGG 817 Score = 29.5 bits (63), Expect = 3.2 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = -1 Query: 566 GGXXAXXXXXRGGGGGGXSXPXXGGGGXXXXXXXGGGGGXXXPXGG 429 GG G GGG G GG GGGGG GG Sbjct: 814 GGGGGGGGGGGGDGGGYGDGGGFGDGGGYADGDGGGGGGGGGGGGG 859 Score = 29.1 bits (62), Expect = 4.2 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -1 Query: 566 GGXXAXXXXXRGGGGGGXSXPXXGGGGXXXXXXXGGGGG 450 GG G GGGG GGGG GGG G Sbjct: 799 GGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGGGFG 837 Score = 28.7 bits (61), Expect = 5.6 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = -1 Query: 566 GGXXAXXXXXRGGGGGGXSXPXXGGGGXXXXXXXGGGGGXXXPXGG 429 GG GG GGG GGGG GG G GG Sbjct: 771 GGGGDGGDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGG 816 Score = 28.3 bits (60), Expect = 7.4 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -2 Query: 547 AXXXGXGGGGGXPPPXXGGGGXXFXXXXGGGGGXXPXG 434 A G GGGG GG G GGGGG G Sbjct: 765 AVVVGGGGGGDGGDGGGGGDGGGGGGGGGGGGGGGGGG 802 Score = 28.3 bits (60), Expect = 7.4 Identities = 18/51 (35%), Positives = 18/51 (35%), Gaps = 5/51 (9%) Frame = -1 Query: 566 GGXXAXXXXXRGGGGGGXSXPXXGGG-----GXXXXXXXGGGGGXXXPXGG 429 GG GGGGG GGG G GGGGG GG Sbjct: 773 GGDGGDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGG 823 Score = 28.3 bits (60), Expect = 7.4 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = -1 Query: 566 GGXXAXXXXXRGGGGGGXSXPXXGGGGXXXXXXXGGGGGXXXPXGG 429 GG GGG G G GG GGGGG GG Sbjct: 822 GGGGDGGGYGDGGGFGDGGGYADGDGGGGGGGGGGGGGGGGGGGGG 867 Score = 27.9 bits (59), Expect = 9.8 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = -1 Query: 566 GGXXAXXXXXRGGGGGGXSXPXXGGGGXXXXXXXGGGGGXXXPXGG 429 GG GGG G GGG GGGGG GG Sbjct: 816 GGGGGGGGGGDGGGYGDGGGFGDGGGYADGDGGGGGGGGGGGGGGG 861 >SB_9896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 35.9 bits (79), Expect = 0.037 Identities = 15/31 (48%), Positives = 16/31 (51%), Gaps = 2/31 (6%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGG--GXPPPPPXP 536 PP PP +PP P GG PPPPP P Sbjct: 178 PPAPPPPGAPAAPPAPPFGGPPSAPPPPPAP 208 Score = 34.3 bits (75), Expect = 0.11 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPP 534 P PPP P PP G PPPPP Sbjct: 179 PAPPPPGAPAAPPAPPFGGPPSAPPPPP 206 Score = 32.7 bits (71), Expect = 0.34 Identities = 15/45 (33%), Positives = 15/45 (33%) Frame = +1 Query: 433 PXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 P PP P P PP G PP PP A PP Sbjct: 161 PPQPPAPPAAPFMAPAAPPAPPPPGAPAAPPAPPFGGPPSAPPPP 205 Score = 30.7 bits (66), Expect = 1.4 Identities = 16/52 (30%), Positives = 17/52 (32%), Gaps = 1/52 (1%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSP-PPPXXGGGXPPPPPXPXXXAXXXXPPXXXXXG 584 PP PP P P PPP PP PP + PP G Sbjct: 161 PPQPPAPPAAPFMAPAAPPAPPPPGAPAAPPAPPFGGPPSAPPPPPAPPVGG 212 >SB_47508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2143 Score = 35.5 bits (78), Expect = 0.049 Identities = 15/29 (51%), Positives = 16/29 (55%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPPL 537 PPPPP PPPP PPPPPP+ Sbjct: 82 PPPPP-------PPPPASNVPAPPPPPPV 103 Score = 33.1 bits (72), Expect = 0.26 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPPL 537 PPPPP PPPP PP PL Sbjct: 584 PPPPPQMNNTSAPPPPNKEKQTAKPPAPL 612 Score = 29.5 bits (63), Expect = 3.2 Identities = 13/30 (43%), Positives = 14/30 (46%), Gaps = 1/30 (3%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPP-XXGGGXPPPPPXP 536 PPPPP +PPPP PP P P Sbjct: 584 PPPPPQMNNTSAPPPPNKEKQTAKPPAPLP 613 >SB_7731| Best HMM Match : Extensin_2 (HMM E-Value=1.2) Length = 352 Score = 34.7 bits (76), Expect = 0.085 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 PP PPP P PPPP G PPPP P Sbjct: 183 PPGVLAPPPAPPGVL---PPPPAPPGALIPPPPAP 214 Score = 32.3 bits (70), Expect = 0.46 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +1 Query: 457 PPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PPP PPP G PPP PP PP Sbjct: 179 PPPAPPGVLAPPPAPPGVLPPPPAPPGALIPPPPAPP 215 Score = 29.1 bits (62), Expect = 4.2 Identities = 13/37 (35%), Positives = 14/37 (37%) Frame = +3 Query: 456 PPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PPP +PPP G PPP P PP Sbjct: 179 PPPAPPGVLAPPPAPPGVLPPPPAPPGALIPPPPAPP 215 >SB_38313| Best HMM Match : XYPPX (HMM E-Value=0.069) Length = 135 Score = 34.3 bits (75), Expect = 0.11 Identities = 21/55 (38%), Positives = 21/55 (38%), Gaps = 5/55 (9%) Frame = +3 Query: 381 PPRGGG-----GGXXFXXXGXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPP 530 PP GG GG PP G PPP P PPPP G PPP Sbjct: 31 PPAPGGYPPAPGGYPPSGGYGYPPAGGYPPPQP--GYAGGPPPPGIAPGIGGPPP 83 Score = 30.7 bits (66), Expect = 1.4 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 4/45 (8%) Frame = -1 Query: 458 GGGXXXPXGGXXXXXKXXPPPP----PPGGXXXTPXGGXPPPXXG 336 GG GG PP P P GG P GG PPP G Sbjct: 20 GGYPPAAPGGYPPAPGGYPPAPGGYPPSGGYGYPPAGGYPPPQPG 64 Score = 30.3 bits (65), Expect = 1.8 Identities = 15/48 (31%), Positives = 16/48 (33%) Frame = +3 Query: 423 GXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 G PP G PP P G PPPP P + PP Sbjct: 79 GGPPPSGQYGAPPTSQPYGAPPTSGYPGYQQHPPPPQPSAQSYNAPPP 126 Score = 29.9 bits (64), Expect = 2.4 Identities = 20/54 (37%), Positives = 21/54 (38%), Gaps = 7/54 (12%) Frame = +3 Query: 381 PPRGGG----GGXXFXXXGXXPPX--GXX-PPPPPXXXXXXSPPPPXXGGGXPP 521 PP GG GG + G PP G PPPP PPP G PP Sbjct: 38 PPAPGGYPPSGGYGYPPAGGYPPPQPGYAGGPPPPGIAPGIGGPPPSGQYGAPP 91 Score = 29.1 bits (62), Expect = 4.2 Identities = 20/57 (35%), Positives = 20/57 (35%), Gaps = 5/57 (8%) Frame = +3 Query: 381 PPRGGGG-----GXXFXXXGXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 PP GG G G PP G PP PP P GG PPP P Sbjct: 23 PPAAPGGYPPAPGGYPPAPGGYPPSGGYGYPPAGGYP---PPQPGYAGGPPPPGIAP 76 >SB_22158| Best HMM Match : Lipoprotein_15 (HMM E-Value=8.4) Length = 184 Score = 34.3 bits (75), Expect = 0.11 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 441 GXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 G PPPPP P P G PPPP P Sbjct: 119 GYVPPPPPTGTLPPPPVTPPPGPETPPPPDTP 150 Score = 33.9 bits (74), Expect = 0.15 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP G PPPP PPP P PP P A PP Sbjct: 125 PPTGTLPPPPVTPPPGPETPPPP----DTPAPPVPPTEAPPTAPP 165 Score = 32.7 bits (71), Expect = 0.34 Identities = 16/44 (36%), Positives = 16/44 (36%), Gaps = 1/44 (2%) Frame = +1 Query: 439 GXXXPPPPPXXXKXXXPPPPXXGXXXPPPP-PPLXXXXXAXXPP 567 G PPPPP P P G PPPP P PP Sbjct: 118 GGYVPPPPPTGTLPPPPVTPPPGPETPPPPDTPAPPVPPTEAPP 161 Score = 27.9 bits (59), Expect = 9.8 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPP 528 PP PPPP PPP P PP Sbjct: 124 PPPTGTLPPPPVTPPPGPETPPPPDTPAPPVPP 156 >SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 34.3 bits (75), Expect = 0.11 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPPL 537 P PP PPPP PPPPPP+ Sbjct: 93 PACPPACCAPPPPPPPPPPPPPPPPPPPI 121 Score = 32.7 bits (71), Expect = 0.34 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 PP PPPPP PPPP PPPPP P Sbjct: 96 PPACCAPPPPP-----PPPPPP-----PPPPPPPP 120 Score = 31.5 bits (68), Expect = 0.80 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +3 Query: 435 PXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPP 530 P P PP PPPP PPPPP Sbjct: 88 PTSCAPACPPACCAPPPPPPPPPPPPPPPPPP 119 Score = 29.5 bits (63), Expect = 3.2 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPP 534 PP PPPPP PPPPPP Sbjct: 109 PPPPPPPPPPPPITLHHEQHVVSHVMHPAPPPPPP 143 >SB_46162| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 291 Score = 34.3 bits (75), Expect = 0.11 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = -1 Query: 566 GGXXAXXXXXRGGGGGGXSXPXXGGGGXXXXXXXGGGGGXXXPXGG 429 GG RGGGGG GGGG GGGG GG Sbjct: 92 GGGGRRERGGRGGGGGYGGGGGYGGGGRSYGGGGGGGGFYQDSYGG 137 Score = 33.1 bits (72), Expect = 0.26 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = -1 Query: 533 GGGGGGXSXPXXGGGGXXXXXXXGGGGG 450 G GGGG S GGGG GGGGG Sbjct: 113 GYGGGGRSYGGGGGGGGFYQDSYGGGGG 140 Score = 31.1 bits (67), Expect = 1.1 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = -2 Query: 565 GGXXXXAXXXGXGGGGGXPPPXXGGGGXXFXXXXGGGGG 449 GG G GGGG GGGG GGGGG Sbjct: 103 GGGGGYGGGGGYGGGGRSYGGGGGGGGFYQDSYGGGGGG 141 Score = 29.5 bits (63), Expect = 3.2 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -1 Query: 536 RGGGGGGXSXPXXGGGGXXXXXXXGGGGGXXXPXGG 429 RGGGG GGGG GGGG GG Sbjct: 91 RGGGGRRERGGRGGGGGYGGGGGYGGGGRSYGGGGG 126 >SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2870 Score = 33.9 bits (74), Expect = 0.15 Identities = 18/46 (39%), Positives = 19/46 (41%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPP P PPPP PPPPPP+ PP Sbjct: 952 PPPTSALPPPIPATQ---VPPPPLP--PLPPPPPPVQTTTAPTLPP 992 Score = 32.7 bits (71), Expect = 0.34 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPPL 537 P PPP PPPP PPPPPP+ Sbjct: 906 PAPPPPLPLAPEPPPPL-----PPPPPPI 929 Score = 31.5 bits (68), Expect = 0.80 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +1 Query: 433 PXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPL 537 P PP P K P PP P PPPPL Sbjct: 888 PKTTTAPPTTPTTPKPTTPAPPPPLPLAPEPPPPL 922 >SB_27885| Best HMM Match : Cytadhesin_P30 (HMM E-Value=0.051) Length = 421 Score = 33.9 bits (74), Expect = 0.15 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +3 Query: 423 GXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPP 521 G PP G P PP +PPP GG PP Sbjct: 234 GYAPPPGGYPGAPPAGGYPGAPPPGGYPGGPPP 266 Score = 31.1 bits (67), Expect = 1.1 Identities = 16/35 (45%), Positives = 17/35 (48%), Gaps = 2/35 (5%) Frame = +3 Query: 423 GXXPPXGXXPPPPPXXXXXXSPPP--PXXGGGXPP 521 G PP G PPP +PPP P GGG PP Sbjct: 188 GYYPPPGGYQQPPP---GGYAPPPYVPQEGGGIPP 219 Score = 29.9 bits (64), Expect = 2.4 Identities = 24/69 (34%), Positives = 24/69 (34%), Gaps = 7/69 (10%) Frame = -1 Query: 521 GGXSXPXXGGGGXXXXXXXGGGGGXXXPXGGXXXXXKXXPPP----PPPGGXXXT-PXGG 357 GG P GG GGG P PPP PPPGG P GG Sbjct: 194 GGYQQPPPGGYAPPPYVPQEGGG---IPPQNHPLTNYPAPPPQGYAPPPGGYPGAPPAGG 250 Query: 356 XP--PPXXG 336 P PP G Sbjct: 251 YPGAPPPGG 259 Score = 27.9 bits (59), Expect = 9.8 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = -1 Query: 395 PPPGGXXXTPXGGXPPP 345 PPPGG P GG PP Sbjct: 191 PPPGGYQQPPPGGYAPP 207 >SB_37033| Best HMM Match : Annexin (HMM E-Value=0) Length = 287 Score = 33.5 bits (73), Expect = 0.20 Identities = 22/56 (39%), Positives = 23/56 (41%), Gaps = 4/56 (7%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXXPP----PPPXXXXXXSPPPPXXGGGXPPPPPXP 536 PP GG G + G P G PP PPP PP P GG P P P P Sbjct: 5 PPPGGYGMYGY---GGMPRPGAPPPMPQQPPPLGFDAMGPPQP---GGMPMPMPGP 54 >SB_18024| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 831 Score = 33.5 bits (73), Expect = 0.20 Identities = 16/32 (50%), Positives = 16/32 (50%), Gaps = 4/32 (12%) Frame = +1 Query: 451 PPPPPXXXKXXXPP--PPXXG--XXXPPPPPP 534 PPPPP PP PP G PPPPPP Sbjct: 52 PPPPPRFYDNDIPPPPPPRRGFYDDYPPPPPP 83 Score = 33.5 bits (73), Expect = 0.20 Identities = 15/32 (46%), Positives = 15/32 (46%), Gaps = 3/32 (9%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGG---GXPPPPPXP 536 PPPP PPPP G PPPPP P Sbjct: 53 PPPPRFYDNDIPPPPPPRRGFYDDYPPPPPPP 84 Score = 30.7 bits (66), Expect = 1.4 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +2 Query: 434 PXGXXXPPPPXXXXKXXXPPPXXXGXXXPPPPXPXXXXXXXXPPP 568 P PPPP PPP PPPP P PPP Sbjct: 44 PRDRERPPPP--------PPPRFYDNDIPPPPPPRRGFYDDYPPP 80 Score = 27.9 bits (59), Expect = 9.8 Identities = 15/47 (31%), Positives = 16/47 (34%), Gaps = 2/47 (4%) Frame = +3 Query: 450 PPPPPXXXXXXS--PPPPXXGGGXPPPPPXPXXXAXXXXPPXXXXXG 584 PPPPP + P PPPPP P PP G Sbjct: 26 PPPPPTRPFERNIHPRTEPRDRERPPPPPPPRFYDNDIPPPPPPRRG 72 Score = 27.9 bits (59), Expect = 9.8 Identities = 14/41 (34%), Positives = 15/41 (36%), Gaps = 2/41 (4%) Frame = +1 Query: 451 PPPPPXXXKXXXPP--PPXXGXXXPPPPPPLXXXXXAXXPP 567 PPPP + P P PPPPPP PP Sbjct: 27 PPPPTRPFERNIHPRTEPRDRERPPPPPPPRFYDNDIPPPP 67 Score = 27.9 bits (59), Expect = 9.8 Identities = 12/39 (30%), Positives = 13/39 (33%) Frame = +2 Query: 452 PPPPXXXXKXXXPPPXXXGXXXPPPPXPXXXXXXXXPPP 568 PPP + P PPPP P PPP Sbjct: 28 PPPTRPFERNIHPRTEPRDRERPPPPPPPRFYDNDIPPP 66 >SB_14625| Best HMM Match : Cytadhesin_P30 (HMM E-Value=0.056) Length = 245 Score = 33.5 bits (73), Expect = 0.20 Identities = 21/63 (33%), Positives = 22/63 (34%) Frame = +1 Query: 349 GGXPPXGVXSXXXXXXXXXXFXXXXXXPPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPP 528 GG PP GV PP G PPP PPPP G P P Sbjct: 186 GGYPPAGVGQHSGPYPGQPGMWGP---PPMGG--PPPMGGPPGGYPPPPPPPGAGDPAYP 240 Query: 529 PPL 537 PP+ Sbjct: 241 PPV 243 Score = 33.1 bits (72), Expect = 0.26 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPP 530 PP PPP PPPP G G P PP Sbjct: 209 PPPMGGPPPMGGPPGGYPPPPPPPGAGDPAYPP 241 Score = 31.9 bits (69), Expect = 0.60 Identities = 14/28 (50%), Positives = 14/28 (50%), Gaps = 2/28 (7%) Frame = +3 Query: 489 PPPXXG--GGXPPPPPXPXXXAXXXXPP 566 PPP G GG PPPPP P PP Sbjct: 215 PPPMGGPPGGYPPPPPPPGAGDPAYPPP 242 Score = 30.3 bits (65), Expect = 1.8 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPP 530 PP G PP PPPP G PPP Sbjct: 210 PPMGGPPPMGGPPGGYPPPPPPPGAGDPAYPPP 242 Score = 29.9 bits (64), Expect = 2.4 Identities = 21/64 (32%), Positives = 22/64 (34%), Gaps = 8/64 (12%) Frame = +3 Query: 399 GGXXFXXXGXXPPXGXXPP--PPPXXXXXXSPPP---PXXGGGXP---PPPPXPXXXAXX 554 G + G PP G P P PPP P GG P PPPP P Sbjct: 178 GQEPYPEKGGYPPAGVGQHSGPYPGQPGMWGPPPMGGPPPMGGPPGGYPPPPPPPGAGDP 237 Query: 555 XXPP 566 PP Sbjct: 238 AYPP 241 Score = 28.7 bits (61), Expect = 5.6 Identities = 18/48 (37%), Positives = 18/48 (37%) Frame = -1 Query: 527 GGGGXSXPXXGGGGXXXXXXXGGGGGXXXPXGGXXXXXKXXPPPPPPG 384 G G S P G G GG P GG PPPPPPG Sbjct: 192 GVGQHSGPYPGQPGMWGPPPMGGPPPMGGPPGGYP------PPPPPPG 233 Score = 27.9 bits (59), Expect = 9.8 Identities = 13/28 (46%), Positives = 13/28 (46%), Gaps = 2/28 (7%) Frame = +1 Query: 490 PPPXXGXXX--PPPPPPLXXXXXAXXPP 567 PPP G PPPPPP A PP Sbjct: 215 PPPMGGPPGGYPPPPPPPGAGDPAYPPP 242 >SB_4337| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 423 Score = 33.5 bits (73), Expect = 0.20 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPP 521 PP G G G PP G PP PPP G G PP Sbjct: 262 PPGQQGYGPPLGQQGYGPPPGQQGYGPPPGQQGYGPPPGQQGYGSPP 308 Score = 31.9 bits (69), Expect = 0.60 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPP 521 PP G G G PP G PP PPP G G PP Sbjct: 253 PPGQQGYGAPPGQQGYGPPLGQQGYGPPPGQQGYGPPPGQQGYGPPP 299 Score = 28.7 bits (61), Expect = 5.6 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPP 521 PP G G G P G PP PPP G G PP Sbjct: 244 PPGQQGYGPPPGQQGYGAPPGQQGYGPPLGQQGYGPPPGQQGYGPPP 290 Score = 27.9 bits (59), Expect = 9.8 Identities = 17/48 (35%), Positives = 17/48 (35%), Gaps = 1/48 (2%) Frame = +3 Query: 381 PPRGGGG-GXXFXXXGXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPP 521 PP G G G G PP G PP PP G G PP Sbjct: 270 PPLGQQGYGPPPGQQGYGPPPGQQGYGPPPGQQGYGSPPGQQGYGPPP 317 >SB_44584| Best HMM Match : DEAD_2 (HMM E-Value=0.12) Length = 540 Score = 33.1 bits (72), Expect = 0.26 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -1 Query: 527 GGGGXSXPXXGGGGXXXXXXXGGGGGXXXPXGG 429 GGGG GGGG GGGGG GG Sbjct: 80 GGGGCGGGGGGGGGVGGGGGGGGGGGDDCEDGG 112 Score = 32.3 bits (70), Expect = 0.46 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = -1 Query: 566 GGXXAXXXXXRGGGGGGXSXPXXGGGGXXXXXXXGGGGGXXXPXGG 429 GG GGGGGG GGGG GGG GG Sbjct: 75 GGDTDGGGGCGGGGGGGGGVGGGGGGGGGGGDDCEDGGGDDGEDGG 120 >SB_37501| Best HMM Match : SCP (HMM E-Value=1.2e-19) Length = 351 Score = 33.1 bits (72), Expect = 0.26 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 529 GGGGGXPPPXXGGGGXXFXXXXGGGGGXXPXG 434 GGGGG P GGGG GGGG G Sbjct: 18 GGGGGSPTEAPGGGGGSPTEAPGGGGSTPTKG 49 Score = 28.7 bits (61), Expect = 5.6 Identities = 12/26 (46%), Positives = 13/26 (50%) Frame = -1 Query: 533 GGGGGGXSXPXXGGGGXXXXXXXGGG 456 GGGGG + GGGG GGG Sbjct: 18 GGGGGSPTEAPGGGGGSPTEAPGGGG 43 Score = 27.9 bits (59), Expect = 9.8 Identities = 17/47 (36%), Positives = 18/47 (38%), Gaps = 4/47 (8%) Frame = -2 Query: 508 PPXXGGGGXXFXXXXGGGGGXXP----XGGXXPXFXKXXPPPPPRGG 380 P GGGG GGGGG GG P + P P GG Sbjct: 14 PQAPGGGGGSPTEAPGGGGGSPTEAPGGGGSTPTKGEGSTSPTPGGG 60 >SB_28396| Best HMM Match : RRM_1 (HMM E-Value=0.00035) Length = 258 Score = 33.1 bits (72), Expect = 0.26 Identities = 17/45 (37%), Positives = 18/45 (40%) Frame = -2 Query: 565 GGXXXXAXXXGXGGGGGXPPPXXGGGGXXFXXXXGGGGGXXPXGG 431 GG G GGGG GGGG + GGGG GG Sbjct: 174 GGYGGGGYGGGGHGGGGYGGGGYGGGGGGYGGSGYGGGGGYGGGG 218 Score = 32.3 bits (70), Expect = 0.46 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = -1 Query: 536 RGGGGGGXSXPXXGGGGXXXXXXXGGGGGXXXPXGG 429 RG GGGG GGGG GGG G GG Sbjct: 164 RGRGGGGYGGGGYGGGGYGGGGHGGGGYGGGGYGGG 199 Score = 31.1 bits (67), Expect = 1.1 Identities = 20/50 (40%), Positives = 20/50 (40%), Gaps = 4/50 (8%) Frame = -1 Query: 566 GGXXAXXXXXRGGG---GGGXSXPXXGGGGXXXXXXXGGG-GGXXXPXGG 429 GG RGGG GGG GGGG GGG GG GG Sbjct: 156 GGGGGYRGRGRGGGGYGGGGYGGGGYGGGGHGGGGYGGGGYGGGGGGYGG 205 Score = 30.7 bits (66), Expect = 1.4 Identities = 19/50 (38%), Positives = 19/50 (38%), Gaps = 4/50 (8%) Frame = -1 Query: 566 GGXXAXXXXXRGGGGG----GXSXPXXGGGGXXXXXXXGGGGGXXXPXGG 429 GG RGGGGG G GGGG GGG G GG Sbjct: 145 GGGYRGGGGYRGGGGGYRGRGRGGGGYGGGGYGGGGYGGGGHGGGGYGGG 194 Score = 30.7 bits (66), Expect = 1.4 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -1 Query: 533 GGGGGGXSXPXXGGGGXXXXXXXGGG 456 GGGGGG GGGG GGG Sbjct: 197 GGGGGGYGGSGYGGGGGYGGGGYGGG 222 Score = 29.9 bits (64), Expect = 2.4 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -1 Query: 533 GGGGGGXSXPXXGGGGXXXXXXXGGGGGXXXPXGG 429 GGGG G GGGG GGGG GG Sbjct: 187 GGGGYGGGGYGGGGGGYGGSGYGGGGGYGGGGYGG 221 Score = 29.5 bits (63), Expect = 3.2 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 1/36 (2%) Frame = -1 Query: 533 GGGGGGXSXPXXGGGGXXXXXXXGGGGGX-XXPXGG 429 G GGGG GGGG GGGGG GG Sbjct: 175 GYGGGGYGGGGHGGGGYGGGGYGGGGGGYGGSGYGG 210 Score = 29.1 bits (62), Expect = 4.2 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 2/37 (5%) Frame = -1 Query: 533 GGG--GGGXSXPXXGGGGXXXXXXXGGGGGXXXPXGG 429 GGG GGG GGGG GGGG GG Sbjct: 124 GGGRRGGGYGGGRGGGGGYRSGGGYRGGGGYRGGGGG 160 Score = 28.7 bits (61), Expect = 5.6 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = -1 Query: 566 GGXXAXXXXXRGGGGGGXSXPXXGGGGXXXXXXXGGGGGXXXPXGG 429 GG R GGG GGGG GGGG GG Sbjct: 133 GGGRGGGGGYRSGGGYRGGGGYRGGGGGYRGRGRGGGGYGGGGYGG 178 Score = 28.3 bits (60), Expect = 7.4 Identities = 16/40 (40%), Positives = 16/40 (40%), Gaps = 1/40 (2%) Frame = -1 Query: 566 GGXXAXXXXXRGG-GGGGXSXPXXGGGGXXXXXXXGGGGG 450 GG GG GGGG GGGG GGGG Sbjct: 173 GGGYGGGGYGGGGHGGGGYGGGGYGGGGGGYGGSGYGGGG 212 Score = 27.9 bits (59), Expect = 9.8 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = -1 Query: 566 GGXXAXXXXXRGGGGGGXSXPXXGGGGXXXXXXXGGGGGXXXPXGG 429 GG GGG G GGGG GGG G GG Sbjct: 134 GGRGGGGGYRSGGGYRGGGGYRGGGGGYRGRGRGGGGYGGGGYGGG 179 Score = 27.9 bits (59), Expect = 9.8 Identities = 17/45 (37%), Positives = 18/45 (40%) Frame = -2 Query: 565 GGXXXXAXXXGXGGGGGXPPPXXGGGGXXFXXXXGGGGGXXPXGG 431 GG G GGGG GGGG + GG GG GG Sbjct: 169 GGYGGGGYGGGGYGGGGHGGGGYGGGG--YGGGGGGYGGSGYGGG 211 Score = 27.9 bits (59), Expect = 9.8 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -1 Query: 533 GGGGGGXSXPXXGGGGXXXXXXXGGGGGXXXPXGG 429 GGGG G GG G GGGG GG Sbjct: 192 GGGGYGGGGGGYGGSGYGGGGGYGGGGYGGGRSGG 226 >SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1066 Score = 32.7 bits (71), Expect = 0.34 Identities = 12/26 (46%), Positives = 13/26 (50%) Frame = +1 Query: 457 PPPXXXKXXXPPPPXXGXXXPPPPPP 534 P P + PPPP PPPPPP Sbjct: 860 PRPRPRRPPPPPPPPPPPPPPPPPPP 885 Score = 31.5 bits (68), Expect = 0.80 Identities = 21/59 (35%), Positives = 22/59 (37%) Frame = +3 Query: 387 RGGGGGXXFXXXGXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXP 563 RG G G P PPPPP PPPP PPPPP P + P Sbjct: 848 RGRGRGRSRYRRPRPRPRRPPPPPPP-------PPPP------PPPPPPPPASSTGSTP 893 Score = 28.7 bits (61), Expect = 5.6 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = -1 Query: 404 PPPPPPGGXXXTPXGGXPPPXXGXK 330 PPPPPP + GG P G K Sbjct: 880 PPPPPPASSTGSTPGGDKVPSVGPK 904 >SB_40573| Best HMM Match : RRM_1 (HMM E-Value=1.8e-39) Length = 507 Score = 32.7 bits (71), Expect = 0.34 Identities = 24/63 (38%), Positives = 25/63 (39%) Frame = -1 Query: 536 RGGGGGGXSXPXXGGGGXXXXXXXGGGGGXXXPXGGXXXXXKXXPPPPPPGGXXXTPXGG 357 RGGGGGG GGGG GGGGG GG + PPP G Sbjct: 341 RGGGGGG-----GGGGG------GGGGGGGRGGGGGFSSRGRG---PPPRRSDFRVQVSG 386 Query: 356 XPP 348 PP Sbjct: 387 LPP 389 Score = 31.1 bits (67), Expect = 1.1 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -2 Query: 535 GXGGGGGXPPPXXGGGGXXFXXXXGGGGGXXPXGGXXP 422 G GGGGG GGGG GGGGG G P Sbjct: 340 GRGGGGGG---GGGGGGGGGGGGRGGGGGFSSRGRGPP 374 Score = 29.9 bits (64), Expect = 2.4 Identities = 21/50 (42%), Positives = 21/50 (42%) Frame = -2 Query: 535 GXGGGGGXPPPXXGGGGXXFXXXXGGGGGXXPXGGXXPXFXKXXPPPPPR 386 G G GGG GGGG GGGGG GG F PPPR Sbjct: 338 GSGRGGGGGGGGGGGGG-------GGGGGRGGGGG----FSSRGRGPPPR 376 >SB_45152| Best HMM Match : DUF320 (HMM E-Value=2.9) Length = 293 Score = 32.3 bits (70), Expect = 0.46 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -1 Query: 533 GGGGGGXSXPXXGGGGXXXXXXXGGGGG 450 GGGGGG GG G GGGGG Sbjct: 238 GGGGGGGGGYSGGGSGNPHYYACGGGGG 265 Score = 31.5 bits (68), Expect = 0.80 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 1/45 (2%) Frame = -2 Query: 565 GGXXXXAXXXGXGGGGGXPPPXXGGG-GXXFXXXXGGGGGXXPXG 434 GG G GGGGG GGG G GGGGG G Sbjct: 226 GGFGGGGGVWGNGGGGGGGGGYSGGGSGNPHYYACGGGGGSYNSG 270 Score = 30.3 bits (65), Expect = 1.8 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 4/49 (8%) Frame = -2 Query: 565 GGXXXXAXXXGXGGG----GGXPPPXXGGGGXXFXXXXGGGGGXXPXGG 431 GG A G GG G P GGGG GGGGG GG Sbjct: 203 GGEGGKAFLNGGVGGRSVWNGVPGGFGGGGGVWGNGGGGGGGGGYSGGG 251 >SB_41910| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1486 Score = 32.3 bits (70), Expect = 0.46 Identities = 19/54 (35%), Positives = 19/54 (35%), Gaps = 8/54 (14%) Frame = +1 Query: 430 PPXGXXX---PPPPPXXXKXXXP-----PPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP G PPPPP P PPP G PP PP PP Sbjct: 1225 PPMGHHMMNMPPPPPAMPPDGPPKFMGLPPPPPGMRPMPPQPPFMPPPPRMQPP 1278 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 PP G P PP PPPP PP PP P Sbjct: 1255 PPPGMRPMPP---QPPFMPPPPRMQPPGPPGPPGP 1286 Score = 29.1 bits (62), Expect = 4.2 Identities = 14/36 (38%), Positives = 15/36 (41%), Gaps = 3/36 (8%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGG---GXPPPPP 530 PP PPP +P PP G PPPPP Sbjct: 1204 PPTTAIPPPMTNTMTHSAPRPPPMGHHMMNMPPPPP 1239 >SB_37008| Best HMM Match : MAM (HMM E-Value=1.3999e-42) Length = 382 Score = 32.3 bits (70), Expect = 0.46 Identities = 16/47 (34%), Positives = 18/47 (38%), Gaps = 2/47 (4%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPP--PPXPXXXAXXXXPP 566 PP PP PP +PP P P P PP P + PP Sbjct: 309 PPNPHIPPAPPNPYIPTAPPNPSIPPAPPNPSIPPAPPNPSIPPAPP 355 Score = 29.9 bits (64), Expect = 2.4 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 PP PP PP +PP P PP PP P Sbjct: 291 PPNPYIPPAPPNLFIPSAPPNPH----IPPAPPNP 321 Score = 29.5 bits (63), Expect = 3.2 Identities = 16/47 (34%), Positives = 17/47 (36%), Gaps = 2/47 (4%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPP--XXGGGXPPPPPXPXXXAXXXXPP 566 PP PP PP +PP P G P PP P PP Sbjct: 188 PPTPPAPPSPPIPTAPPTPPMPETPLPPGSPHIPPAPLHPHIPPAPP 234 Score = 28.3 bits (60), Expect = 7.4 Identities = 16/50 (32%), Positives = 16/50 (32%), Gaps = 5/50 (10%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSP-----PPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PP PP P PP PP PP P PP Sbjct: 197 PPIPTAPPTPPMPETPLPPGSPHIPPAPLHPHIPPAPPNPSKAIATPNPP 246 Score = 28.3 bits (60), Expect = 7.4 Identities = 15/47 (31%), Positives = 17/47 (36%), Gaps = 2/47 (4%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPP--PPXPXXXAXXXXPP 566 PP P PP +PP P P P PP P + PP Sbjct: 300 PPNLFIPSAPPNPHIPPAPPNPYIPTAPPNPSIPPAPPNPSIPPAPP 346 >SB_1800| Best HMM Match : LEA_4 (HMM E-Value=7.4) Length = 186 Score = 32.3 bits (70), Expect = 0.46 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -1 Query: 533 GGGGGGXSXPXXGGGGXXXXXXXGGGGGXXXPXGG 429 GG GG GGGG GGGGG GG Sbjct: 40 GGATGGHGGATGGGGGATGGGATGGGGGATGGGGG 74 Score = 31.5 bits (68), Expect = 0.80 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = -1 Query: 566 GGXXAXXXXXRGGGGGGXSXPXXGGGGXXXXXXXGGGGGXXXPXGG 429 GG GGGGG GGGG GGGGG GG Sbjct: 40 GGATGGHGGATGGGGGATGGGATGGGG----GATGGGGGATGGHGG 81 Score = 29.5 bits (63), Expect = 3.2 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = -2 Query: 562 GXXXXAXXXGXGGGGGXPPPXXGGGGXXFXXXXGGGGGXXPXGG 431 G A G GGGG GG GGGGG GG Sbjct: 51 GGGGGATGGGATGGGGGATGGGGGATGGHGGATGGGGGATGDGG 94 Score = 29.5 bits (63), Expect = 3.2 Identities = 16/46 (34%), Positives = 17/46 (36%) Frame = -1 Query: 566 GGXXAXXXXXRGGGGGGXSXPXXGGGGXXXXXXXGGGGGXXXPXGG 429 GG A GGGG + GG GGGGG GG Sbjct: 71 GGGGATGGHGGATGGGGGATGDGGGATGGGGGATGGGGGATGGHGG 116 Score = 29.1 bits (62), Expect = 4.2 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = -1 Query: 566 GGXXAXXXXXRGGGGGGXSXPXXGGGGXXXXXXXGGGGGXXXPXGG 429 GG A GGGGG GG GGGGG GG Sbjct: 52 GGGGATGGGATGGGGGATGG--GGGATGGHGGATGGGGGATGDGGG 95 Score = 28.3 bits (60), Expect = 7.4 Identities = 17/48 (35%), Positives = 17/48 (35%), Gaps = 2/48 (4%) Frame = -1 Query: 566 GGXXAXXXXXRGGGGGGXSXPXXGGGGXXXXXXXG--GGGGXXXPXGG 429 GG GGG G GGGG G GGGG GG Sbjct: 47 GGATGGGGGATGGGATGGGGGATGGGGGATGGHGGATGGGGGATGDGG 94 Score = 28.3 bits (60), Expect = 7.4 Identities = 19/51 (37%), Positives = 19/51 (37%), Gaps = 5/51 (9%) Frame = -1 Query: 566 GGXXAXXXXXRGGGGG---GXSXPXXGGGGXXXXXXX--GGGGGXXXPXGG 429 GG GGGGG G GGGG GGGGG GG Sbjct: 59 GGATGGGGGATGGGGGATGGHGGATGGGGGATGDGGGATGGGGGATGGGGG 109 Score = 27.9 bits (59), Expect = 9.8 Identities = 15/45 (33%), Positives = 15/45 (33%) Frame = -2 Query: 565 GGXXXXAXXXGXGGGGGXPPPXXGGGGXXFXXXXGGGGGXXPXGG 431 GG GGGGG G G GGGG GG Sbjct: 51 GGGGGATGGGATGGGGGATGGGGGATGGHGGATGGGGGATGDGGG 95 >SB_18600| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2388 Score = 32.3 bits (70), Expect = 0.46 Identities = 17/47 (36%), Positives = 18/47 (38%), Gaps = 2/47 (4%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSP--PPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP P PPP +P PPP G PPPP PP Sbjct: 362 PPPPIIPIPPPAMPAMFNPHVPPPMIGPVTVPPPPLIPPPQASIPPP 408 Score = 31.5 bits (68), Expect = 0.80 Identities = 16/47 (34%), Positives = 18/47 (38%), Gaps = 2/47 (4%) Frame = +1 Query: 433 PXGXXXPPPPPXXXKXXXP--PPPXXGXXXPPPPPPLXXXXXAXXPP 567 P P PPP P PPP G PPPP + + PP Sbjct: 362 PPPPIIPIPPPAMPAMFNPHVPPPMIGPVTVPPPPLIPPPQASIPPP 408 Score = 27.9 bits (59), Expect = 9.8 Identities = 15/40 (37%), Positives = 17/40 (42%), Gaps = 4/40 (10%) Frame = +1 Query: 430 PPXGXXXPPPPP--XXXKXXXPPPPXXGXXXPP--PPPPL 537 P G PPPP + PPP PP PPPP+ Sbjct: 385 PMIGPVTVPPPPLIPPPQASIPPPTMIQTLPPPSVPPPPI 424 >SB_14242| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 408 Score = 31.9 bits (69), Expect = 0.60 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -1 Query: 533 GGGGGGXSXPXXGGGGXXXXXXXGGGGG 450 G GG G S GGGG GGGGG Sbjct: 329 GSGGSGTSEGGFGGGGATVASRPGGGGG 356 Score = 29.9 bits (64), Expect = 2.4 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 535 GXGGGGGXPPPXXGGGGXXFXXXXGGGGGXXPXG 434 G GG G GGGG GGGGG G Sbjct: 328 GGSGGSGTSEGGFGGGGATVASRPGGGGGYSGGG 361 >SB_20734| Best HMM Match : Abi_HHR (HMM E-Value=3.59994e-42) Length = 426 Score = 31.9 bits (69), Expect = 0.60 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +1 Query: 433 PXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPL 537 P PPP PP P PPPPPPL Sbjct: 283 PVPPMTPPPAVVTAPPPAPPLPNFTSPSPPPPPPL 317 >SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 833 Score = 31.5 bits (68), Expect = 0.80 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 5/37 (13%) Frame = +1 Query: 439 GXXXPPPPPXXXKXXXPPP-----PXXGXXXPPPPPP 534 G PPPPP PP P PPPPPP Sbjct: 775 GAPPPPPPPTKPATPRVPPNIPSRPPGARPTPPPPPP 811 >SB_1160| Best HMM Match : RRM_1 (HMM E-Value=1.5e-07) Length = 252 Score = 31.5 bits (68), Expect = 0.80 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 1/47 (2%) Frame = -1 Query: 566 GGXXAXXXXXRGGGGGGXSXPXXGGGGXXXXXXXGG-GGGXXXPXGG 429 GG GG GGG GGGG GG GGG GG Sbjct: 193 GGYGGSKGGYGGGSGGGGYGGGRGGGGYGGGHGGGGYGGGGRHDYGG 239 Score = 29.9 bits (64), Expect = 2.4 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 1/47 (2%) Frame = -1 Query: 566 GGXXAXXXXXRGGGGGGXSXPXXGGGGXXXXXXXG-GGGGXXXPXGG 429 GG GGGG G S GGG G GGGG GG Sbjct: 180 GGGSQGGGYRSGGGGYGGSKGGYGGGSGGGGYGGGRGGGGYGGGHGG 226 Score = 28.7 bits (61), Expect = 5.6 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = -2 Query: 565 GGXXXXAXXXGXGGGGGXPPPXXGGGGXXFXXXXGGGG 452 GG G GGG G G GG + GGGG Sbjct: 191 GGGGYGGSKGGYGGGSGGGGYGGGRGGGGYGGGHGGGG 228 >SB_44923| Best HMM Match : Fibrillarin (HMM E-Value=0) Length = 304 Score = 31.5 bits (68), Expect = 0.80 Identities = 18/37 (48%), Positives = 18/37 (48%), Gaps = 1/37 (2%) Frame = -1 Query: 536 RGGG-GGGXSXPXXGGGGXXXXXXXGGGGGXXXPXGG 429 RG G GGG P GG G GGGGG P GG Sbjct: 40 RGAGRGGGRGGPRGGGRGGGR----GGGGGFKSPRGG 72 Score = 27.9 bits (59), Expect = 9.8 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 6/41 (14%) Frame = -2 Query: 535 GXGGGGGXPPPXXGG------GGXXFXXXXGGGGGXXPXGG 431 G G GGG P GG GG F GGG G GG Sbjct: 41 GAGRGGGRGGPRGGGRGGGRGGGGGFKSPRGGGRGGGRGGG 81 >SB_32451| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 924 Score = 31.5 bits (68), Expect = 0.80 Identities = 17/37 (45%), Positives = 17/37 (45%), Gaps = 1/37 (2%) Frame = -1 Query: 536 RGGGG-GGXSXPXXGGGGXXXXXXXGGGGGXXXPXGG 429 RGGGG GG GGGG GGG G GG Sbjct: 760 RGGGGYGGGGGGYRGGGGYGGGHRGGGGYGGGGHRGG 796 >SB_20869| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1212 Score = 31.5 bits (68), Expect = 0.80 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPP 534 PP PPP PPPP PPP P Sbjct: 1057 PPPRKPSPPPSEPAPPPRQPPPPSTSQPVPPPRQP 1091 Score = 28.7 bits (61), Expect = 5.6 Identities = 15/45 (33%), Positives = 16/45 (35%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP P PPP P PP PP P P + PP Sbjct: 1049 PPPSAVPIPPPR-----KPSPPPSEPAPPPRQPPPPSTSQPVPPP 1088 Score = 27.9 bits (59), Expect = 9.8 Identities = 18/49 (36%), Positives = 18/49 (36%), Gaps = 4/49 (8%) Frame = +3 Query: 432 PPXGXXPPPP-PXXXXXXSPPPPXXGGGXPP---PPPXPXXXAXXXXPP 566 PP PPP P PPPP PP P P P A PP Sbjct: 1058 PPRKPSPPPSEPAPPPR-QPPPPSTSQPVPPPRQPDPIPTNPAHPTEPP 1105 >SB_10615| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1884 Score = 31.5 bits (68), Expect = 0.80 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = -1 Query: 566 GGXXAXXXXXRGGGGGGXSXPXXGGGGXXXXXXXGGGGGXXXPXGG 429 GG A GGGGGG G G GG GG GG Sbjct: 1800 GGGMAGGGGGMGGGGGGMGGGGEGMGAAGGGMGAGGEGGGAGGGGG 1845 Score = 30.7 bits (66), Expect = 1.4 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -1 Query: 533 GGGGGGXSXPXXGGGGXXXXXXXGGGGGXXXPXGG 429 GG GGG GGGG G GGG GG Sbjct: 1756 GGFGGGGGGGGMGGGGGMAGGGGGMGGGGMAAGGG 1790 Score = 30.3 bits (65), Expect = 1.8 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 1/47 (2%) Frame = -1 Query: 566 GGXXAXXXXXRGGGGGGXSXPXXGGG-GXXXXXXXGGGGGXXXPXGG 429 GG A GGGG GGG G GGGGG GG Sbjct: 1770 GGGMAGGGGGMGGGGMAAGGGEFGGGEGMGGGGMAGGGGGMGGGGGG 1816 Score = 29.5 bits (63), Expect = 3.2 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = -2 Query: 565 GGXXXXAXXXGXGGGGGXPPPXXGGGGXXFXXXXGGGGGXXPXGG 431 GG GGGGG GG F G GGG GG Sbjct: 1763 GGGGMGGGGGMAGGGGGMGGGGMAAGGGEFGGGEGMGGGGMAGGG 1807 Score = 29.5 bits (63), Expect = 3.2 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = -1 Query: 566 GGXXAXXXXXRGGGGGGXSXPXXGGGGXXXXXXXGGGGGXXXPXGG 429 GG GGGGG GGG GGGG GG Sbjct: 1764 GGGMGGGGGMAGGGGGMGGGGMAAGGGEFGGGEGMGGGGMAGGGGG 1809 Score = 29.1 bits (62), Expect = 4.2 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -2 Query: 535 GXGGGGGXPPPXXGGGGXXFXXXXGGGGGXXPXGG 431 G GGGGG GGGG G GGG GG Sbjct: 1757 GFGGGGGG--GGMGGGGGMAGGGGGMGGGGMAAGG 1789 Score = 29.1 bits (62), Expect = 4.2 Identities = 17/47 (36%), Positives = 17/47 (36%), Gaps = 1/47 (2%) Frame = -1 Query: 566 GGXXAXXXXXRGGGGGGXSXPXXG-GGGXXXXXXXGGGGGXXXPXGG 429 GG GGGGG G GGG GGG G GG Sbjct: 1793 GGGEGMGGGGMAGGGGGMGGGGGGMGGGGEGMGAAGGGMGAGGEGGG 1839 Score = 29.1 bits (62), Expect = 4.2 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = -2 Query: 565 GGXXXXAXXXGXGGGGGXPPPXXGGGGXXFXXXXGGGGGXXPXGG 431 GG G GGGGG GGGG GG G GG Sbjct: 1799 GGGGMAGGGGGMGGGGG----GMGGGGEGMGAAGGGMGAGGEGGG 1839 Score = 28.7 bits (61), Expect = 5.6 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -2 Query: 535 GXGGGGGXPPPXXGGGGXXFXXXXGGGGGXXPXGG 431 G GGGGG GGGG GGGG GG Sbjct: 1759 GGGGGGGG---MGGGGGMAGGGGGMGGGGMAAGGG 1790 Score = 28.3 bits (60), Expect = 7.4 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = -3 Query: 567 GGGXXXXXXXKGXGGGGXXXPXXXGGGXXXFXXXXGGGGXLXPXGG 430 GGG G GGG GGG GGGG GG Sbjct: 1764 GGGMGGGGGMAGGGGGMGGGGMAAGGGEFGGGEGMGGGGMAGGGGG 1809 >SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 382 Score = 31.1 bits (67), Expect = 1.1 Identities = 12/28 (42%), Positives = 13/28 (46%) Frame = -3 Query: 363 GGXPPPXXGXKXXXXXXPPXKKXPPPPP 280 GG PPP PP + PPPPP Sbjct: 272 GGMPPPGMPPPMPPGGMPPNMEQPPPPP 299 Score = 29.9 bits (64), Expect = 2.4 Identities = 17/46 (36%), Positives = 18/46 (39%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP G PPPP PPP G PP PP+ PP Sbjct: 236 PPMGA---PPPPHSMPPPGMPPP--GMMPPPGFPPMGMPGMGGMPP 276 Score = 28.7 bits (61), Expect = 5.6 Identities = 18/48 (37%), Positives = 18/48 (37%), Gaps = 3/48 (6%) Frame = +3 Query: 432 PPXGXXPP---PPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP G PP PPP PP G G PPP P PP Sbjct: 248 PPPGMPPPGMMPPPGF-----PPMGMPGMGGMPPPGMPPPMPPGGMPP 290 Score = 28.3 bits (60), Expect = 7.4 Identities = 13/32 (40%), Positives = 13/32 (40%), Gaps = 2/32 (6%) Frame = +3 Query: 423 GXXPPXGXXPPPPP--XXXXXXSPPPPXXGGG 512 G PP G PP PP PPPP G Sbjct: 272 GGMPPPGMPPPMPPGGMPPNMEQPPPPPPSSG 303 >SB_37864| Best HMM Match : Extensin_2 (HMM E-Value=0.064) Length = 1230 Score = 31.1 bits (67), Expect = 1.1 Identities = 12/28 (42%), Positives = 13/28 (46%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPP 534 PPP P + PP PPPPPP Sbjct: 432 PPPRPYASQFADAPPVSPTTATPPPPPP 459 Score = 27.9 bits (59), Expect = 9.8 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPPP 530 PPP P PP PPPPP Sbjct: 432 PPPRPYASQFADAPPVSPTTATPPPPP 458 >SB_34030| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -1 Query: 566 GGXXAXXXXXRGGGGGGXSXPXXGGGGXXXXXXXGGGGG 450 GG GGGGGG G G GGGGG Sbjct: 42 GGGGGGGGGGGGGGGGGGDGDGDGDGDANANADGGGGGG 80 Score = 30.7 bits (66), Expect = 1.4 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -1 Query: 566 GGXXAXXXXXRGGGGGGXSXPXXGGGGXXXXXXXGGGGG 450 GG GGGGGG G G GGGGG Sbjct: 41 GGGGGGGGGGGGGGGGGGGDGDGDGDGDANANADGGGGG 79 Score = 29.9 bits (64), Expect = 2.4 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -1 Query: 533 GGGGGGXSXPXXGGGGXXXXXXXGGGGGXXXPXGG 429 GGGGGG GGGG G G GG Sbjct: 42 GGGGGGGGGGGGGGGGGGDGDGDGDGDANANADGG 76 >SB_3802| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 257 Score = 31.1 bits (67), Expect = 1.1 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +1 Query: 487 PPPPXXGXXXPPPPPPL 537 P PP G PPPPPPL Sbjct: 171 PSPPPSGAPPPPPPPPL 187 >SB_43690| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 780 Score = 31.1 bits (67), Expect = 1.1 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPP 534 PPPPP P P G PPPPPP Sbjct: 755 PPPPPP------PAVPGEGARPPPPPPP 776 Score = 30.7 bits (66), Expect = 1.4 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 PPPPP P P G PPPPP P Sbjct: 755 PPPPPP------PAVPGEGARPPPPPPPP 777 Score = 27.9 bits (59), Expect = 9.8 Identities = 17/45 (37%), Positives = 19/45 (42%), Gaps = 7/45 (15%) Frame = +3 Query: 453 PPPPXXXXXXSPPPPXXGGGXP-------PPPPXPXXXAXXXXPP 566 PPPP +PPPP GGG P PP P + PP Sbjct: 684 PPPP------APPPPPIGGGDPTIWVSGGPPLSAPPLSSTLGPPP 722 Score = 25.4 bits (53), Expect(2) = 1.3 Identities = 11/22 (50%), Positives = 11/22 (50%), Gaps = 2/22 (9%) Frame = -1 Query: 404 PPPPPPG--GXXXTPXGGXPPP 345 PPPPPP G P PPP Sbjct: 756 PPPPPPAVPGEGARPPPPPPPP 777 Score = 23.8 bits (49), Expect(2) = 1.3 Identities = 13/41 (31%), Positives = 13/41 (31%) Frame = -1 Query: 506 PXXGGGGXXXXXXXGGGGGXXXPXGGXXXXXKXXPPPPPPG 384 P GGG GG P PPPPP G Sbjct: 691 PPPIGGGDPTIWVSGGPPLSAPPLSSTLGPPPPAPPPPPLG 731 >SB_39302| Best HMM Match : SH3_2 (HMM E-Value=1.9e-38) Length = 2084 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/42 (35%), Positives = 17/42 (40%) Frame = +2 Query: 410 FXKXXXXPPXGXXXPPPPXXXXKXXXPPPXXXGXXXPPPPXP 535 F + PP PPPP + PPP G PPP P Sbjct: 505 FVEDRSPPPPPPASPPPPLPAEEDNSPPPLPAG---PPPDEP 543 Score = 29.1 bits (62), Expect = 4.2 Identities = 13/36 (36%), Positives = 15/36 (41%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPL 537 PP PPPP + PPP PPP P+ Sbjct: 511 PPPPPPASPPPPLPAEEDNSPPPLPA--GPPPDEPM 544 >SB_18993| Best HMM Match : DEAD (HMM E-Value=9.3e-41) Length = 690 Score = 31.1 bits (67), Expect = 1.1 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = -1 Query: 533 GGGGGGXSXPXXGGGGXXXXXXXGGGGGXXXPXGGXXXXXKXXPPPPPP 387 G G GG S GGGG G GG PPPPPP Sbjct: 472 GSGYGGGSSSRGGGGGR-------SSSGGNSRSGGSSYKSSNPPPPPPP 513 Score = 29.9 bits (64), Expect = 2.4 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -2 Query: 535 GXGGGGGXPPPXXGGGGXXFXXXXGGGGGXXPXGGXXPXFXKXXPPPPPR 386 G G GG GGGG GG GG PPPPPR Sbjct: 471 GGSGYGGGSSSRGGGGGR------SSSGGNSRSGGSSYKSSNPPPPPPPR 514 >SB_11832| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 493 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 1/36 (2%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXG-GGXPPPPPXP 536 PP G PPPP P P G PPPP P Sbjct: 360 PPPGTYYPPPPQGNYNQYPVPGGQNYAGAPPPPYYP 395 >SB_59302| Best HMM Match : Collagen (HMM E-Value=0) Length = 993 Score = 30.7 bits (66), Expect = 1.4 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +3 Query: 453 PPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PPPP PPP G PP P P PP Sbjct: 29 PPPPPPYEAPPPPPGPPGPDGPPGFPGPQGPNGPKGPP 66 Score = 30.3 bits (65), Expect = 1.8 Identities = 22/72 (30%), Positives = 23/72 (31%), Gaps = 11/72 (15%) Frame = +3 Query: 384 PRGGGGGXXFXXXGXXP-----PXGXXPPP----PPXXXXXXSPP--PPXXGGGXPPPPP 530 P G GG + P P G PP PP PP P G PP PP Sbjct: 663 PAGNAGGVGYQGNHGNPAGVQGPNGQPGPPGINGPPGQIGEMGPPGLPGPPGPASPPSPP 722 Query: 531 XPXXXAXXXXPP 566 P PP Sbjct: 723 GPPGPPGPNGPP 734 Score = 28.7 bits (61), Expect = 5.6 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +1 Query: 433 PXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 P G PP PP P P G PP PP L PP Sbjct: 181 PNGPLGPPGPPGDMGPPGLPGPQ-GPQMPPGPPGLPGAPGPKGPP 224 Score = 28.7 bits (61), Expect = 5.6 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +1 Query: 433 PXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 P G PP PP P P G PP PP L PP Sbjct: 266 PNGILGPPGPPGDMGPPGLPGPP-GPQMPPGPPGLPGAPGPKGPP 309 Score = 28.7 bits (61), Expect = 5.6 Identities = 18/54 (33%), Positives = 18/54 (33%), Gaps = 6/54 (11%) Frame = +3 Query: 423 GXXPPXGXXPPP----PPXXXXXXSPP--PPXXGGGXPPPPPXPXXXAXXXXPP 566 G P G PP PP PP P G PP PP P PP Sbjct: 766 GSQGPNGQPGPPGINGPPGQVGEMGPPGLPGPPGPASPPSPPGPPGPPGPKGPP 819 Score = 28.7 bits (61), Expect = 5.6 Identities = 18/54 (33%), Positives = 18/54 (33%), Gaps = 6/54 (11%) Frame = +3 Query: 423 GXXPPXGXXPPP----PPXXXXXXSPP--PPXXGGGXPPPPPXPXXXAXXXXPP 566 G P G PP PP PP P G PP PP P PP Sbjct: 851 GSQGPNGQPGPPGINGPPGQVGEMGPPGLPGPPGPASPPSPPGPPGPPGPKGPP 904 Score = 28.3 bits (60), Expect = 7.4 Identities = 14/45 (31%), Positives = 14/45 (31%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP PPPP PP G P P P PP Sbjct: 31 PPPPYEAPPPPPGPPGPDGPPGFPGPQGPNGPKGPPGLPGPPGPP 75 Score = 27.9 bits (59), Expect = 9.8 Identities = 13/38 (34%), Positives = 14/38 (36%) Frame = +1 Query: 454 PPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PPPP + PPP G PP P PP Sbjct: 29 PPPPPPYEAPPPPPGPPGPDGPPGFPGPQGPNGPKGPP 66 Score = 27.9 bits (59), Expect = 9.8 Identities = 14/44 (31%), Positives = 15/44 (34%) Frame = +3 Query: 435 PXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 P G PP + PP G PP PP P PP Sbjct: 84 PAGAIGPPGLPGPNGVNGPPGELGDMGPPGPPGPPGPQMPPGPP 127 >SB_47949| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 280 Score = 30.7 bits (66), Expect = 1.4 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 6/39 (15%) Frame = +3 Query: 423 GXXPPXGXXPP---PP---PXXXXXXSPPPPXXGGGXPP 521 G PP G PP PP P PPPP GG PP Sbjct: 220 GMLPPPGGMPPGRMPPQGLPFPPPGPIPPPPGAGGMRPP 258 Score = 29.5 bits (63), Expect = 3.2 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPP 522 PP G PPP P PPPP G PP Sbjct: 234 PPQGLPFPPPGPI------PPPPGAGGMRPP 258 Score = 28.3 bits (60), Expect = 7.4 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 3/37 (8%) Frame = +3 Query: 423 GXXPPXGXXPPP---PPXXXXXXSPPPPXXGGGXPPP 524 G PP G PPP PP P P G PPP Sbjct: 214 GLMPPPGMLPPPGGMPPGRMPPQGLPFPPPGPIPPPP 250 Score = 27.9 bits (59), Expect = 9.8 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +3 Query: 435 PXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 P G PPP PP G P PPP P Sbjct: 212 PPGLMPPPGMLPPPGGMPPGRMPPQGLPFPPPGP 245 >SB_35885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 476 Score = 30.7 bits (66), Expect = 1.4 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPP 524 PP PPPP PPP PPP Sbjct: 322 PPPSQAPPPPKTIPSTLPPPPVPSATSAPPP 352 Score = 30.7 bits (66), Expect = 1.4 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 2/37 (5%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXX--PPPPXXGXXXPPPPPP 534 PP P PP PPPP PPPPPP Sbjct: 405 PPMLNMAPSIPPWQTTPGYIPPPPPGFPQFQPPPPPP 441 Score = 30.3 bits (65), Expect = 1.8 Identities = 20/66 (30%), Positives = 21/66 (31%), Gaps = 5/66 (7%) Frame = +3 Query: 384 PRGGGGGXXFXXXGXXPPXGXXPPPPPXXXXXXS-----PPPPXXGGGXPPPPPXPXXXA 548 P G G G P G P PPP + PP G PPPPP Sbjct: 376 PPGAGNGPGGPPPPWSKPGGILPGPPPPGPPMLNMAPSIPPWQTTPGYIPPPPPGFPQFQ 435 Query: 549 XXXXPP 566 PP Sbjct: 436 PPPPPP 441 Score = 29.9 bits (64), Expect = 2.4 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +3 Query: 435 PXGXXPPPPPXXXXXXSPPPPXXGGGXPPPP 527 P PPPP PPPP PPP Sbjct: 322 PPPSQAPPPPKTIPSTLPPPPVPSATSAPPP 352 Score = 29.9 bits (64), Expect = 2.4 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +1 Query: 454 PPPPXXXKXXXPPPPXXGXXXPPPP 528 PPPP PPPP PPP Sbjct: 328 PPPPKTIPSTLPPPPVPSATSAPPP 352 Score = 29.1 bits (62), Expect = 4.2 Identities = 19/55 (34%), Positives = 19/55 (34%), Gaps = 3/55 (5%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPX-GXXPPPPPXXXXXX--SPPPPXXGGGXPPPPPXP 536 PP GG PP P PP PPPP PPPPP P Sbjct: 388 PPWSKPGGILPGPPPPGPPMLNMAPSIPPWQTTPGYIPPPPPGFPQFQPPPPPPP 442 Score = 27.9 bits (59), Expect = 9.8 Identities = 16/49 (32%), Positives = 16/49 (32%), Gaps = 7/49 (14%) Frame = +3 Query: 441 GXXPPPPPXXXXXXSPPPPXXGGGXPPP-------PPXPXXXAXXXXPP 566 G PPPP P P PPP PP P A PP Sbjct: 304 GEAPPPPAASEPAAFAPAPPPSQAPPPPKTIPSTLPPPPVPSATSAPPP 352 >SB_28395| Best HMM Match : RRM_1 (HMM E-Value=3.9e-25) Length = 159 Score = 30.7 bits (66), Expect = 1.4 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 1/47 (2%) Frame = -1 Query: 566 GGXXAXXXXXRGGGGGGXSXPXXGGG-GXXXXXXXGGGGGXXXPXGG 429 GG A GGG GG S GGG G GGGG GG Sbjct: 89 GGSRAGGYRSGGGGYGGSSRGGYGGGRGGGGYGGGRGGGGYGGGRGG 135 Score = 29.5 bits (63), Expect = 3.2 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -1 Query: 533 GGGGGGXSXPXXGGGGXXXXXXXGGGGGXXXPXGG 429 GG GGG GGGG G GGG GG Sbjct: 113 GGRGGGGYGGGRGGGGYGGGRGGGYGGGRRDYGGG 147 Score = 29.1 bits (62), Expect = 4.2 Identities = 18/47 (38%), Positives = 19/47 (40%), Gaps = 2/47 (4%) Frame = -2 Query: 565 GGXXXXAXXXGXGG--GGGXPPPXXGGGGXXFXXXXGGGGGXXPXGG 431 GG + G GG GGG GGGG G GGG GG Sbjct: 100 GGGYGGSSRGGYGGGRGGGGYGGGRGGGGYGGGRGGGYGGGRRDYGG 146 >SB_20442| Best HMM Match : Chitin_bind_3 (HMM E-Value=7.4e-05) Length = 288 Score = 30.7 bits (66), Expect = 1.4 Identities = 15/40 (37%), Positives = 15/40 (37%), Gaps = 5/40 (12%) Frame = +3 Query: 423 GXXPPXGXXPPPP-----PXXXXXXSPPPPXXGGGXPPPP 527 G PP PPPP P PPPP PPP Sbjct: 209 GPLPPTAAPPPPPTTGAPPPTPVTNKPPPPRPATTQAPPP 248 Score = 29.1 bits (62), Expect = 4.2 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = -1 Query: 440 PXGGXXXXXKXXPPPPPPGGXXXTPXGGXPPP 345 P G PPPP G TP PPP Sbjct: 206 PRSGPLPPTAAPPPPPTTGAPPPTPVTNKPPP 237 Score = 28.3 bits (60), Expect = 7.4 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPP 534 PPPPP PPP PPPP P Sbjct: 217 PPPPPTTGA----PPPTPVTNKPPPPRP 240 >SB_17289| Best HMM Match : GRP (HMM E-Value=0.00022) Length = 131 Score = 30.7 bits (66), Expect = 1.4 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = -1 Query: 533 GGGGGGXSXPXXGGGGXXXXXXXGGGGG 450 GGGGGG GGGG GGGGG Sbjct: 53 GGGGGGGG---GGGGGGGGGGGGGGGGG 77 Score = 29.9 bits (64), Expect = 2.4 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -1 Query: 530 GGGGGXSXPXXGGGGXXXXXXXGGGGG 450 GGGGG GGGG GGG G Sbjct: 53 GGGGGGGGGGGGGGGGGGGGGGGGGDG 79 >SB_17044| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 386 Score = 30.7 bits (66), Expect = 1.4 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +3 Query: 456 PPPXXXXXXSPPPPXXGGGXPPPPPXP 536 PP P P G G PPPPP P Sbjct: 115 PPAPTSVPSGPRAPPGGPGAPPPPPPP 141 Score = 28.3 bits (60), Expect = 7.4 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPP 531 PP P PP G PPPPP Sbjct: 115 PPAPTSVPSGPRAPPGGPGAPPPPPPP 141 Score = 27.9 bits (59), Expect = 9.8 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPPP 530 PP P PP G PPPPP Sbjct: 115 PPAPTSVPSGPRAPPGGPGAPPPPPPP 141 >SB_5325| Best HMM Match : Drf_FH1 (HMM E-Value=0.41) Length = 638 Score = 30.7 bits (66), Expect = 1.4 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 1/47 (2%) Frame = +1 Query: 430 PPXGXXXPPP-PPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 PP PPP PP K PPPP P P PP PP Sbjct: 449 PPLPSDEPPPLPPDEEK---PPPPPAPALPPLPLPPELPGSPGDSPP 492 Score = 30.3 bits (65), Expect = 1.8 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPP 530 PP PPPPP P PP G PP Sbjct: 460 PPDEEKPPPPPAPALPPLPLPPELPGSPGDSPP 492 >SB_17864| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 911 Score = 30.7 bits (66), Expect = 1.4 Identities = 16/48 (33%), Positives = 17/48 (35%) Frame = +3 Query: 441 GXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPPXXXXXG 584 G P P P + PPP GG P P P P PP G Sbjct: 577 GGYPAPTPSYPQPGTYPPPHPSGGYPQPSP-PHGGHPHHPPPTGYPGG 623 Score = 28.7 bits (61), Expect = 5.6 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +3 Query: 390 GGGGGXXFXXXGXXPPXGXXPPPPPXXXXXXSPPP 494 GG G P G PPPPP PPP Sbjct: 622 GGYPGTHTAPPAGGYPTGQHPPPPPAGYPGYGPPP 656 >SB_52012| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1143 Score = 30.3 bits (65), Expect = 1.8 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +1 Query: 487 PPPPXXGXXXPPPPPP 534 PPPP PPPPPP Sbjct: 740 PPPPATAAKAPPPPPP 755 Score = 28.7 bits (61), Expect = 5.6 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPP 525 PPPP K PPPP P P Sbjct: 740 PPPPATAAKAPPPPPPRKDVEEPSP 764 >SB_51555| Best HMM Match : ATP-cone (HMM E-Value=3.3) Length = 491 Score = 30.3 bits (65), Expect = 1.8 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -2 Query: 535 GXGGGGGXPPPXXGGGGXXFXXXXGGGGGXXPXGG 431 G GGGG GGGG GGGGG GG Sbjct: 344 GLAGGGGIQS--FGGGGGADLQTLGGGGGVQTLGG 376 >SB_45304| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 535 Score = 30.3 bits (65), Expect = 1.8 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = -2 Query: 565 GGXXXXAXXXGXGGGGGXPPPXXGGGGXXFXXXXGGGGGXXPXG 434 GG G GGGGG GG GGGGG G Sbjct: 468 GGFGGGGGPNGAGGGGGGGGGYSGGASGSRSNSCGGGGGSYNAG 511 >SB_38223| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 201 Score = 30.3 bits (65), Expect = 1.8 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = +1 Query: 487 PPPPXXGXXXPPPPPPL 537 PPPP PPPPPP+ Sbjct: 94 PPPPQLENDFPPPPPPM 110 >SB_9057| Best HMM Match : Nucleoplasmin (HMM E-Value=3.6) Length = 479 Score = 30.3 bits (65), Expect = 1.8 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +1 Query: 487 PPPPXXGXXXPPPPPP 534 PPPP PPPPPP Sbjct: 425 PPPPPPAPLPPPPPPP 440 Score = 29.9 bits (64), Expect = 2.4 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 PPPPP PPPP P P P Sbjct: 426 PPPPPAPLPPPPPPPPQPTTALPDPLQGP 454 Score = 29.5 bits (63), Expect = 3.2 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +1 Query: 487 PPPPXXGXXXPPPPPP 534 PPPP PPPPPP Sbjct: 424 PPPPPPPAPLPPPPPP 439 Score = 28.3 bits (60), Expect = 7.4 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +3 Query: 486 PPPPXXGGGXPPPPPXP 536 PPPP PPPPP P Sbjct: 425 PPPPPPAPLPPPPPPPP 441 >SB_53638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 30.3 bits (65), Expect = 1.8 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -1 Query: 533 GGGGGGXSXPXXGGGGXXXXXXXGGGGG 450 GG GGG GGG GGGGG Sbjct: 63 GGAGGGAGGDDDDGGGISGCGDGGGGGG 90 Score = 28.7 bits (61), Expect = 5.6 Identities = 15/46 (32%), Positives = 15/46 (32%) Frame = -1 Query: 566 GGXXAXXXXXRGGGGGGXSXPXXGGGGXXXXXXXGGGGGXXXPXGG 429 GG GGG GG G G GGG G GG Sbjct: 55 GGDDCGDDGGAGGGAGGDDDDGGGISGCGDGGGGGGGAGGDDDDGG 100 >SB_47980| Best HMM Match : EGF_CA (HMM E-Value=7.6e-20) Length = 591 Score = 30.3 bits (65), Expect = 1.8 Identities = 22/65 (33%), Positives = 22/65 (33%), Gaps = 3/65 (4%) Frame = -2 Query: 565 GGXXXXAXXXGXGGGGGX---PPPXXGGGGXXFXXXXGGGGGXXPXGGXXPXFXKXXPPP 395 GG A G GG P GGGG GGGGG GG F P Sbjct: 464 GGEGGKAFLNGGVGGRSIWNVVPGGFGGGGGASGGGGGGGGGGGFSGGACGDFTSGLSPT 523 Query: 394 PPRGG 380 GG Sbjct: 524 CGGGG 528 Score = 27.9 bits (59), Expect = 9.8 Identities = 18/59 (30%), Positives = 18/59 (30%) Frame = -1 Query: 533 GGGGGGXSXPXXGGGGXXXXXXXGGGGGXXXPXGGXXXXXKXXPPPPPPGGXXXTPXGG 357 GGGGGG G GG GG GG P GG GG Sbjct: 441 GGGGGGFYTDGSSGSNFGGAYGPGGEGGKAFLNGGVGGRSIWNVVPGGFGGGGGASGGG 499 >SB_44156| Best HMM Match : Extensin_2 (HMM E-Value=0.05) Length = 1878 Score = 30.3 bits (65), Expect = 1.8 Identities = 16/29 (55%), Positives = 16/29 (55%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPPL 537 PPPPP PPPP PPPPPPL Sbjct: 1311 PPPPP-------PPPP------PPPPPPL 1326 Score = 29.9 bits (64), Expect = 2.4 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +3 Query: 483 SPPPPXXGGGXPPPPPXP 536 SPPPP PPPPP P Sbjct: 1310 SPPPPPPPPPPPPPPPLP 1327 Score = 29.5 bits (63), Expect = 3.2 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 PP PPPPP PPPP PP PP P Sbjct: 1307 PPESPPPPPPP------PPPPP-----PPPLPPTP 1330 >SB_31643| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 330 Score = 30.3 bits (65), Expect = 1.8 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 PP PPPP P P G P PP P Sbjct: 95 PPPPATPPPPTMPPTPPPPQTPAPPGPDTPAPPAP 129 Score = 29.1 bits (62), Expect = 4.2 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = +1 Query: 439 GXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPLXXXXXAXXPP 567 G PPPP PPPP PPP P PP Sbjct: 90 GTCGDPPPPAT-----PPPPTMPPTPPPPQTPAPPGPDTPAPP 127 >SB_4771| Best HMM Match : DEAD (HMM E-Value=0.015) Length = 592 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/55 (30%), Positives = 17/55 (30%), Gaps = 7/55 (12%) Frame = +3 Query: 423 GXXPPXGXXPPPPPXXXXXXSP-------PPPXXGGGXPPPPPXPXXXAXXXXPP 566 G PP PP P P PPP PPP P P PP Sbjct: 61 GVGPPVASTPPAPQPVPNNMGPPPHVNQGPPPNSANQAPPPNPGPSPSFNSQGPP 115 >SB_53717| Best HMM Match : Furin-like (HMM E-Value=0.05) Length = 1098 Score = 29.9 bits (64), Expect = 2.4 Identities = 20/61 (32%), Positives = 21/61 (34%), Gaps = 1/61 (1%) Frame = -1 Query: 536 RGGGGGGXSXPXXGGG-GXXXXXXXGGGGGXXXPXGGXXXXXKXXPPPPPPGGXXXTPXG 360 RG GGG P G G G G GGG GG + PGG G Sbjct: 254 RGSGGGWGQGPGGGWGRGQGRGMGRGPGGGWGRGSGGGWGRMQGGGMGRGPGGGWGRMQG 313 Query: 359 G 357 G Sbjct: 314 G 314 >SB_47282| Best HMM Match : RCSD (HMM E-Value=0.53) Length = 264 Score = 29.9 bits (64), Expect = 2.4 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPP 527 PP PPPPP PPPP G P P Sbjct: 73 PPPLCAPPPPP---PPPPPPPPPPGAKKPDDP 101 Score = 29.9 bits (64), Expect = 2.4 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +1 Query: 457 PPPXXXKXXXPPPPXXGXXXPPPPPP 534 PPP PPPP PPPPPP Sbjct: 73 PPPLCAPPPPPPPPP-----PPPPPP 93 Score = 29.1 bits (62), Expect = 4.2 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPP 528 PP PPPPP PPPP G P P Sbjct: 74 PPLCAPPPPPPPPP-----PPPPPPGAKKPDDP 101 >SB_43066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 29.9 bits (64), Expect = 2.4 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPP 534 PPPPP PPPP PPPPPP Sbjct: 54 PPPPPPPP----PPPP------PPPPPP 71 >SB_31227| Best HMM Match : RIO1 (HMM E-Value=0.13) Length = 633 Score = 29.9 bits (64), Expect = 2.4 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXP 518 P G PPP SPPPP GGG P Sbjct: 247 PTNGMLGHPPPKQGLL-SPPPPAYGGGPP 274 >SB_29861| Best HMM Match : RRM_1 (HMM E-Value=1.10002e-42) Length = 1531 Score = 29.9 bits (64), Expect = 2.4 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPP 527 P PP PPPP G PPPP Sbjct: 891 PGTPPITSPSSLPPPPPLQGYNPPPP 916 Score = 28.3 bits (60), Expect = 7.4 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPP 528 P PP PPPP PPPP Sbjct: 891 PGTPPITSPSSLPPPPPLQGYNPPPP 916 >SB_11994| Best HMM Match : ERM (HMM E-Value=0.28) Length = 465 Score = 29.9 bits (64), Expect = 2.4 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPP 527 PP PPPPP PPPP G P P Sbjct: 274 PPPLCAPPPPP---PPPPPPPPPPGAKKPDDP 302 Score = 29.9 bits (64), Expect = 2.4 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +1 Query: 457 PPPXXXKXXXPPPPXXGXXXPPPPPP 534 PPP PPPP PPPPPP Sbjct: 274 PPPLCAPPPPPPPPP-----PPPPPP 294 Score = 29.1 bits (62), Expect = 4.2 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPP 528 PP PPPPP PPPP G P P Sbjct: 275 PPLCAPPPPPPPPP-----PPPPPPGAKKPDDP 302 >SB_8600| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 450 Score = 29.9 bits (64), Expect = 2.4 Identities = 15/46 (32%), Positives = 16/46 (34%) Frame = -1 Query: 566 GGXXAXXXXXRGGGGGGXSXPXXGGGGXXXXXXXGGGGGXXXPXGG 429 GG GGG G + P GG GG G P GG Sbjct: 79 GGGNEGQTKPNGGGSEGQTTPNGGGSEGQTTPNGGGSEGQTTPNGG 124 Score = 29.9 bits (64), Expect = 2.4 Identities = 15/46 (32%), Positives = 16/46 (34%) Frame = -1 Query: 566 GGXXAXXXXXRGGGGGGXSXPXXGGGGXXXXXXXGGGGGXXXPXGG 429 GG GGG G + P GG GG G P GG Sbjct: 90 GGGSEGQTTPNGGGSEGQTTPNGGGSEGQTTPNGGGSEGQTTPNGG 135 Score = 29.9 bits (64), Expect = 2.4 Identities = 15/46 (32%), Positives = 16/46 (34%) Frame = -1 Query: 566 GGXXAXXXXXRGGGGGGXSXPXXGGGGXXXXXXXGGGGGXXXPXGG 429 GG GGG G + P GG GG G P GG Sbjct: 101 GGGSEGQTTPNGGGSEGQTTPNGGGSEGQTTPNGGGSEGQTTPNGG 146 >SB_2840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2248 Score = 29.9 bits (64), Expect = 2.4 Identities = 22/64 (34%), Positives = 22/64 (34%), Gaps = 2/64 (3%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXXP--PPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXX 554 PP G G G PP G PPPP SP P G PP P P Sbjct: 2125 PPMGQYGAPARPAMGP-PPMGSSRYGPPPPMGPARHSPSGPSPLGA-PPSVPPPMGAPPS 2182 Query: 555 XXPP 566 PP Sbjct: 2183 GPPP 2186 Score = 29.9 bits (64), Expect = 2.4 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = +3 Query: 435 PXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 P G P PP S PPP G PP P P PP Sbjct: 2166 PLGAPPSVPPPMGAPPSGPPPM---GAPPSGPPPMGTPPSGHPP 2206 Score = 29.1 bits (62), Expect = 4.2 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +3 Query: 432 PPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP G P PP S PPP G PP P PP Sbjct: 2175 PPMGAPPSGPPPMGAPPSGPPPM---GTPPSGHPPMGAPPMGPPP 2216 >SB_29069| Best HMM Match : Furin-like (HMM E-Value=0.042) Length = 628 Score = 29.9 bits (64), Expect = 2.4 Identities = 20/61 (32%), Positives = 21/61 (34%), Gaps = 1/61 (1%) Frame = -1 Query: 536 RGGGGGGXSXPXXGGG-GXXXXXXXGGGGGXXXPXGGXXXXXKXXPPPPPPGGXXXTPXG 360 RG GGG P G G G G GGG GG + PGG G Sbjct: 10 RGSGGGWGQGPGGGWGRGQGGGMGRGPGGGWGRGSGGGWGRMQGGGMGRGPGGGWGRMQG 69 Query: 359 G 357 G Sbjct: 70 G 70 >SB_23532| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 364 Score = 29.9 bits (64), Expect = 2.4 Identities = 16/46 (34%), Positives = 17/46 (36%) Frame = -1 Query: 566 GGXXAXXXXXRGGGGGGXSXPXXGGGGXXXXXXXGGGGGXXXPXGG 429 GG + R GGGG G GG GGG G GG Sbjct: 92 GGGGSQGGGYRSGGGGYGGSSRGGYGGGRGGGGYGGGRGGGGSYGG 137 Score = 29.5 bits (63), Expect = 3.2 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = -1 Query: 566 GGXXAXXXXXRGGGGGGXSXPXXGGGGXXXXXXXGGGGGXXXPXGG 429 GG GGGG G S GGG GG GG GG Sbjct: 93 GGGSQGGGYRSGGGGYGGSSRGGYGGGRGGGGYGGGRGGGGSYGGG 138 >SB_42034| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 504 Score = 29.5 bits (63), Expect = 3.2 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPPPXPXXXA 548 PPPPP +PP P PPP P P A Sbjct: 9 PPPPPIAAEFTAPPAP-----PPPPNPAPDVPA 36 Score = 29.1 bits (62), Expect = 4.2 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 PPPPP + PP PPPPP P Sbjct: 8 PPPPPPIAAEFTAPP------APPPPPNP 30 >SB_7446| Best HMM Match : SH2 (HMM E-Value=2.7e-22) Length = 699 Score = 29.5 bits (63), Expect = 3.2 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 PPP S PPP PPP P P Sbjct: 387 PPPMSTHPEFTSKPPPPPVASKPPPKPVP 415 >SB_6280| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 29.5 bits (63), Expect = 3.2 Identities = 16/46 (34%), Positives = 17/46 (36%) Frame = -1 Query: 566 GGXXAXXXXXRGGGGGGXSXPXXGGGGXXXXXXXGGGGGXXXPXGG 429 GG A GGGG + GG GGGGG GG Sbjct: 242 GGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGG 287 Score = 29.5 bits (63), Expect = 3.2 Identities = 16/46 (34%), Positives = 17/46 (36%) Frame = -1 Query: 566 GGXXAXXXXXRGGGGGGXSXPXXGGGGXXXXXXXGGGGGXXXPXGG 429 GG A GGGG + GG GGGGG GG Sbjct: 249 GGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGG 294 Score = 29.5 bits (63), Expect = 3.2 Identities = 16/46 (34%), Positives = 17/46 (36%) Frame = -1 Query: 566 GGXXAXXXXXRGGGGGGXSXPXXGGGGXXXXXXXGGGGGXXXPXGG 429 GG A GGGG + GG GGGGG GG Sbjct: 256 GGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGG 301 Score = 29.5 bits (63), Expect = 3.2 Identities = 16/46 (34%), Positives = 17/46 (36%) Frame = -1 Query: 566 GGXXAXXXXXRGGGGGGXSXPXXGGGGXXXXXXXGGGGGXXXPXGG 429 GG A GGGG + GG GGGGG GG Sbjct: 263 GGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGG 308 Score = 29.5 bits (63), Expect = 3.2 Identities = 16/46 (34%), Positives = 17/46 (36%) Frame = -1 Query: 566 GGXXAXXXXXRGGGGGGXSXPXXGGGGXXXXXXXGGGGGXXXPXGG 429 GG A GGGG + GG GGGGG GG Sbjct: 270 GGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGVGGG 315 Score = 28.7 bits (61), Expect = 5.6 Identities = 19/50 (38%), Positives = 19/50 (38%), Gaps = 4/50 (8%) Frame = -1 Query: 566 GGXXAXXXXXRGGGGG--GXSXPXXGGGGXXXXXXXG--GGGGXXXPXGG 429 GG GGGGG G GGGG G GGGG GG Sbjct: 244 GGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGG 293 Score = 28.7 bits (61), Expect = 5.6 Identities = 19/50 (38%), Positives = 19/50 (38%), Gaps = 4/50 (8%) Frame = -1 Query: 566 GGXXAXXXXXRGGGGG--GXSXPXXGGGGXXXXXXXG--GGGGXXXPXGG 429 GG GGGGG G GGGG G GGGG GG Sbjct: 251 GGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGG 300 Score = 28.7 bits (61), Expect = 5.6 Identities = 19/50 (38%), Positives = 19/50 (38%), Gaps = 4/50 (8%) Frame = -1 Query: 566 GGXXAXXXXXRGGGGG--GXSXPXXGGGGXXXXXXXG--GGGGXXXPXGG 429 GG GGGGG G GGGG G GGGG GG Sbjct: 258 GGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGG 307 Score = 28.7 bits (61), Expect = 5.6 Identities = 19/50 (38%), Positives = 19/50 (38%), Gaps = 4/50 (8%) Frame = -1 Query: 566 GGXXAXXXXXRGGGGG--GXSXPXXGGGGXXXXXXXG--GGGGXXXPXGG 429 GG GGGGG G GGGG G GGGG GG Sbjct: 265 GGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGVGG 314 Score = 28.7 bits (61), Expect = 5.6 Identities = 17/48 (35%), Positives = 17/48 (35%), Gaps = 2/48 (4%) Frame = -1 Query: 566 GGXXAXXXXXRGGGGG--GXSXPXXGGGGXXXXXXXGGGGGXXXPXGG 429 GG GGGGG G GGGG G GG GG Sbjct: 293 GGATGGGGGATGGGGGATGVGGGATGGGGGATGGGVGATGGGGGATGG 340 Score = 28.7 bits (61), Expect = 5.6 Identities = 19/48 (39%), Positives = 19/48 (39%), Gaps = 2/48 (4%) Frame = -1 Query: 566 GGXXAXXXXXRGGGGG--GXSXPXXGGGGXXXXXXXGGGGGXXXPXGG 429 GG GGGGG G GGGG GGGGG GG Sbjct: 307 GGATGVGGGATGGGGGATGGGVGATGGGGGAT----GGGGGVTGGGGG 350 Score = 28.3 bits (60), Expect = 7.4 Identities = 17/49 (34%), Positives = 17/49 (34%), Gaps = 3/49 (6%) Frame = -1 Query: 566 GGXXAXXXXXRGGGGG---GXSXPXXGGGGXXXXXXXGGGGGXXXPXGG 429 GG GGGGG G GGGG GGG GG Sbjct: 279 GGATGGGGGATGGGGGATGGGGGATGGGGGATGVGGGATGGGGGATGGG 327 Score = 28.3 bits (60), Expect = 7.4 Identities = 15/45 (33%), Positives = 15/45 (33%) Frame = -2 Query: 565 GGXXXXAXXXGXGGGGGXPPPXXGGGGXXFXXXXGGGGGXXPXGG 431 GG G GGG GGG GGGG GG Sbjct: 283 GGGGGATGGGGGATGGGGGATGGGGGATGVGGGATGGGGGATGGG 327 Score = 27.9 bits (59), Expect = 9.8 Identities = 16/40 (40%), Positives = 16/40 (40%), Gaps = 2/40 (5%) Frame = -2 Query: 535 GXGG--GGGXPPPXXGGGGXXFXXXXGGGGGXXPXGGXXP 422 G GG GGG GGG GGGG GG P Sbjct: 319 GGGGATGGGVGATGGGGGATGGGGGVTGGGGGATGGGGGP 358 >SB_1157| Best HMM Match : RRM_1 (HMM E-Value=1.2e-11) Length = 248 Score = 29.5 bits (63), Expect = 3.2 Identities = 16/46 (34%), Positives = 17/46 (36%) Frame = -1 Query: 566 GGXXAXXXXXRGGGGGGXSXPXXGGGGXXXXXXXGGGGGXXXPXGG 429 GG + R GGGG G GG GGG G GG Sbjct: 183 GGGGSQGGGYRSGGGGYGGSSRGGYGGGRGGGGYGGGRGGGGGYGG 228 Score = 29.5 bits (63), Expect = 3.2 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = -1 Query: 566 GGXXAXXXXXRGGGGGGXSXPXXGGGGXXXXXXXGGGGGXXXPXGG 429 GG GGGG G S GGG GG GG GG Sbjct: 184 GGGSQGGGYRSGGGGYGGSSRGGYGGGRGGGGYGGGRGGGGGYGGG 229 >SB_51034| Best HMM Match : Extensin_2 (HMM E-Value=0.038) Length = 354 Score = 29.1 bits (62), Expect = 4.2 Identities = 14/35 (40%), Positives = 14/35 (40%), Gaps = 3/35 (8%) Frame = +1 Query: 439 GXXXPPPPPXXXKXXXPP---PPXXGXXXPPPPPP 534 G PPPPP P P G PP PPP Sbjct: 70 GGYPPPPPPGPYYQGRPAHWHQPPGGMSYPPAPPP 104 >SB_32093| Best HMM Match : MCM (HMM E-Value=0.004) Length = 348 Score = 29.1 bits (62), Expect = 4.2 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = -2 Query: 565 GGXXXXAXXXGXGGGGGXPPPXXGGGGXXFXXXXGGGGGXXPXG 434 GG G GGGGG GGGG GGGG G Sbjct: 77 GGGCDGGGGDGDGGGGGD---GDGGGGGDGGGGGDGGGGNDDDG 117 Score = 29.1 bits (62), Expect = 4.2 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -1 Query: 533 GGGGGGXSXPXXGGGGXXXXXXXGGGGGXXXPXGG 429 GGG G GGGG GG GG GG Sbjct: 77 GGGCDGGGGDGDGGGGGDGDGGGGGDGGGGGDGGG 111 Score = 28.3 bits (60), Expect = 7.4 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = -1 Query: 566 GGXXAXXXXXRGGGGGGXSXPXXGGGGXXXXXXXGGGGG 450 GG G G GG GGGG GGGG Sbjct: 74 GGDGGGCDGGGGDGDGGGGGDGDGGGGGDGGGGGDGGGG 112 Score = 28.3 bits (60), Expect = 7.4 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 2/37 (5%) Frame = -2 Query: 535 GXGGG--GGXPPPXXGGGGXXFXXXXGGGGGXXPXGG 431 G GGG GG GGGG G GGG GG Sbjct: 75 GDGGGCDGGGGDGDGGGGGDGDGGGGGDGGGGGDGGG 111 Score = 28.3 bits (60), Expect = 7.4 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -1 Query: 533 GGGGGGXSXPXXGGGGXXXXXXXGGGGGXXXPXGG 429 GG GG GGGG G GGG GG Sbjct: 78 GGCDGGGGDGDGGGGGDGDGGGGGDGGGGGDGGGG 112 >SB_58158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 883 Score = 29.1 bits (62), Expect = 4.2 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = -2 Query: 565 GGXXXXAXXXGXGGGGGXPPPXXGGGGXXFXXXXGGGGGXXPXG 434 GG G GGGGG GGGG GGGG G Sbjct: 92 GGGCDGGGGDGDGGGGGD---GDGGGGGDGGGGGDGGGGNDDDG 132 Score = 29.1 bits (62), Expect = 4.2 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -1 Query: 533 GGGGGGXSXPXXGGGGXXXXXXXGGGGGXXXPXGG 429 GGG G GGGG GG GG GG Sbjct: 92 GGGCDGGGGDGDGGGGGDGDGGGGGDGGGGGDGGG 126 Score = 28.3 bits (60), Expect = 7.4 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = -1 Query: 566 GGXXAXXXXXRGGGGGGXSXPXXGGGGXXXXXXXGGGGG 450 GG G G GG GGGG GGGG Sbjct: 89 GGDGGGCDGGGGDGDGGGGGDGDGGGGGDGGGGGDGGGG 127 Score = 28.3 bits (60), Expect = 7.4 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 2/37 (5%) Frame = -2 Query: 535 GXGGG--GGXPPPXXGGGGXXFXXXXGGGGGXXPXGG 431 G GGG GG GGGG G GGG GG Sbjct: 90 GDGGGCDGGGGDGDGGGGGDGDGGGGGDGGGGGDGGG 126 Score = 28.3 bits (60), Expect = 7.4 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -1 Query: 533 GGGGGGXSXPXXGGGGXXXXXXXGGGGGXXXPXGG 429 GG GG GGGG G GGG GG Sbjct: 93 GGCDGGGGDGDGGGGGDGDGGGGGDGGGGGDGGGG 127 >SB_30592| Best HMM Match : MAM (HMM E-Value=2.66247e-44) Length = 667 Score = 29.1 bits (62), Expect = 4.2 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +1 Query: 439 GXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPP 534 G PPP P PPP PPP P Sbjct: 426 GTATPPPTPPPTPPPTPPPTTLPPTTQPPPQP 457 >SB_21461| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 29.1 bits (62), Expect = 4.2 Identities = 16/40 (40%), Positives = 17/40 (42%), Gaps = 2/40 (5%) Frame = +3 Query: 423 GXXPPXGXXP-PPPPXXXXXXSPPPPXXGGGXPPP-PPXP 536 G PP P PPP +PPP G PPP P P Sbjct: 41 GDRPPNTPIPGDPPPNIPIPGNPPPNTPIPGDPPPNTPIP 80 Score = 29.1 bits (62), Expect = 4.2 Identities = 16/40 (40%), Positives = 17/40 (42%), Gaps = 2/40 (5%) Frame = +3 Query: 423 GXXPPXGXXP-PPPPXXXXXXSPPPPXXGGGXPPP-PPXP 536 G PP P PPP +PPP G PPP P P Sbjct: 71 GDPPPNTPIPGDPPPNTPIPGNPPPNTPIPGDPPPNTPIP 110 Score = 28.7 bits (61), Expect = 5.6 Identities = 16/40 (40%), Positives = 16/40 (40%), Gaps = 2/40 (5%) Frame = +3 Query: 423 GXXPPXGXXP-PPPPXXXXXXSPPPPXXGGGXPPP-PPXP 536 G PP P PPP PPP G PPP P P Sbjct: 61 GNPPPNTPIPGDPPPNTPIPGDPPPNTPIPGNPPPNTPIP 100 Score = 27.9 bits (59), Expect = 9.8 Identities = 14/35 (40%), Positives = 14/35 (40%), Gaps = 1/35 (2%) Frame = +3 Query: 423 GXXPPXGXXP-PPPPXXXXXXSPPPPXXGGGXPPP 524 G PP P PPP PPP G PPP Sbjct: 81 GDPPPNTPIPGNPPPNTPIPGDPPPNTPIPGDPPP 115 >SB_6245| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1000 Score = 29.1 bits (62), Expect = 4.2 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPP 531 P P P PP P PPPPP Sbjct: 788 PAPAPFSAAPHLPPAPNISAEPPPPPP 814 Score = 28.7 bits (61), Expect = 5.6 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +3 Query: 450 PPPPPXXXXXXSPPPPXXGGGXPPPPP 530 P P P PP P PPPPP Sbjct: 788 PAPAPFSAAPHLPPAPNISAEPPPPPP 814 Score = 28.3 bits (60), Expect = 7.4 Identities = 16/49 (32%), Positives = 16/49 (32%), Gaps = 4/49 (8%) Frame = +3 Query: 432 PPXGXXPPP----PPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 P PPP PP PP P P PP P A PP Sbjct: 765 PQFAPVPPPCAPIPPMPCSAPLPPAPAPFSAAPHLPPAPNISAEPPPPP 813 >SB_3200| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 29.1 bits (62), Expect = 4.2 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +3 Query: 489 PPPXXGGGXPPPPPXP 536 PPP GG PPP P P Sbjct: 6 PPPNYGGAYPPPVPAP 21 >SB_58920| Best HMM Match : GRP (HMM E-Value=0.35) Length = 243 Score = 28.7 bits (61), Expect = 5.6 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -2 Query: 535 GXGGGGGXPPPXXGGGGXXFXXXXGGGGGXXPXGG 431 G GGGG GGGG GGG GG Sbjct: 98 GSNGGGGDDDGSNGGGGDDDGSNGGGGDDDGSNGG 132 Score = 28.7 bits (61), Expect = 5.6 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -2 Query: 535 GXGGGGGXPPPXXGGGGXXFXXXXGGGGGXXPXGG 431 G GGGG GGGG GGG GG Sbjct: 108 GSNGGGGDDDGSNGGGGDDDGSNGGGGDDDGSNGG 142 Score = 28.3 bits (60), Expect = 7.4 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = -1 Query: 533 GGGGGGXSXPXXGGGGXXXXXXXGGGGGXXXPXGG 429 G GGG GGG GGGG GG Sbjct: 98 GSNGGGGDDDGSNGGGGDDDGSNGGGGDDDGSNGG 132 Score = 28.3 bits (60), Expect = 7.4 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = -1 Query: 533 GGGGGGXSXPXXGGGGXXXXXXXGGGGGXXXPXGG 429 G GGG GGG GGGG GG Sbjct: 108 GSNGGGGDDDGSNGGGGDDDGSNGGGGDDDGSNGG 142 >SB_48719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1880 Score = 28.7 bits (61), Expect = 5.6 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = -1 Query: 566 GGXXAXXXXXRGGGGGGXSXPXXGGGGXXXXXXXGGGGGXXXPXGG 429 GG RGGG GG GG G GGGG GG Sbjct: 145 GGIGRGGGRGRGGGEGGWGG--RGGNGGGRGGGEGGGGRGRGTGGG 188 Score = 28.3 bits (60), Expect = 7.4 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = -2 Query: 565 GGXXXXAXXXGXGGGGGXPPPXXGGGGXXFXXXXGGGGGXXPXGG 431 GG G GGG G G GG GGG G GG Sbjct: 144 GGGIGRGGGRGRGGGEGGWGGRGGNGGGRGGGEGGGGRGRGTGGG 188 Score = 28.3 bits (60), Expect = 7.4 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 3/39 (7%) Frame = -1 Query: 536 RGGGGGGXSXPXXGGG---GXXXXXXXGGGGGXXXPXGG 429 RGG GGG GGG G GGG G GG Sbjct: 165 RGGNGGGRGGGEGGGGRGRGTGGGSRGGGGDGRGRGRGG 203 >SB_24696| Best HMM Match : F5_F8_type_C (HMM E-Value=0.00023) Length = 547 Score = 28.7 bits (61), Expect = 5.6 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = -1 Query: 566 GGXXAXXXXXRGGGGGGXSXPXXGGGGXXXXXXXGGGGG 450 GG GGGGG S GGG GGGGG Sbjct: 358 GGGGGSEDNGASGGGGGYS----GGGSGITWNQAGGGGG 392 >SB_20622| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) Length = 276 Score = 28.7 bits (61), Expect = 5.6 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +1 Query: 433 PXGXXXPPPPPXXXKXXXPPPPXXG 507 P PPPPP PPPP G Sbjct: 62 PIPPTLPPPPPPPPPPLPPPPPSGG 86 >SB_19519| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 401 Score = 28.7 bits (61), Expect = 5.6 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = +1 Query: 457 PPPXXXKXXXPPPPXXGXXXPPPPPP 534 PPP PPPP G PPPPPP Sbjct: 197 PPPSGA----PPPPPIG--APPPPPP 216 Score = 28.3 bits (60), Expect = 7.4 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = +3 Query: 456 PPPXXXXXXSPPPPXXGGGXPPPP 527 PPP +PPPP G PPPP Sbjct: 197 PPPSG----APPPPPIGAPPPPPP 216 >SB_11868| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) Length = 500 Score = 28.7 bits (61), Expect = 5.6 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +1 Query: 433 PXGXXXPPPPPXXXKXXXPPPPXXG 507 P PPPPP PPPP G Sbjct: 286 PIPPTLPPPPPPPPPPLPPPPPSGG 310 >SB_50413| Best HMM Match : GRP (HMM E-Value=0.15) Length = 487 Score = 28.7 bits (61), Expect = 5.6 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 2/38 (5%) Frame = -1 Query: 536 RGGGGGGXSXPXXGGGGXXXXXXXGGG--GGXXXPXGG 429 RGG GGG GGG GGG GG GG Sbjct: 442 RGGDGGGDGGGGGDGGGDGIDGGDGGGDGGGDGGGDGG 479 Score = 27.9 bits (59), Expect = 9.8 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -2 Query: 535 GXGGGGGXPPPXXGGGGXXFXXXXGGGGGXXPXGG 431 G GGG G GG G GGG G GG Sbjct: 450 GGGGGDGGGDGIDGGDGGGDGGGDGGGDGGGDGGG 484 >SB_32600| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1572 Score = 28.7 bits (61), Expect = 5.6 Identities = 16/48 (33%), Positives = 16/48 (33%), Gaps = 3/48 (6%) Frame = +3 Query: 432 PPXGXXPPP---PPXXXXXXSPPPPXXGGGXPPPPPXPXXXAXXXXPP 566 PP G PPP PP PP G PP P PP Sbjct: 317 PPPGMGPPPRIPPPPIRAPVDVYPPRAPQGASQTPPYPGSHYSRVPPP 364 Score = 28.7 bits (61), Expect = 5.6 Identities = 14/36 (38%), Positives = 14/36 (38%), Gaps = 1/36 (2%) Frame = +1 Query: 430 PPXGXXXPP-PPPXXXKXXXPPPPXXGXXXPPPPPP 534 PP G P PPP PPP PPP P Sbjct: 432 PPPGAPHPRFPPPGAPHPRVPPPGAPHPRVPPPGAP 467 Score = 28.7 bits (61), Expect = 5.6 Identities = 14/36 (38%), Positives = 14/36 (38%), Gaps = 1/36 (2%) Frame = +1 Query: 430 PPXGXXXP-PPPPXXXKXXXPPPPXXGXXXPPPPPP 534 PP G P PPP PPP PPP P Sbjct: 442 PPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAP 477 Score = 28.7 bits (61), Expect = 5.6 Identities = 14/36 (38%), Positives = 14/36 (38%), Gaps = 1/36 (2%) Frame = +1 Query: 430 PPXGXXXP-PPPPXXXKXXXPPPPXXGXXXPPPPPP 534 PP G P PPP PPP PPP P Sbjct: 452 PPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAP 487 Score = 28.7 bits (61), Expect = 5.6 Identities = 14/36 (38%), Positives = 14/36 (38%), Gaps = 1/36 (2%) Frame = +1 Query: 430 PPXGXXXP-PPPPXXXKXXXPPPPXXGXXXPPPPPP 534 PP G P PPP PPP PPP P Sbjct: 462 PPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAP 497 Score = 28.7 bits (61), Expect = 5.6 Identities = 14/36 (38%), Positives = 14/36 (38%), Gaps = 1/36 (2%) Frame = +1 Query: 430 PPXGXXXP-PPPPXXXKXXXPPPPXXGXXXPPPPPP 534 PP G P PPP PPP PPP P Sbjct: 472 PPPGAPHPRVPPPGAPHPRVPPPGAPHQRVPPPGAP 507 Score = 28.7 bits (61), Expect = 5.6 Identities = 14/36 (38%), Positives = 14/36 (38%), Gaps = 1/36 (2%) Frame = +1 Query: 430 PPXGXXXP-PPPPXXXKXXXPPPPXXGXXXPPPPPP 534 PP G P PPP PPP PPP P Sbjct: 482 PPPGAPHPRVPPPGAPHQRVPPPGAPHPRVPPPGAP 517 Score = 28.7 bits (61), Expect = 5.6 Identities = 14/36 (38%), Positives = 14/36 (38%), Gaps = 1/36 (2%) Frame = +1 Query: 430 PPXGXXXP-PPPPXXXKXXXPPPPXXGXXXPPPPPP 534 PP G P PPP PPP PPP P Sbjct: 502 PPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAP 537 Score = 28.7 bits (61), Expect = 5.6 Identities = 14/36 (38%), Positives = 14/36 (38%), Gaps = 1/36 (2%) Frame = +1 Query: 430 PPXGXXXP-PPPPXXXKXXXPPPPXXGXXXPPPPPP 534 PP G P PPP PPP PPP P Sbjct: 512 PPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAP 547 Score = 28.7 bits (61), Expect = 5.6 Identities = 14/36 (38%), Positives = 14/36 (38%), Gaps = 1/36 (2%) Frame = +1 Query: 430 PPXGXXXP-PPPPXXXKXXXPPPPXXGXXXPPPPPP 534 PP G P PPP PPP PPP P Sbjct: 532 PPPGAPHPRVPPPGAPHPRVPPPGASHPRVPPPGAP 567 Score = 28.7 bits (61), Expect = 5.6 Identities = 14/36 (38%), Positives = 14/36 (38%), Gaps = 1/36 (2%) Frame = +1 Query: 430 PPXGXXXP-PPPPXXXKXXXPPPPXXGXXXPPPPPP 534 PP G P PPP PPP PPP P Sbjct: 542 PPPGAPHPRVPPPGASHPRVPPPGAPHPRVPPPGAP 577 Score = 28.7 bits (61), Expect = 5.6 Identities = 14/36 (38%), Positives = 14/36 (38%), Gaps = 1/36 (2%) Frame = +1 Query: 430 PPXGXXXP-PPPPXXXKXXXPPPPXXGXXXPPPPPP 534 PP G P PPP PPP PPP P Sbjct: 552 PPPGASHPRVPPPGAPHPRVPPPGAPHPRVPPPGTP 587 Score = 28.7 bits (61), Expect = 5.6 Identities = 14/36 (38%), Positives = 14/36 (38%), Gaps = 1/36 (2%) Frame = +1 Query: 430 PPXGXXXP-PPPPXXXKXXXPPPPXXGXXXPPPPPP 534 PP G P PPP PPP PPP P Sbjct: 562 PPPGAPHPRVPPPGAPHPRVPPPGTPHPRVPPPGAP 597 Score = 28.7 bits (61), Expect = 5.6 Identities = 14/36 (38%), Positives = 14/36 (38%), Gaps = 1/36 (2%) Frame = +1 Query: 430 PPXGXXXP-PPPPXXXKXXXPPPPXXGXXXPPPPPP 534 PP G P PPP PPP PPP P Sbjct: 572 PPPGAPHPRVPPPGTPHPRVPPPGAPHPKVPPPGAP 607 Score = 27.9 bits (59), Expect = 9.8 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +1 Query: 430 PPXGXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPP 534 PP G P PP PPP G P PPP Sbjct: 522 PPPGAPHPRVPPPGAPHPRVPPP--GAPHPRVPPP 554 >SB_26709| Best HMM Match : CtnDOT_TraJ (HMM E-Value=8.8) Length = 291 Score = 28.7 bits (61), Expect = 5.6 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = -1 Query: 566 GGXXAXXXXXRGGGGGGXSXPXXGGGGXXXXXXXGGGGG 450 GG GGGGG S GGG GGGGG Sbjct: 228 GGGGGSEDNGASGGGGGYS----GGGSGTHSGQAGGGGG 262 >SB_10945| Best HMM Match : Pinin_SDK_memA (HMM E-Value=8.9) Length = 280 Score = 28.3 bits (60), Expect = 7.4 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = -1 Query: 536 RGGGGGGXSXPXXGGGGXXXXXXXGGGGGXXXPXG 432 R GGGGG + G GGGGG P G Sbjct: 159 RPGGGGGGTFVVKMDGTPLLIAGGGGGGGIPPPAG 193 >SB_47680| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2749 Score = 28.3 bits (60), Expect = 7.4 Identities = 11/28 (39%), Positives = 11/28 (39%) Frame = +1 Query: 451 PPPPPXXXKXXXPPPPXXGXXXPPPPPP 534 PP PP P G PP PPP Sbjct: 364 PPSPPESYNSEPEDSPLVGPSKPPTPPP 391 >SB_25368| Best HMM Match : PID (HMM E-Value=2.7e-22) Length = 1197 Score = 28.3 bits (60), Expect = 7.4 Identities = 14/39 (35%), Positives = 15/39 (38%), Gaps = 4/39 (10%) Frame = +1 Query: 430 PPXGXXXPPPP----PXXXKXXXPPPPXXGXXXPPPPPP 534 PP PPPP + P G PPPPPP Sbjct: 880 PPKSDTPPPPPRPAADESQEMSRTRGPKDGRKPPPPPPP 918 >SB_25090| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1170 Score = 28.3 bits (60), Expect = 7.4 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -1 Query: 533 GGGGGGXSXPXXGGGGXXXXXXXGGGGG 450 GG GG S GG G GGGGG Sbjct: 435 GGSFGGSSGGSFGGSGFGSKSSGGGGGG 462 >SB_7937| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 618 Score = 28.3 bits (60), Expect = 7.4 Identities = 16/52 (30%), Positives = 16/52 (30%) Frame = +3 Query: 381 PPRGGGGGXXFXXXGXXPPXGXXPPPPPXXXXXXSPPPPXXGGGXPPPPPXP 536 P G G G PP PP P PPP G P P P Sbjct: 388 PKEDWGPGPRGMGPGMGPPRPMGPPGPHGPPFGPRGPPPHGGPPRGPMGPGP 439 >SB_46050| Best HMM Match : RRM_1 (HMM E-Value=1.7e-33) Length = 392 Score = 27.9 bits (59), Expect = 9.8 Identities = 13/33 (39%), Positives = 14/33 (42%), Gaps = 1/33 (3%) Frame = +1 Query: 430 PPXGXXXPPP-PPXXXKXXXPPPPXXGXXXPPP 525 PP G P PP + P PP G PPP Sbjct: 221 PPQGESHGQPGPPALLQQGPPGPPFHGEPRPPP 253 >SB_43284| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 519 Score = 27.9 bits (59), Expect = 9.8 Identities = 17/47 (36%), Positives = 18/47 (38%), Gaps = 2/47 (4%) Frame = -2 Query: 565 GGXXXXAXXXGXGGGGGXPPPXXGGGGXXFXXXXGGGG--GXXPXGG 431 GG + GG GG GGGG GGGG G GG Sbjct: 169 GGGSNGSGGGDDGGDGGDDGGGSGGGGDDGGSDGGGGGNDGGRDDGG 215 >SB_33565| Best HMM Match : SET (HMM E-Value=3.99931e-42) Length = 601 Score = 27.9 bits (59), Expect = 9.8 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -2 Query: 535 GXGGGGGXPPPXXGGGGXXFXXXXGGGGGXXPXGG 431 G G GGG GGGG GGG G G Sbjct: 304 GDGDGGGGGDGGGGGGGGGGGGGDGGGDGDGDGDG 338 >SB_26939| Best HMM Match : Drf_FH1 (HMM E-Value=9.2) Length = 188 Score = 27.9 bits (59), Expect = 9.8 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +1 Query: 487 PPPPXXGXXXPPPPPPL 537 PPPP PPP PPL Sbjct: 31 PPPPSPPPSPPPPSPPL 47 Score = 27.9 bits (59), Expect = 9.8 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +1 Query: 487 PPPPXXGXXXPPPPPPL 537 PPPP PPP PPL Sbjct: 154 PPPPSPPPSPPPPSPPL 170 >SB_26646| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 27.9 bits (59), Expect = 9.8 Identities = 15/46 (32%), Positives = 15/46 (32%) Frame = -1 Query: 566 GGXXAXXXXXRGGGGGGXSXPXXGGGGXXXXXXXGGGGGXXXPXGG 429 GG GG G G G GG GGG G GG Sbjct: 36 GGGVGGGGGNGGGAGNGVGAGGCGCGGGNDGGNGGGGAGNGGGGGG 81 >SB_5433| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1554 Score = 27.9 bits (59), Expect = 9.8 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -1 Query: 536 RGGGGGGXSXPXXGGGGXXXXXXXGGGGG 450 R GGGG GGG GGGGG Sbjct: 23 RDGGGGHGGGHGYGGGPNGGGGGGGGGGG 51 >SB_5243| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 924 Score = 27.9 bits (59), Expect = 9.8 Identities = 14/28 (50%), Positives = 14/28 (50%), Gaps = 1/28 (3%) Frame = +1 Query: 457 PPPXXXKXXXPPPPXXGXXXPPPP-PPL 537 PPP PPPP PPPP PPL Sbjct: 784 PPPEYP----PPPPGLARPNPPPPNPPL 807 >SB_56440| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1142 Score = 27.9 bits (59), Expect = 9.8 Identities = 17/50 (34%), Positives = 18/50 (36%), Gaps = 1/50 (2%) Frame = +3 Query: 384 PRGGGGGXXFXXXGXXPPXGXXP-PPPPXXXXXXSPPPPXXGGGXPPPPP 530 P GG G F P G P PP +P PP G P PP Sbjct: 231 PYPGGVGEGFRGLRSYPLNGRKSNPNPPLNGRKSNPNPPLNGRKSNPNPP 280 >SB_45599| Best HMM Match : GRP (HMM E-Value=0.22) Length = 595 Score = 27.9 bits (59), Expect = 9.8 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -1 Query: 536 RGGGGGGXSXPXXGGGG 486 RGGGGGG GGGG Sbjct: 513 RGGGGGGGGGGGGGGGG 529 >SB_39475| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 333 Score = 27.9 bits (59), Expect = 9.8 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = -3 Query: 312 PPXKKXPPPPPXGGXG 265 PP ++ PPPPP G G Sbjct: 254 PPRQEHPPPPPPGSRG 269 >SB_38456| Best HMM Match : BTB (HMM E-Value=8.8e-26) Length = 1410 Score = 27.9 bits (59), Expect = 9.8 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 2/36 (5%) Frame = +3 Query: 435 PXGXXPPPP--PXXXXXXSPPPPXXGGGXPPPPPXP 536 P PP P P PPPP PPPPP P Sbjct: 340 PTTPQPPTPTTPKTHPQLGPPPP-----PPPPPPTP 370 >SB_37045| Best HMM Match : Drf_FH1 (HMM E-Value=0.95) Length = 1080 Score = 27.9 bits (59), Expect = 9.8 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = -1 Query: 536 RGGGGGGXSXPXXGGGGXXXXXXXGGGGG 450 RGGGGGG GGGG GG GG Sbjct: 1002 RGGGGGG------GGGGGGGGGRRGGRGG 1024 >SB_23696| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 559 Score = 27.9 bits (59), Expect = 9.8 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -2 Query: 547 AXXXGXGGGGGXPPPXXGGGGXXFXXXXGGGGGXXPXG 434 A G G G P GGGG GGGGG G Sbjct: 402 AVREGLRGEEGSPSVFLGGGGRGGGGGDGGGGGEGVQG 439 >SB_15225| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 246 Score = 27.9 bits (59), Expect = 9.8 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = -1 Query: 533 GGGGGGXSXPXXGGGGXXXXXXXGGGGGXXXPXGG 429 G GGGG + GGGG GGG GG Sbjct: 142 GMGGGGMAGEGMGGGGMAGEGMGGGGIAGEGISGG 176 >SB_11420| Best HMM Match : MBOAT (HMM E-Value=6.9e-06) Length = 628 Score = 27.9 bits (59), Expect = 9.8 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +1 Query: 439 GXXXPPPPPXXXKXXXPPPPXXGXXXPPPPPPL 537 G PPPPP PPPP PPPPP L Sbjct: 207 GDAKPPPPP-------PPPP------PPPPPML 226 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.313 0.147 0.512 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,763,773 Number of Sequences: 59808 Number of extensions: 491036 Number of successful extensions: 11030 Number of sequences better than 10.0: 138 Number of HSP's better than 10.0 without gapping: 700 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4836 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2143884611 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.8 bits)
- SilkBase 1999-2023 -