BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_FL5_O03 (846 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF442747-1|AAL40947.1| 669|Tribolium castaneum ABC transmembran... 23 3.0 AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembran... 23 3.0 AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept... 21 9.3 >AF442747-1|AAL40947.1| 669|Tribolium castaneum ABC transmembrane transporter protein. Length = 669 Score = 23.0 bits (47), Expect = 3.0 Identities = 12/30 (40%), Positives = 15/30 (50%) Frame = +3 Query: 129 HTXAAVTQEGYRSVNKTIKSSNQLPMSSSY 218 HT + +T G R VN SS L S+Y Sbjct: 127 HTSSNLTVSGLRCVNGIPVSSKTLASQSAY 156 Score = 22.2 bits (45), Expect = 5.3 Identities = 13/38 (34%), Positives = 18/38 (47%) Frame = -3 Query: 673 VYKMFKAKGLMLFGLSEILGTHKFSELSIVSLKVSCGR 560 VY MF LM G + LG+ + +E L+ C R Sbjct: 283 VYSMFDKLLLMSEGRTAFLGSPEEAETFFRELEAPCPR 320 >AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembrane transporter white protein. Length = 669 Score = 23.0 bits (47), Expect = 3.0 Identities = 12/30 (40%), Positives = 15/30 (50%) Frame = +3 Query: 129 HTXAAVTQEGYRSVNKTIKSSNQLPMSSSY 218 HT + +T G R VN SS L S+Y Sbjct: 127 HTSSNLTVSGLRCVNGIPVSSKTLASQSAY 156 Score = 22.2 bits (45), Expect = 5.3 Identities = 13/38 (34%), Positives = 18/38 (47%) Frame = -3 Query: 673 VYKMFKAKGLMLFGLSEILGTHKFSELSIVSLKVSCGR 560 VY MF LM G + LG+ + +E L+ C R Sbjct: 283 VYSMFDKLLLMSEGRTAFLGSPEEAETFFRELEAPCPR 320 >AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor candidate 46 protein. Length = 1451 Score = 21.4 bits (43), Expect = 9.3 Identities = 8/16 (50%), Positives = 12/16 (75%) Frame = -2 Query: 383 AVVYISKFLYVACEIL 336 A+VY S ++V CE+L Sbjct: 412 ALVYCSLAIFVLCELL 427 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 183,917 Number of Sequences: 336 Number of extensions: 3862 Number of successful extensions: 12 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 23348025 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -