BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_FL5_O01 (849 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g02590.1 68417.m00353 basic helix-loop-helix (bHLH) family pr... 30 2.2 At2g30900.1 68415.m03766 expressed protein 29 5.2 At3g55220.1 68416.m06133 splicing factor, putative contains CPSF... 28 6.8 At3g55200.1 68416.m06131 splicing factor, putative contains CPSF... 28 6.8 At4g32420.1 68417.m04615 peptidyl-prolyl cis-trans isomerase cyc... 28 9.0 >At4g02590.1 68417.m00353 basic helix-loop-helix (bHLH) family protein similar to A. thaliana putative protein F6I18.110, GenBank accession number 2980768 Length = 310 Score = 29.9 bits (64), Expect = 2.2 Identities = 17/41 (41%), Positives = 21/41 (51%) Frame = -1 Query: 222 LGLTNVSMSQMQGQVDYDFGVGGGSPDRTLRGASRS*GTVM 100 LGL N S S G D G+GGG+P L+ S G+ M Sbjct: 24 LGLPNFSASSAAGLSGVDGGLGGGAPPMMLQLGSGEEGSHM 64 >At2g30900.1 68415.m03766 expressed protein Length = 367 Score = 28.7 bits (61), Expect = 5.2 Identities = 14/41 (34%), Positives = 23/41 (56%) Frame = -3 Query: 181 G*LRFWSRGGESRSYVARSESIMRDSDVAFSHSAALAIAQV 59 G R WS+ G S + ++ IM S +A H+A + +A+V Sbjct: 266 GRAREWSKQGGKGSCIGETKPIMGSSYLAGPHAAEMVVAKV 306 >At3g55220.1 68416.m06133 splicing factor, putative contains CPSF A subunit region (PF03178); contains weak WD-40 repeat (PF00400); similar to Splicing factor 3B subunit 3 (SF3b130)/spliceosomal protein/Splicing factor 3B subunit 3 (SAP 130)(KIAA0017)(SP:Q15393) Homo sapiens, EMBL:HSAJ1443_1 Length = 1214 Score = 28.3 bits (60), Expect = 6.8 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = -3 Query: 400 GRGERSPRRWLQPRLAVPRQASTSVPRTPA 311 GRG RS R L+P LA+ A + +P P+ Sbjct: 426 GRGPRSSLRILRPGLAITEMAVSQLPGQPS 455 >At3g55200.1 68416.m06131 splicing factor, putative contains CPSF A subunit region (PF03178); contains weak WD-40 repeat (PF00400); similar to Splicing factor 3B subunit 3 (SF3b130)/spliceosomal protein/Splicing factor 3B subunit 3 (SAP 130)(KIAA0017)(SP:Q15393) Homo sapiens, EMBL:HSAJ1443_1 Length = 1214 Score = 28.3 bits (60), Expect = 6.8 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = -3 Query: 400 GRGERSPRRWLQPRLAVPRQASTSVPRTPA 311 GRG RS R L+P LA+ A + +P P+ Sbjct: 426 GRGPRSSLRILRPGLAITEMAVSQLPGQPS 455 >At4g32420.1 68417.m04615 peptidyl-prolyl cis-trans isomerase cyclophilin-type family protein weak similarity to CARS-Cyp [Homo sapiens] GI:1117968; contains Pfam profile PF00160: peptidyl-prolyl cis-trans isomerase, cyclophilin-type Length = 837 Score = 27.9 bits (59), Expect = 9.0 Identities = 35/106 (33%), Positives = 47/106 (44%), Gaps = 6/106 (5%) Frame = -3 Query: 388 RSPRRWLQPRLAVPRQASTSVPRTPAKCCSPTPLRS-NSVVCRSNSFEDLPVFARWTRTH 212 RSP + + R V + + R+P+K S +PLRS V+ RS PV R R+ Sbjct: 445 RSPTKSVS-RSPVRVKKERDISRSPSKSLSRSPLRSPKRVISRS------PVRGRIARSP 497 Query: 211 EC*HVSNA-----GSG*LRFWSRGGESRSYVARSESIMRDSDVAFS 89 V +A G G LR SR SRS V S + S + S Sbjct: 498 SRSPVRSASRGSLGRGPLRRSSRRSPSRSPVRSSRRSLSRSPIQLS 543 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,230,407 Number of Sequences: 28952 Number of extensions: 350197 Number of successful extensions: 1066 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1011 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1060 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1970388800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -