BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_FL5_N24 (899 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_33418| Best HMM Match : IQ (HMM E-Value=1.6) 29 6.8 SB_20654| Best HMM Match : Helicase_C (HMM E-Value=2.3e-21) 28 8.9 SB_9715| Best HMM Match : F5_F8_type_C (HMM E-Value=2.4e-22) 28 8.9 >SB_33418| Best HMM Match : IQ (HMM E-Value=1.6) Length = 344 Score = 28.7 bits (61), Expect = 6.8 Identities = 11/26 (42%), Positives = 18/26 (69%) Frame = +1 Query: 655 QDLXTGELVAENFKIXSDSIPNNXTR 732 Q + GEL+ EN+K+ ++ I N+ TR Sbjct: 11 QQVEEGELLVENYKLTTEMIENSCTR 36 >SB_20654| Best HMM Match : Helicase_C (HMM E-Value=2.3e-21) Length = 1728 Score = 28.3 bits (60), Expect = 8.9 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +1 Query: 277 QQKKKHYADQNTSSGTPQERECSIRKSCNNVSVTSMED 390 ++KKK +A Q SG+ E EC K+CN +E+ Sbjct: 1554 ERKKKKFA-QVIDSGSEDEFECDYTKACNPKKQEKVEE 1590 >SB_9715| Best HMM Match : F5_F8_type_C (HMM E-Value=2.4e-22) Length = 431 Score = 28.3 bits (60), Expect = 8.9 Identities = 10/31 (32%), Positives = 19/31 (61%) Frame = -3 Query: 345 AAFTFLWRTTTSILICIMFFFLLYFEHVQTR 253 A TF W +++L+ ++ F LYF +++ R Sbjct: 240 ATGTFFWILVSALLLAMLVFMFLYFCYIRKR 270 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,797,017 Number of Sequences: 59808 Number of extensions: 453159 Number of successful extensions: 982 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 907 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 981 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2586032617 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -