BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_FL5_N24 (899 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. 25 2.4 DQ219482-1|ABB29886.1| 545|Anopheles gambiae cryptochrome 1 pro... 23 9.6 >AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. Length = 3398 Score = 25.4 bits (53), Expect = 2.4 Identities = 16/75 (21%), Positives = 32/75 (42%) Frame = +1 Query: 259 LNMFEVQQKKKHYADQNTSSGTPQERECSIRKSCNNVSVTSMEDLSHEEIVTSYVLAHVA 438 LN +QK+K Y Q +SG E++ +K + ++++S + + ++ Sbjct: 993 LNNSLTEQKQKSYK-QIDASGEAVEKKAQYKKEVDEKFAEEVDNISQTVVSKAQFAMDLS 1051 Query: 439 QFDCRRHHMAFTNGN 483 QF + GN Sbjct: 1052 QFGVLTNQHGVVTGN 1066 >DQ219482-1|ABB29886.1| 545|Anopheles gambiae cryptochrome 1 protein. Length = 545 Score = 23.4 bits (48), Expect = 9.6 Identities = 8/24 (33%), Positives = 16/24 (66%) Frame = +1 Query: 328 QERECSIRKSCNNVSVTSMEDLSH 399 +ER+ ++ K C + V +E++SH Sbjct: 115 KERDDAVAKLCRTMDVRCVENVSH 138 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 786,920 Number of Sequences: 2352 Number of extensions: 14246 Number of successful extensions: 23 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 22 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 23 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 97160985 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -