BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_FL5_N21 (853 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g31830.1 68415.m03887 endonuclease/exonuclease/phosphatase fa... 29 3.0 At3g55220.1 68416.m06133 splicing factor, putative contains CPSF... 28 6.9 At3g55200.1 68416.m06131 splicing factor, putative contains CPSF... 28 6.9 >At2g31830.1 68415.m03887 endonuclease/exonuclease/phosphatase family protein belongs to Pfam:PF03372: Endonuclease/Exonuclease/phosphatase family; contains 4 WD-40 repeats (PF00400);similar to SP:Q01968 Inositol polyphosphate 5-phosphatase OCRL-1 (EC 3.1.3.-)(Lowe's oculocerebrorenal syndrome protein) (SP:Q01968) [Homo sapiens] Length = 1144 Score = 29.5 bits (63), Expect = 3.0 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = +1 Query: 541 FVIDKRYVRXXSVGCDGSVXCGAXPGTVARW 633 F D R V ++ DGS+ G+ G +A+W Sbjct: 443 FAEDTRKVEAIAIAADGSIWTGSMNGVIAQW 473 >At3g55220.1 68416.m06133 splicing factor, putative contains CPSF A subunit region (PF03178); contains weak WD-40 repeat (PF00400); similar to Splicing factor 3B subunit 3 (SF3b130)/spliceosomal protein/Splicing factor 3B subunit 3 (SAP 130)(KIAA0017)(SP:Q15393) Homo sapiens, EMBL:HSAJ1443_1 Length = 1214 Score = 28.3 bits (60), Expect = 6.9 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = -1 Query: 394 GRGERSPRRWLQPRLAVPRQASTSVPRTPA 305 GRG RS R L+P LA+ A + +P P+ Sbjct: 426 GRGPRSSLRILRPGLAITEMAVSQLPGQPS 455 >At3g55200.1 68416.m06131 splicing factor, putative contains CPSF A subunit region (PF03178); contains weak WD-40 repeat (PF00400); similar to Splicing factor 3B subunit 3 (SF3b130)/spliceosomal protein/Splicing factor 3B subunit 3 (SAP 130)(KIAA0017)(SP:Q15393) Homo sapiens, EMBL:HSAJ1443_1 Length = 1214 Score = 28.3 bits (60), Expect = 6.9 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = -1 Query: 394 GRGERSPRRWLQPRLAVPRQASTSVPRTPA 305 GRG RS R L+P LA+ A + +P P+ Sbjct: 426 GRGPRSSLRILRPGLAITEMAVSQLPGQPS 455 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,148,385 Number of Sequences: 28952 Number of extensions: 320644 Number of successful extensions: 867 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 815 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 863 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1980143200 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -