BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_FL5_N19 (856 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g55020.1 68418.m06853 myb family transcription factor (MYB120... 29 5.2 At2g29210.1 68415.m03550 splicing factor PWI domain-containing p... 29 5.2 At2g15290.1 68415.m01744 expressed protein 29 5.2 At4g02070.1 68417.m00277 DNA mismatch repair protein MSH6-1 (MSH... 28 9.1 >At5g55020.1 68418.m06853 myb family transcription factor (MYB120) contains Pfam profile: PF00249 myb-like DNA-binding domain Length = 523 Score = 28.7 bits (61), Expect = 5.2 Identities = 18/50 (36%), Positives = 29/50 (58%), Gaps = 5/50 (10%) Frame = +3 Query: 501 YYWRSRPYASSHPPLAISATS----TRSSNPRF-HTPTTPDLTSISINPL 635 Y+ + PY+SS P +++ +S T +S+P F H+ TP TS NP+ Sbjct: 336 YHNTNNPYSSS-PSFSLNPSSSSYPTSTSSPSFLHSHYTPSSTSFHTNPV 384 >At2g29210.1 68415.m03550 splicing factor PWI domain-containing protein contains Pfam profile PF01480: PWI domain Length = 878 Score = 28.7 bits (61), Expect = 5.2 Identities = 14/51 (27%), Positives = 23/51 (45%) Frame = +2 Query: 575 KSPIPYTNHPRLNIHFHQSPERRTKKEFAPGLKPPLSSEAPSAYLTPSSLG 727 +SP P R + +SP+RR ++ + P S P + +PS G Sbjct: 584 RSPTPVNRRSRRSSSASRSPDRRRRRSPSSSRSPSRSRSPPVLHRSPSPRG 634 >At2g15290.1 68415.m01744 expressed protein Length = 296 Score = 28.7 bits (61), Expect = 5.2 Identities = 19/49 (38%), Positives = 23/49 (46%), Gaps = 3/49 (6%) Frame = +2 Query: 623 HQSPERRTKKEFAPGLKPPLSSEAPSAYLTPSSL---GMAKGGSXPLFS 760 HQS R+ F P L P S+Y +P SL G GGS P F+ Sbjct: 29 HQSLSTRSLPLFNPLLLAPKKKTTISSYQSPPSLSVYGFQIGGSKPSFT 77 >At4g02070.1 68417.m00277 DNA mismatch repair protein MSH6-1 (MSH6-1) (AGAA.3) identical to SP|O04716 DNA mismatch repair protein MSH6-1 (AtMsh6-1) cress] {Arabidopsis thaliana} Length = 1324 Score = 27.9 bits (59), Expect = 9.1 Identities = 11/17 (64%), Positives = 15/17 (88%) Frame = +1 Query: 313 QSLPNVSSIIKGYRDAY 363 QSLPN+SS IK ++DA+ Sbjct: 854 QSLPNISSSIKYFKDAF 870 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,183,605 Number of Sequences: 28952 Number of extensions: 393161 Number of successful extensions: 1124 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1042 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1122 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1989897600 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -