BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_FL5_N17 (889 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_6924| Best HMM Match : TTL (HMM E-Value=4.4e-09) 31 1.2 SB_33380| Best HMM Match : Herpes_capsid (HMM E-Value=3) 29 3.8 SB_35094| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.8 SB_5404| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.8 SB_30122| Best HMM Match : YadA (HMM E-Value=2) 29 5.0 SB_24452| Best HMM Match : PKD_channel (HMM E-Value=0) 29 5.0 SB_33995| Best HMM Match : Cadherin (HMM E-Value=3e-39) 29 5.0 SB_1375| Best HMM Match : Extensin_2 (HMM E-Value=0.18) 29 5.0 SB_34943| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.8 SB_33345| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.8 SB_27417| Best HMM Match : zf-CCHC (HMM E-Value=0.00021) 28 8.8 SB_23207| Best HMM Match : zf-CCHC (HMM E-Value=0.00021) 28 8.8 >SB_6924| Best HMM Match : TTL (HMM E-Value=4.4e-09) Length = 458 Score = 31.1 bits (67), Expect = 1.2 Identities = 19/48 (39%), Positives = 23/48 (47%), Gaps = 2/48 (4%) Frame = +3 Query: 414 TSHS*PLLDYC*RHS*RSQCAGHPFILSHYYWRSRPY--ASSHPPLAI 551 T + LL YC R AGHPF+L Y + R Y +S PL I Sbjct: 91 TKYDIDLLGYCTEQEIRRVVAGHPFLLDGYKFDLRVYVLVTSCDPLRI 138 >SB_33380| Best HMM Match : Herpes_capsid (HMM E-Value=3) Length = 474 Score = 29.5 bits (63), Expect = 3.8 Identities = 18/63 (28%), Positives = 28/63 (44%) Frame = -2 Query: 456 CDVSSSPTKVNCDWYFEARGGRKNDSLKIDKIRVAVAFYDGGDVR**LHSDTVRFGFGAS 277 C + P + W+F + G K DS + + + G V +HS VR G GA+ Sbjct: 275 CVRAHLPNAADQPWFFLSNTGAKIDSNNVQSLLRSFQRSTGVQVSKPIHSTAVRCGSGAT 334 Query: 276 KIE 268 + E Sbjct: 335 EEE 337 >SB_35094| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/57 (33%), Positives = 26/57 (45%), Gaps = 5/57 (8%) Frame = +3 Query: 564 TRSSNPRFHTPTTPDLTSISINPLNAVLKGVRAGVKASGCH-----QRLHQRISPPR 719 TR +PR HTP+TP T +A + + H +R+HQRI PR Sbjct: 70 TRLVHPRLHTPSTPTATHAEYT--HAYKRRAHPRLHTPTTHTPTRARRVHQRIQTPR 124 Score = 29.5 bits (63), Expect = 3.8 Identities = 25/86 (29%), Positives = 34/86 (39%), Gaps = 1/86 (1%) Frame = +3 Query: 495 SHYYWRSRPYASSHPPLAISATSTRSSNPRFHTPTTPDLTSISINPLNAVLKGVRAGVKA 674 +H Y R R + H P + T R + R TP TP P +A R V Sbjct: 91 THAYKR-RAHPRLHTPTTHTPTRARRVHQRIQTPRTP-------RPTHAEYTHARR-VHT 141 Query: 675 SGCHQRLHQRISP-PRHWAWLXGVSP 749 H RLH ++P P H + +P Sbjct: 142 RRVHPRLHTPVTPTPTHAEYTHAYTP 167 >SB_5404| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/57 (33%), Positives = 26/57 (45%), Gaps = 5/57 (8%) Frame = +3 Query: 564 TRSSNPRFHTPTTPDLTSISINPLNAVLKGVRAGVKASGCH-----QRLHQRISPPR 719 TR +PR HTP+TP T +A + + H +R+HQRI PR Sbjct: 70 TRLVHPRLHTPSTPTATHAEYT--HAYKRRAHPRLHTPTTHTPTRARRVHQRIQTPR 124 Score = 29.5 bits (63), Expect = 3.8 Identities = 25/86 (29%), Positives = 34/86 (39%), Gaps = 1/86 (1%) Frame = +3 Query: 495 SHYYWRSRPYASSHPPLAISATSTRSSNPRFHTPTTPDLTSISINPLNAVLKGVRAGVKA 674 +H Y R R + H P + T R + R TP TP P +A R V Sbjct: 91 THAYKR-RAHPRLHTPTTHTPTRARRVHQRIQTPRTP-------RPTHAEYTHARR-VHT 141 Query: 675 SGCHQRLHQRISP-PRHWAWLXGVSP 749 H RLH ++P P H + +P Sbjct: 142 RRVHPRLHTPVTPTPTHAEYTHAYTP 167 >SB_30122| Best HMM Match : YadA (HMM E-Value=2) Length = 408 Score = 29.1 bits (62), Expect = 5.0 Identities = 12/37 (32%), Positives = 22/37 (59%) Frame = +1 Query: 394 SAPSLKIPVTVDLCWTTADVTVEGVNVLATPSSSRIT 504 S P K+P+T T+A+VT +++ +PS + +T Sbjct: 239 SRPETKVPITTIGASTSAEVTTSQRDLMPSPSQAHVT 275 >SB_24452| Best HMM Match : PKD_channel (HMM E-Value=0) Length = 1433 Score = 29.1 bits (62), Expect = 5.0 Identities = 15/39 (38%), Positives = 26/39 (66%), Gaps = 3/39 (7%) Frame = +1 Query: 268 FDLTGTETKSNSVTVQS---LPNVSSIIKGYRDAYLVNL 375 F +TG E KS+S+T++ +P V ++ +G D +LV+L Sbjct: 485 FTITGQEGKSDSITIRHADVIPRV-ALARGNEDVFLVHL 522 >SB_33995| Best HMM Match : Cadherin (HMM E-Value=3e-39) Length = 632 Score = 29.1 bits (62), Expect = 5.0 Identities = 19/62 (30%), Positives = 27/62 (43%), Gaps = 2/62 (3%) Frame = +3 Query: 507 WR-SRPYASSHPPLAISATSTRSSNPRFHTPTTPDLTSI-SINPLNAVLKGVRAGVKASG 680 WR + P + + I+ T + PRF P P +TSI P + V A + SG Sbjct: 443 WRPNMPELPAEATVLITVTDINDNAPRFAIPREPLVTSIHQFRPAGTTVTKVTAYDQDSG 502 Query: 681 CH 686 H Sbjct: 503 SH 504 >SB_1375| Best HMM Match : Extensin_2 (HMM E-Value=0.18) Length = 796 Score = 29.1 bits (62), Expect = 5.0 Identities = 18/41 (43%), Positives = 19/41 (46%), Gaps = 1/41 (2%) Frame = +3 Query: 513 SRPYASSHPPLAISATSTRSSN-PRFHTPTTPDLTSISINP 632 S P P IS TS SS PR H PTTP T + P Sbjct: 249 STPRHHGEPQTTISITSIISSAIPRGHLPTTPSTTPQATPP 289 >SB_34943| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 28.3 bits (60), Expect = 8.8 Identities = 24/93 (25%), Positives = 35/93 (37%), Gaps = 3/93 (3%) Frame = +3 Query: 480 HPFILSHY-YWRSRPYASSHPPLA-ISATSTRSSNPRFHTPTTPDLTSISINPLNAVLKG 653 HP + + Y + +RP ++ P A + TR P HTP TP T Sbjct: 26 HPRLHAEYIHAYTRPPSTPRPTHAEYTQAYTRRVRPLLHTPVTPKPTHAEYTHAE-YTHA 84 Query: 654 VRAGVKASGCHQRLHQRISP-PRHWAWLXGVSP 749 H RLH ++P P H + +P Sbjct: 85 EYTHAYTRRVHPRLHTPVTPTPTHAEYTHAYTP 117 >SB_33345| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 728 Score = 28.3 bits (60), Expect = 8.8 Identities = 21/52 (40%), Positives = 27/52 (51%) Frame = +3 Query: 561 STRSSNPRFHTPTTPDLTSISINPLNAVLKGVRAGVKASGCHQRLHQRISPP 716 +T SSNP + P L S+S PL+A G A +SG R +Q SPP Sbjct: 320 TTYSSNPSTPVGSPPPLASVSERPLSA---GSGASGHSSG-WGRTNQPTSPP 367 >SB_27417| Best HMM Match : zf-CCHC (HMM E-Value=0.00021) Length = 538 Score = 28.3 bits (60), Expect = 8.8 Identities = 14/34 (41%), Positives = 19/34 (55%) Frame = +3 Query: 522 YASSHPPLAISATSTRSSNPRFHTPTTPDLTSIS 623 Y S PPL++ + ST + +P TP TSIS Sbjct: 502 YKGSEPPLSVCSFSTLNVDPPTPNSPTPISTSIS 535 >SB_23207| Best HMM Match : zf-CCHC (HMM E-Value=0.00021) Length = 260 Score = 28.3 bits (60), Expect = 8.8 Identities = 14/34 (41%), Positives = 19/34 (55%) Frame = +3 Query: 522 YASSHPPLAISATSTRSSNPRFHTPTTPDLTSIS 623 Y S PPL++ + ST + +P TP TSIS Sbjct: 224 YKGSEPPLSVCSFSTLNVDPPTPNSPTPISTSIS 257 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 25,617,933 Number of Sequences: 59808 Number of extensions: 513416 Number of successful extensions: 1547 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 1267 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1540 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2538363813 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -