BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_FL5_N11 (886 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value X04701-1|CAA28407.1| 705|Homo sapiens protein ( Human mRNA for ... 31 5.6 M14058-1|AAA51851.1| 705|Homo sapiens C1R protein. 31 5.6 BC035220-1|AAH35220.1| 705|Homo sapiens complement component 1,... 31 5.6 AB083037-1|BAC19850.2| 705|Homo sapiens r subcomponent of compl... 31 5.6 >X04701-1|CAA28407.1| 705|Homo sapiens protein ( Human mRNA for complement component C1r. ). Length = 705 Score = 31.1 bits (67), Expect = 5.6 Identities = 15/37 (40%), Positives = 21/37 (56%) Frame = +3 Query: 357 D*RDSHCPYLLSSETTAKGTGLGESAGKEDPVELDSS 467 D + HCPY + A G +GE GK+ P +LD+S Sbjct: 244 DHQQVHCPYD-QLQIYANGKNIGEFCGKQRPPDLDTS 279 >M14058-1|AAA51851.1| 705|Homo sapiens C1R protein. Length = 705 Score = 31.1 bits (67), Expect = 5.6 Identities = 15/37 (40%), Positives = 21/37 (56%) Frame = +3 Query: 357 D*RDSHCPYLLSSETTAKGTGLGESAGKEDPVELDSS 467 D + HCPY + A G +GE GK+ P +LD+S Sbjct: 244 DHQQVHCPYD-QLQIYANGKNIGEFCGKQRPPDLDTS 279 >BC035220-1|AAH35220.1| 705|Homo sapiens complement component 1, r subcomponent protein. Length = 705 Score = 31.1 bits (67), Expect = 5.6 Identities = 15/37 (40%), Positives = 21/37 (56%) Frame = +3 Query: 357 D*RDSHCPYLLSSETTAKGTGLGESAGKEDPVELDSS 467 D + HCPY + A G +GE GK+ P +LD+S Sbjct: 244 DHQQVHCPYD-QLQIYANGKNIGEFCGKQRPPDLDTS 279 >AB083037-1|BAC19850.2| 705|Homo sapiens r subcomponent of complement component 1 protein. Length = 705 Score = 31.1 bits (67), Expect = 5.6 Identities = 15/37 (40%), Positives = 21/37 (56%) Frame = +3 Query: 357 D*RDSHCPYLLSSETTAKGTGLGESAGKEDPVELDSS 467 D + HCPY + A G +GE GK+ P +LD+S Sbjct: 244 DHQQVHCPYD-QLQIYANGKNIGEFCGKQRPPDLDTS 279 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 127,346,333 Number of Sequences: 237096 Number of extensions: 2738691 Number of successful extensions: 6118 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5658 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6115 length of database: 76,859,062 effective HSP length: 90 effective length of database: 55,520,422 effective search space used: 11326166088 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -