BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_FL5_N10 (883 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292375-1|CAL23187.2| 311|Tribolium castaneum gustatory recept... 23 4.2 AM292368-1|CAL23180.2| 387|Tribolium castaneum gustatory recept... 23 4.2 AM292347-1|CAL23159.2| 387|Tribolium castaneum gustatory recept... 23 4.2 AM292327-1|CAL23139.2| 387|Tribolium castaneum gustatory recept... 23 4.2 AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. 21 9.7 >AM292375-1|CAL23187.2| 311|Tribolium castaneum gustatory receptor candidate 54 protein. Length = 311 Score = 22.6 bits (46), Expect = 4.2 Identities = 9/35 (25%), Positives = 20/35 (57%) Frame = -3 Query: 515 YIIIFENCCITCVRSIMRCTVVAAASCGESQTCFE 411 ++ +F ++ + IM C VVA+ S ++ C++ Sbjct: 214 HLSVFVYTLVSVILIIMGCDVVASNSRKTAEMCYK 248 >AM292368-1|CAL23180.2| 387|Tribolium castaneum gustatory receptor candidate 47 protein. Length = 387 Score = 22.6 bits (46), Expect = 4.2 Identities = 13/59 (22%), Positives = 28/59 (47%) Frame = -1 Query: 526 SIFTTSSYSRTVVSPVLGV*CAAQWLRLHPVGKARPALSPSSPIRRLAVFSNSSQISII 350 +++ T++Y + ++ + CA ++ VG A AL+ S + SNS ++ Sbjct: 155 TLYHTTAYLHIIT--MINMNCALWYINCRAVGNASTALAESFQNVLVPTASNSKSTKVL 211 >AM292347-1|CAL23159.2| 387|Tribolium castaneum gustatory receptor candidate 26 protein. Length = 387 Score = 22.6 bits (46), Expect = 4.2 Identities = 13/59 (22%), Positives = 28/59 (47%) Frame = -1 Query: 526 SIFTTSSYSRTVVSPVLGV*CAAQWLRLHPVGKARPALSPSSPIRRLAVFSNSSQISII 350 +++ T++Y + ++ + CA ++ VG A AL+ S + SNS ++ Sbjct: 155 TLYHTTAYLHIIT--MINMNCALWYINCRAVGNASTALAESFQNVLVPTASNSKSTKVL 211 >AM292327-1|CAL23139.2| 387|Tribolium castaneum gustatory receptor candidate 6 protein. Length = 387 Score = 22.6 bits (46), Expect = 4.2 Identities = 13/59 (22%), Positives = 28/59 (47%) Frame = -1 Query: 526 SIFTTSSYSRTVVSPVLGV*CAAQWLRLHPVGKARPALSPSSPIRRLAVFSNSSQISII 350 +++ T++Y + ++ + CA ++ VG A AL+ S + SNS ++ Sbjct: 155 TLYHTTAYLHIIT--MINMNCALWYINCRAVGNASTALAESFQNVLVPTASNSKSTKVL 211 >AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. Length = 717 Score = 21.4 bits (43), Expect = 9.7 Identities = 15/56 (26%), Positives = 27/56 (48%) Frame = -1 Query: 649 PDALMPASVAX*TPFTRGS*RGLKCSVKAQSIMRPFM*VPKSIFTTSSYSRTVVSP 482 PDA+ + + +G R K VK R + P+ +F ++Y+R +V+P Sbjct: 465 PDAICVSQLKNALSIDKGILRE-KPDVKIFLPFRFHIYTPEDLFAPNTYNRHLVAP 519 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 158,433 Number of Sequences: 336 Number of extensions: 3414 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 24410188 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -