BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_FL5_N10 (883 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical prote... 26 1.7 AJ438610-11|CAD27483.1| 765|Anopheles gambiae hypothetical prot... 26 1.7 AJ439353-3|CAD27925.1| 1200|Anopheles gambiae putative TPR-conta... 25 4.0 AY301275-1|AAQ67361.1| 611|Anopheles gambiae G-protein coupled ... 23 9.3 AJ439353-2|CAD27924.1| 612|Anopheles gambiae putative G-protein... 23 9.3 >AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical protein protein. Length = 1645 Score = 25.8 bits (54), Expect = 1.7 Identities = 14/40 (35%), Positives = 21/40 (52%) Frame = +1 Query: 88 DLLRSRPSHLLYQ*RNYFLMETFLRVKLWTMVLLRVLMRE 207 DLLR PS +++ M F +K W M LR++ R+ Sbjct: 345 DLLRKEPSFSAEWAKSFNKMSHFNSLKQWGMNRLRMMNRD 384 >AJ438610-11|CAD27483.1| 765|Anopheles gambiae hypothetical protein protein. Length = 765 Score = 25.8 bits (54), Expect = 1.7 Identities = 14/40 (35%), Positives = 21/40 (52%) Frame = +1 Query: 88 DLLRSRPSHLLYQ*RNYFLMETFLRVKLWTMVLLRVLMRE 207 DLLR PS +++ M F +K W M LR++ R+ Sbjct: 346 DLLRKEPSFSAEWAKSFNKMSHFNSLKQWGMNRLRMMNRD 385 >AJ439353-3|CAD27925.1| 1200|Anopheles gambiae putative TPR-containing phosphoprotein protein. Length = 1200 Score = 24.6 bits (51), Expect = 4.0 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = -3 Query: 572 CEGAVNNATIYVSTKVDLHYIIIFENC 492 C+ +N A IYV K + I ++ENC Sbjct: 680 CDVWINIAHIYVEQKQYISAIQMYENC 706 >AY301275-1|AAQ67361.1| 611|Anopheles gambiae G-protein coupled receptor protein. Length = 611 Score = 23.4 bits (48), Expect = 9.3 Identities = 9/28 (32%), Positives = 17/28 (60%) Frame = -1 Query: 409 PSSPIRRLAVFSNSSQISIIVMPGLIQL 326 PS+P ++ N S ++++ PG+ QL Sbjct: 91 PSTPFANVSTGQNESLANLLLHPGVHQL 118 >AJ439353-2|CAD27924.1| 612|Anopheles gambiae putative G-protein coupled receptor protein. Length = 612 Score = 23.4 bits (48), Expect = 9.3 Identities = 9/28 (32%), Positives = 17/28 (60%) Frame = -1 Query: 409 PSSPIRRLAVFSNSSQISIIVMPGLIQL 326 PS+P ++ N S ++++ PG+ QL Sbjct: 92 PSTPFANVSTGQNESLANLLLHPGVHQL 119 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 698,988 Number of Sequences: 2352 Number of extensions: 14072 Number of successful extensions: 61 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 57 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 61 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 94680279 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -