BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_FL5_N02 (829 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY273778-1|AAP33487.1| 427|Apis mellifera ultraspiracle protein... 24 2.0 AF263459-1|AAF73057.1| 427|Apis mellifera ultraspiracle protein... 24 2.0 AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic ac... 23 2.6 AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisp... 22 8.0 >AY273778-1|AAP33487.1| 427|Apis mellifera ultraspiracle protein protein. Length = 427 Score = 23.8 bits (49), Expect = 2.0 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = -3 Query: 659 TTSQRWSRGSTPRSLNTS 606 T +Q WSRG+T SL+ S Sbjct: 18 TQAQHWSRGNTWLSLDNS 35 >AF263459-1|AAF73057.1| 427|Apis mellifera ultraspiracle protein protein. Length = 427 Score = 23.8 bits (49), Expect = 2.0 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = -3 Query: 659 TTSQRWSRGSTPRSLNTS 606 T +Q WSRG+T SL+ S Sbjct: 18 TQAQHWSRGNTWLSLDNS 35 >AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic acetylcholine receptoralpha7-1 protein. Length = 555 Score = 23.4 bits (48), Expect = 2.6 Identities = 9/22 (40%), Positives = 12/22 (54%) Frame = -1 Query: 670 TNQPXHPSAGHGEAHHEASTLH 605 T P H + GHG +H A+ H Sbjct: 411 TPGPHHHTMGHGHSHIHATPHH 432 >AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform A protein. Length = 782 Score = 21.8 bits (44), Expect = 8.0 Identities = 6/30 (20%), Positives = 16/30 (53%) Frame = +3 Query: 435 VLDPAQDHQPITEASYVNIPVIALCNTDSP 524 ++DP ++++ E + IP++ + P Sbjct: 167 IVDPVEENETYDEFDTIRIPIVRSLSKSPP 196 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 220,714 Number of Sequences: 438 Number of extensions: 4990 Number of successful extensions: 7 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 26460186 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -