BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_FL5_M23 (887 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_03_1310 + 29238644-29240260 33 0.40 07_01_0373 + 2783596-2784933 31 0.93 02_01_0219 - 1437685-1437723,1437932-1438091,1438385-1438514,143... 29 3.7 11_04_0307 + 16185405-16185713,16185847-16185942,16186626-161867... 29 4.9 09_04_0506 - 18188785-18190599 29 6.5 04_01_0041 - 464695-464850,467485-469029 29 6.5 01_05_0227 - 19512866-19514983 29 6.5 02_05_0788 + 31758119-31758384,31758482-31758634,31759385-317595... 28 8.6 >06_03_1310 + 29238644-29240260 Length = 538 Score = 32.7 bits (71), Expect = 0.40 Identities = 21/60 (35%), Positives = 28/60 (46%), Gaps = 1/60 (1%) Frame = +2 Query: 575 KSPNSIHQPPQT*HPFPSIP*TPYXXEFAPGVKPPLSSEAPSAYLTPS-SLGMAKGVSAP 751 +SP H PP+ P P P +P P PP SE+P + + PS S + G S P Sbjct: 382 RSPLPHHMPPRRTPPTPPPPSSPTPSHLPP--PPPTYSESPKSSMPPSTSPPSSHGASPP 439 >07_01_0373 + 2783596-2784933 Length = 445 Score = 31.5 bits (68), Expect = 0.93 Identities = 12/28 (42%), Positives = 21/28 (75%) Frame = -1 Query: 92 EEEKALTKEGMAEAAETXKGTISSMNRS 9 E+++ LTK G + +ET KG++ S++RS Sbjct: 151 EQQQQLTKSGCSSTSETSKGSVLSLSRS 178 >02_01_0219 - 1437685-1437723,1437932-1438091,1438385-1438514, 1438627-1438696,1439264-1439407,1439771-1439837, 1439970-1440019,1440386-1440559,1440881-1440934, 1441008-1441112 Length = 330 Score = 29.5 bits (63), Expect = 3.7 Identities = 25/85 (29%), Positives = 38/85 (44%), Gaps = 2/85 (2%) Frame = +2 Query: 284 TETKSNSVTVQSLPNVSSIIKGYRDAYLVNLEAVVFPSAPSL--KIPVTVDLCWTTADVT 457 TE +N V V L SS GY D + ++ V + K+ V +D TAD++ Sbjct: 167 TEAGANRVLVCDLH--SSQAMGYFDIPVDHVYGQVMNLIGDVRGKVAVMMDDMIDTADIS 224 Query: 458 VEGVNVLATPSSSRITIGGLALMHQ 532 + +N+L P G L+HQ Sbjct: 225 LPNINILMKPIKLGTIAKGAELLHQ 249 >11_04_0307 + 16185405-16185713,16185847-16185942,16186626-16186730, 16186938-16187090,16188395-16188478,16188566-16188694, 16188986-16189165,16189555-16189677,16189678-16189794, 16189889-16190053 Length = 486 Score = 29.1 bits (62), Expect = 4.9 Identities = 18/58 (31%), Positives = 24/58 (41%) Frame = +2 Query: 572 IKSPNSIHQPPQT*HPFPSIP*TPYXXEFAPGVKPPLSSEAPSAYLTPSSLGMAKGVS 745 + SP PP + P P +P PY + +P PP P + P S A G S Sbjct: 13 LNSPLWSAPPPSSSSPSPPVPPDPYGADLSP---PPPPPPKPPPTVPPPSYEQAVGSS 67 >09_04_0506 - 18188785-18190599 Length = 604 Score = 28.7 bits (61), Expect = 6.5 Identities = 12/34 (35%), Positives = 16/34 (47%) Frame = +2 Query: 566 PIIKSPNSIHQPPQT*HPFPSIP*TPYXXEFAPG 667 P+ PN +H PPQ P + P P + PG Sbjct: 120 PVPDRPNPVHLPPQPQPPVAAAPPPPPHNQIQPG 153 >04_01_0041 - 464695-464850,467485-469029 Length = 566 Score = 28.7 bits (61), Expect = 6.5 Identities = 18/63 (28%), Positives = 32/63 (50%), Gaps = 1/63 (1%) Frame = +2 Query: 245 IIPFQRLYFDLTGTETKSNSVTVQSLPNVSSIIKGYRDAYLVNLEAVVFPS-APSLKIPV 421 +I R + D++ T +SN + V +LP VSS + Y D ++ + P P ++ V Sbjct: 40 LISVFRPFTDVSLTLCRSNYIGVTNLPIVSSECEAYYDDFVSGADFTARPQVVPPWRLAV 99 Query: 422 TVD 430 +D Sbjct: 100 PLD 102 >01_05_0227 - 19512866-19514983 Length = 705 Score = 28.7 bits (61), Expect = 6.5 Identities = 11/31 (35%), Positives = 19/31 (61%) Frame = -3 Query: 462 STVTSAVVQQRSTVTGILRLGAEGKTTASRL 370 S +T + +QQ + ++ LG GKTT ++L Sbjct: 18 SKLTESSIQQNIKIVSVIGLGGSGKTTLAKL 48 >02_05_0788 + 31758119-31758384,31758482-31758634,31759385-31759509, 31759650-31759678,31760943-31761008,31761059-31761125, 31761226-31761370,31761404-31761451,31762014-31762182, 31762645-31762779,31762858-31763064,31763608-31763735, 31763815-31763866,31764046-31764060,31764502-31764609 Length = 570 Score = 28.3 bits (60), Expect = 8.6 Identities = 21/86 (24%), Positives = 36/86 (41%) Frame = +2 Query: 236 QRLIIPFQRLYFDLTGTETKSNSVTVQSLPNVSSIIKGYRDAYLVNLEAVVFPSAPSLKI 415 Q I + ++ L N TV + N + GY+ +N+ + PSLK Sbjct: 198 QVFCIVLEMFFYQLLQLLKVPNEKTVNVIENAIQTLPGYQPPKHINIGEYISSHVPSLK- 256 Query: 416 PVTVDLCWTTADVTVEGVNVLATPSS 493 D C T ++ +EG++ L S+ Sbjct: 257 ----DFCEPTVEM-LEGMSALKALST 277 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,990,533 Number of Sequences: 37544 Number of extensions: 539488 Number of successful extensions: 1539 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 1466 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1538 length of database: 14,793,348 effective HSP length: 82 effective length of database: 11,714,740 effective search space used: 2495239620 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -