BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_FL5_M17 (881 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY052072-1|AAK93496.1| 2409|Drosophila melanogaster SD02860p pro... 30 4.9 AJ309005-1|CAC35209.1| 2382|Drosophila melanogaster GRAAL2 prote... 30 4.9 AJ251803-1|CAB64653.1| 1449|Drosophila melanogaster GRAAL protei... 30 4.9 AJ251802-1|CAB64652.1| 1462|Drosophila melanogaster GRAAL protei... 30 4.9 AE014298-1331|AAF46494.1| 4547|Drosophila melanogaster CG12139-P... 30 4.9 AE014296-1583|AAF50321.2| 1374|Drosophila melanogaster CG4821-PB... 30 4.9 AE014296-1581|AAN11984.1| 1450|Drosophila melanogaster CG4821-PD... 30 4.9 AE014296-1580|AAF50319.3| 2786|Drosophila melanogaster CG4821-PA... 30 4.9 AY005815-1|AAF91072.1| 1678|Drosophila melanogaster arrow protein. 29 6.4 AF223365-1|AAF28358.1| 1678|Drosophila melanogaster LDL-related ... 29 6.4 AE013599-1719|AAF58373.2| 1678|Drosophila melanogaster CG5912-PA... 29 6.4 U04809-1|AAA19430.1| 622|Drosophila melanogaster cocaine-sensit... 29 8.5 AY071023-1|AAL48645.1| 622|Drosophila melanogaster RE10485p pro... 29 8.5 AY061451-1|AAL28999.1| 249|Drosophila melanogaster LD38807p pro... 29 8.5 AE013599-3863|AAF47200.1| 622|Drosophila melanogaster CG4545-PA... 29 8.5 >AY052072-1|AAK93496.1| 2409|Drosophila melanogaster SD02860p protein. Length = 2409 Score = 29.9 bits (64), Expect = 4.9 Identities = 19/55 (34%), Positives = 24/55 (43%) Frame = +1 Query: 7 RPPFNGQLRTGTDKGNPDCLIKTKHCDGPRGC*RNVISAQCSECQREEIQASAGK 171 R FN Q D GN CL K + CDG + C A C E++ S G+ Sbjct: 1801 RSSFNTQC--DFDCGNGQCLKKEEICDGKKNCPNGKDEANCPPSD-YEVRLSGGE 1852 >AJ309005-1|CAC35209.1| 2382|Drosophila melanogaster GRAAL2 protein protein. Length = 2382 Score = 29.9 bits (64), Expect = 4.9 Identities = 19/55 (34%), Positives = 24/55 (43%) Frame = +1 Query: 7 RPPFNGQLRTGTDKGNPDCLIKTKHCDGPRGC*RNVISAQCSECQREEIQASAGK 171 R FN Q D GN CL K + CDG + C A C E++ S G+ Sbjct: 1774 RSSFNTQC--DFDCGNGQCLKKEEICDGKKNCPNGKDEANCPPSD-YEVRLSGGE 1825 >AJ251803-1|CAB64653.1| 1449|Drosophila melanogaster GRAAL protein protein. Length = 1449 Score = 29.9 bits (64), Expect = 4.9 Identities = 19/55 (34%), Positives = 24/55 (43%) Frame = +1 Query: 7 RPPFNGQLRTGTDKGNPDCLIKTKHCDGPRGC*RNVISAQCSECQREEIQASAGK 171 R FN Q D GN CL K + CDG + C A C E++ S G+ Sbjct: 841 RSSFNTQC--DFDCGNGQCLKKEEICDGKKNCPNGKDEANCPPSD-YEVRLSGGE 892 >AJ251802-1|CAB64652.1| 1462|Drosophila melanogaster GRAAL protein protein. Length = 1462 Score = 29.9 bits (64), Expect = 4.9 Identities = 19/55 (34%), Positives = 24/55 (43%) Frame = +1 Query: 7 RPPFNGQLRTGTDKGNPDCLIKTKHCDGPRGC*RNVISAQCSECQREEIQASAGK 171 R FN Q D GN CL K + CDG + C A C E++ S G+ Sbjct: 854 RSSFNTQC--DFDCGNGQCLKKEEICDGKKNCPNGKDEANCPPSD-YEVRLSGGE 905 >AE014298-1331|AAF46494.1| 4547|Drosophila melanogaster CG12139-PB protein. Length = 4547 Score = 29.9 bits (64), Expect = 4.9 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +1 Query: 37 GTDKGNPDCLIKTKHCDGPRGC 102 G G P C++K++ CDG R C Sbjct: 159 GGASGTPKCILKSQLCDGKRDC 180 >AE014296-1583|AAF50321.2| 1374|Drosophila melanogaster CG4821-PB, isoform B protein. Length = 1374 Score = 29.9 bits (64), Expect = 4.9 Identities = 19/55 (34%), Positives = 24/55 (43%) Frame = +1 Query: 7 RPPFNGQLRTGTDKGNPDCLIKTKHCDGPRGC*RNVISAQCSECQREEIQASAGK 171 R FN Q D GN CL K + CDG + C A C E++ S G+ Sbjct: 766 RSSFNTQC--DFDCGNGQCLKKEEICDGKKNCPNGKDEANCPPSD-YEVRLSGGE 817 >AE014296-1581|AAN11984.1| 1450|Drosophila melanogaster CG4821-PD, isoform D protein. Length = 1450 Score = 29.9 bits (64), Expect = 4.9 Identities = 19/55 (34%), Positives = 24/55 (43%) Frame = +1 Query: 7 RPPFNGQLRTGTDKGNPDCLIKTKHCDGPRGC*RNVISAQCSECQREEIQASAGK 171 R FN Q D GN CL K + CDG + C A C E++ S G+ Sbjct: 842 RSSFNTQC--DFDCGNGQCLKKEEICDGKKNCPNGKDEANCPPSD-YEVRLSGGE 893 >AE014296-1580|AAF50319.3| 2786|Drosophila melanogaster CG4821-PA, isoform A protein. Length = 2786 Score = 29.9 bits (64), Expect = 4.9 Identities = 19/55 (34%), Positives = 24/55 (43%) Frame = +1 Query: 7 RPPFNGQLRTGTDKGNPDCLIKTKHCDGPRGC*RNVISAQCSECQREEIQASAGK 171 R FN Q D GN CL K + CDG + C A C E++ S G+ Sbjct: 2178 RSSFNTQC--DFDCGNGQCLKKEEICDGKKNCPNGKDEANCPPSD-YEVRLSGGE 2229 >AY005815-1|AAF91072.1| 1678|Drosophila melanogaster arrow protein. Length = 1678 Score = 29.5 bits (63), Expect = 6.4 Identities = 11/46 (23%), Positives = 20/46 (43%) Frame = +1 Query: 34 TGTDKGNPDCLIKTKHCDGPRGC*RNVISAQCSECQREEIQASAGK 171 +G N DC+ + CDG + C C C+ ++ +G+ Sbjct: 1331 SGISDVNKDCIPASWRCDGQKDCPDKSDEVGCPTCRADQFSCQSGE 1376 >AF223365-1|AAF28358.1| 1678|Drosophila melanogaster LDL-related protein LRP6 protein. Length = 1678 Score = 29.5 bits (63), Expect = 6.4 Identities = 11/46 (23%), Positives = 20/46 (43%) Frame = +1 Query: 34 TGTDKGNPDCLIKTKHCDGPRGC*RNVISAQCSECQREEIQASAGK 171 +G N DC+ + CDG + C C C+ ++ +G+ Sbjct: 1331 SGISDVNKDCIPASWRCDGQKDCPDKSDEVGCPTCRADQFSCQSGE 1376 >AE013599-1719|AAF58373.2| 1678|Drosophila melanogaster CG5912-PA protein. Length = 1678 Score = 29.5 bits (63), Expect = 6.4 Identities = 11/46 (23%), Positives = 20/46 (43%) Frame = +1 Query: 34 TGTDKGNPDCLIKTKHCDGPRGC*RNVISAQCSECQREEIQASAGK 171 +G N DC+ + CDG + C C C+ ++ +G+ Sbjct: 1331 SGISDVNKDCIPASWRCDGQKDCPDKSDEVGCPTCRADQFSCQSGE 1376 >U04809-1|AAA19430.1| 622|Drosophila melanogaster cocaine-sensitive serotonin transporterprotein. Length = 622 Score = 29.1 bits (62), Expect = 8.5 Identities = 15/35 (42%), Positives = 19/35 (54%) Frame = -1 Query: 503 HRAPADIIDRAPLPPNRVSNETMKVVVFQRRSRET 399 H PA + D PL P +NE + VV R+RET Sbjct: 44 HTTPAKVTD--PLAPKLANNERILVVSVTERTRET 76 >AY071023-1|AAL48645.1| 622|Drosophila melanogaster RE10485p protein. Length = 622 Score = 29.1 bits (62), Expect = 8.5 Identities = 15/35 (42%), Positives = 19/35 (54%) Frame = -1 Query: 503 HRAPADIIDRAPLPPNRVSNETMKVVVFQRRSRET 399 H PA + D PL P +NE + VV R+RET Sbjct: 44 HTTPAKVTD--PLAPKLANNERILVVSVTERTRET 76 >AY061451-1|AAL28999.1| 249|Drosophila melanogaster LD38807p protein. Length = 249 Score = 29.1 bits (62), Expect = 8.5 Identities = 16/44 (36%), Positives = 21/44 (47%), Gaps = 3/44 (6%) Frame = -1 Query: 410 SRETISHLCYTSHVSL---QCQTRVKLNRVFFPR*FSQARSLGC 288 S+ TI CY ++S QCQ R+ +VFF S A C Sbjct: 14 SKRTIFETCYMKNISFLKTQCQARILFCKVFFAVHSSNANVPSC 57 >AE013599-3863|AAF47200.1| 622|Drosophila melanogaster CG4545-PA protein. Length = 622 Score = 29.1 bits (62), Expect = 8.5 Identities = 15/35 (42%), Positives = 19/35 (54%) Frame = -1 Query: 503 HRAPADIIDRAPLPPNRVSNETMKVVVFQRRSRET 399 H PA + D PL P +NE + VV R+RET Sbjct: 44 HTTPAKVTD--PLAPKLANNERILVVSVTERTRET 76 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 38,293,183 Number of Sequences: 53049 Number of extensions: 835622 Number of successful extensions: 2583 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 2431 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2583 length of database: 24,988,368 effective HSP length: 84 effective length of database: 20,532,252 effective search space used: 4291240668 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -