BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_FL5_M12 (870 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_06_0456 + 29521282-29522064 32 0.52 07_01_0087 + 676501-677907 29 4.8 06_01_0437 + 3101449-3101521,3101872-3102232,3103766-3103958,310... 29 4.8 03_05_1067 - 30105850-30106034,30106036-30106192,30106301-30106399 29 4.8 03_05_0934 - 28935728-28935859,28936000-28936122,28936172-289362... 29 4.8 06_03_1448 + 30235336-30236763 29 6.4 06_03_1443 + 30182018-30183445 29 6.4 06_03_1440 + 30166515-30167942 29 6.4 06_03_1437 + 30151030-30152457 29 6.4 06_03_1429 + 30100834-30102261 29 6.4 06_03_1425 + 30084383-30085810 29 6.4 06_03_1420 - 30053713-30055140 29 6.4 06_01_0328 + 2379610-2380359,2380479-2381108,2381222-2381764 29 6.4 01_06_1406 - 37073548-37073822,37073892-37074111,37074200-370742... 29 6.4 03_02_0740 - 10836752-10837052,10837756-10837814,10837901-108384... 28 8.5 >01_06_0456 + 29521282-29522064 Length = 260 Score = 32.3 bits (70), Expect = 0.52 Identities = 19/47 (40%), Positives = 26/47 (55%), Gaps = 6/47 (12%) Frame = -1 Query: 414 AWQC--PRTGSRGSFKRRRAFPPRHHSARLER----NTVRPTILSTA 292 AW+C P +G+RG +RRR P S R R +T+RP + S A Sbjct: 12 AWRCYSPASGARGGSRRRRRRPAGTTSRRCSRADRLDTLRPYVTSAA 58 >07_01_0087 + 676501-677907 Length = 468 Score = 29.1 bits (62), Expect = 4.8 Identities = 15/49 (30%), Positives = 23/49 (46%) Frame = +3 Query: 6 VGACEVHASVLITARLVGPWEVVGMSLSTI*RNHSQGNGLGRISGERRP 152 +G VH+S+ + RL+ P EV+G S +G G + R P Sbjct: 55 LGVAGVHSSMYASLRLITPREVMGFSDFPFRPGKDGDSGAGEVDARRFP 103 >06_01_0437 + 3101449-3101521,3101872-3102232,3103766-3103958, 3104051-3104848,3104997-3105143,3106024-3106377 Length = 641 Score = 29.1 bits (62), Expect = 4.8 Identities = 17/44 (38%), Positives = 23/44 (52%), Gaps = 2/44 (4%) Frame = +2 Query: 308 VGRTVFRSKR--AEW*RGGNARRRLKLPRDPVRGHCQAGSLTGA 433 +G+T+ R R A W RG A RR +LP G +AG G+ Sbjct: 35 IGQTLTRGPRTCAVWRRGRAAVRRRRLPAASAEGGAKAGRSLGS 78 >03_05_1067 - 30105850-30106034,30106036-30106192,30106301-30106399 Length = 146 Score = 29.1 bits (62), Expect = 4.8 Identities = 21/67 (31%), Positives = 30/67 (44%) Frame = +2 Query: 314 RTVFRSKRAEW*RGGNARRRLKLPRDPVRGHCQAGSLTGAVHLSKNNAGVLRPAQRGQKP 493 R + +R E G +RR L D +RG+ + A H AG + RG KP Sbjct: 59 RCIAEGRREEEEEVGRSRRGKDLDLDDMRGYGET-----ATHHGLRLAGREEVSPRGGKP 113 Query: 494 RVEQKGK 514 RV+ G+ Sbjct: 114 RVDNGGR 120 >03_05_0934 - 28935728-28935859,28936000-28936122,28936172-28936284, 28936363-28936430,28936517-28936600,28936937-28936980, 28937061-28937204,28937518-28937582,28937722-28937814, 28938132-28938262,28938375-28938394,28938904-28938987, 28939157-28939330,28940106-28940195,28940293-28940364, 28941318-28941365,28941458-28941570,28942786-28942849, 28942943-28943016,28943162-28943201 Length = 591 Score = 29.1 bits (62), Expect = 4.8 Identities = 16/47 (34%), Positives = 22/47 (46%) Frame = -2 Query: 254 ESSGFSATIARNDLPLMLHLSCLLTMPD*SQAQXGSSFPADSPKPVP 114 + +GFS TI R+D ++ L P G+ PA P PVP Sbjct: 301 DMAGFSITIMRSDENILQRLDAPTKAPAWPVGSEGNRPPAKIPVPVP 347 >06_03_1448 + 30235336-30236763 Length = 475 Score = 28.7 bits (61), Expect = 6.4 Identities = 16/47 (34%), Positives = 23/47 (48%), Gaps = 1/47 (2%) Frame = -2 Query: 419 SPPGSVLEPDHAGVLN-GDERFRHVTTLHAWNETPCARRYYRPRTAS 282 +PP L +L+ GD+R+ V LH W+E R YR +S Sbjct: 126 NPPPPTLGDHQLAILSCGDDRYV-VAALHVWSEFTSTLRLYRSSCSS 171 >06_03_1443 + 30182018-30183445 Length = 475 Score = 28.7 bits (61), Expect = 6.4 Identities = 16/47 (34%), Positives = 23/47 (48%), Gaps = 1/47 (2%) Frame = -2 Query: 419 SPPGSVLEPDHAGVLN-GDERFRHVTTLHAWNETPCARRYYRPRTAS 282 +PP L +L+ GD+R+ V LH W+E R YR +S Sbjct: 126 NPPPPTLGDHQLAILSCGDDRYV-VAALHVWSEFTSTLRLYRSSCSS 171 >06_03_1440 + 30166515-30167942 Length = 475 Score = 28.7 bits (61), Expect = 6.4 Identities = 16/47 (34%), Positives = 23/47 (48%), Gaps = 1/47 (2%) Frame = -2 Query: 419 SPPGSVLEPDHAGVLN-GDERFRHVTTLHAWNETPCARRYYRPRTAS 282 +PP L +L+ GD+R+ V LH W+E R YR +S Sbjct: 126 NPPPPTLGDHQLAILSCGDDRYV-VAALHVWSEFTSTLRLYRSSCSS 171 >06_03_1437 + 30151030-30152457 Length = 475 Score = 28.7 bits (61), Expect = 6.4 Identities = 16/47 (34%), Positives = 23/47 (48%), Gaps = 1/47 (2%) Frame = -2 Query: 419 SPPGSVLEPDHAGVLN-GDERFRHVTTLHAWNETPCARRYYRPRTAS 282 +PP L +L+ GD+R+ V LH W+E R YR +S Sbjct: 126 NPPPPTLGDHQLAILSCGDDRYV-VAALHVWSEFTSTLRLYRSSCSS 171 >06_03_1429 + 30100834-30102261 Length = 475 Score = 28.7 bits (61), Expect = 6.4 Identities = 16/47 (34%), Positives = 23/47 (48%), Gaps = 1/47 (2%) Frame = -2 Query: 419 SPPGSVLEPDHAGVLN-GDERFRHVTTLHAWNETPCARRYYRPRTAS 282 +PP L +L+ GD+R+ V LH W+E R YR +S Sbjct: 126 NPPPPTLGDHQLAILSCGDDRYV-VAALHVWSEFTSTLRLYRSSCSS 171 >06_03_1425 + 30084383-30085810 Length = 475 Score = 28.7 bits (61), Expect = 6.4 Identities = 16/47 (34%), Positives = 23/47 (48%), Gaps = 1/47 (2%) Frame = -2 Query: 419 SPPGSVLEPDHAGVLN-GDERFRHVTTLHAWNETPCARRYYRPRTAS 282 +PP L +L+ GD+R+ V LH W+E R YR +S Sbjct: 126 NPPPPTLGDHQLAILSCGDDRYV-VAALHVWSEFTSTLRLYRSSCSS 171 >06_03_1420 - 30053713-30055140 Length = 475 Score = 28.7 bits (61), Expect = 6.4 Identities = 16/47 (34%), Positives = 23/47 (48%), Gaps = 1/47 (2%) Frame = -2 Query: 419 SPPGSVLEPDHAGVLN-GDERFRHVTTLHAWNETPCARRYYRPRTAS 282 +PP L +L+ GD+R+ V LH W+E R YR +S Sbjct: 126 NPPPPTLGDHQLAILSCGDDRYV-VAALHVWSEFTSTLRLYRSSCSS 171 >06_01_0328 + 2379610-2380359,2380479-2381108,2381222-2381764 Length = 640 Score = 28.7 bits (61), Expect = 6.4 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = -2 Query: 347 TTLHAWNETPCARRYY 300 TT AW ETPCA R++ Sbjct: 560 TTTEAWVETPCAHRFH 575 >01_06_1406 - 37073548-37073822,37073892-37074111,37074200-37074246, 37074404-37074576,37075161-37075238,37075751-37075813, 37075889-37075961,37076150-37076189,37076302-37076368, 37076719-37078472,37079128-37079230,37080041-37080078, 37080221-37080347,37081944-37082152 Length = 1088 Score = 28.7 bits (61), Expect = 6.4 Identities = 14/30 (46%), Positives = 18/30 (60%) Frame = +1 Query: 355 RKRSSPFKTPA*SGSRTLPGGEFDWGGTSV 444 +KR P K PA S S+ LPG + + G SV Sbjct: 339 KKRGRPRKYPAPSNSKHLPGTDTELGNDSV 368 >03_02_0740 - 10836752-10837052,10837756-10837814,10837901-10838476, 10839965-10841686,10841776-10842173,10842264-10842318, 10842989-10843048,10843444-10843540,10844885-10844955, 10845029-10845109,10846054-10846124,10847951-10848119, 10848521-10848683,10848752-10848942,10849037-10849168 Length = 1381 Score = 28.3 bits (60), Expect = 8.5 Identities = 12/24 (50%), Positives = 16/24 (66%) Frame = -2 Query: 434 PPQSNSPPGSVLEPDHAGVLNGDE 363 P +NS P +V +PD +LNGDE Sbjct: 739 PTSNNSVPQNVDQPDSKKMLNGDE 762 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,311,976 Number of Sequences: 37544 Number of extensions: 495275 Number of successful extensions: 1391 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 1356 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1391 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2444475072 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -