BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_FL5_M11 (883 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090821-1|BAC57917.1| 353|Anopheles gambiae gag-like protein p... 25 4.0 DQ655702-1|ABG45862.1| 889|Anopheles gambiae Jxc1 protein. 21 4.4 >AB090821-1|BAC57917.1| 353|Anopheles gambiae gag-like protein protein. Length = 353 Score = 24.6 bits (51), Expect = 4.0 Identities = 28/99 (28%), Positives = 48/99 (48%), Gaps = 2/99 (2%) Frame = +1 Query: 67 VVTQISATMSGGLDVLALNEEDVTKMLAATTHLGAENVNFQMETYVYKRRADGTH--VIN 240 +VT+++ + G+D+LA +EDV + L E T +++RR DGT + Sbjct: 202 IVTEMAEVLITGIDMLA-KKEDVERGL----QRALERTAVAATTSLWERR-DGTQRARVR 255 Query: 241 LRRTWEKLVLAARAVVAIENPADVFVISSRPFGQRAVLK 357 L R L+L R VV V ++ S P Q++ ++ Sbjct: 256 LPRRDTDLLLDKRIVVG----HSVCLVRSAPKQQQSAVR 290 >DQ655702-1|ABG45862.1| 889|Anopheles gambiae Jxc1 protein. Length = 889 Score = 21.4 bits (43), Expect(2) = 4.4 Identities = 14/44 (31%), Positives = 19/44 (43%) Frame = -2 Query: 840 AVFQPMNPLAPVFHSSFMDRSNYXWLAVPQPVPWLVVHPSLSSG 709 A F P+NP F + F + N P P P + PS +G Sbjct: 557 APFFPLNPAQLRFPAGFPNLPNAQPPPAPPPPPPMGPPPSPLAG 600 Score = 21.0 bits (42), Expect(2) = 4.4 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = -2 Query: 882 GGPKPGXPXGPXGGAV 835 GGP P P GGAV Sbjct: 525 GGPLGPPPPPPPGGAV 540 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,046,765 Number of Sequences: 2352 Number of extensions: 24449 Number of successful extensions: 43 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 37 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 43 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 94680279 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -