BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_FL5_M05 (885 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g05130.1 68418.m00544 SNF2 domain-containing protein / helica... 31 1.3 At4g02590.1 68417.m00353 basic helix-loop-helix (bHLH) family pr... 28 9.5 At3g55220.1 68416.m06133 splicing factor, putative contains CPSF... 28 9.5 At3g55200.1 68416.m06131 splicing factor, putative contains CPSF... 28 9.5 At3g24540.1 68416.m03082 protein kinase family protein contains ... 28 9.5 >At5g05130.1 68418.m00544 SNF2 domain-containing protein / helicase domain-containing protein / RING finger domain-containing protein similar to transcription factor RUSH-1alpha [Oryctolagus cuniculus] GI:1655930; contains Pfam profiles PF00271: Helicase conserved C-terminal domain, PF00176: SNF2 family N-terminal domain, PF00097: Zinc finger, C3HC4 type (RING finger) Length = 862 Score = 30.7 bits (66), Expect = 1.3 Identities = 13/58 (22%), Positives = 32/58 (55%), Gaps = 1/58 (1%) Frame = -2 Query: 188 LKCRVRLTTILESGGESRSYVARSESIM-RDSDVAFSHSAALAIAQVRRNGNKNNISR 18 + C++ + LE+ +S ++R ++ +SD +F S A+ + + NG+K ++ + Sbjct: 126 IPCQIHVFAKLEASSTVKSTISRGGLVLISESDTSFGLSEAVVVKEQMGNGDKRSVDK 183 >At4g02590.1 68417.m00353 basic helix-loop-helix (bHLH) family protein similar to A. thaliana putative protein F6I18.110, GenBank accession number 2980768 Length = 310 Score = 27.9 bits (59), Expect = 9.5 Identities = 15/38 (39%), Positives = 18/38 (47%) Frame = -1 Query: 213 LGLTNVSMSQMQGQVDYDFGVGGGVPIVRCEERVDHEG 100 LGL N S S G D G+GGG P + + EG Sbjct: 24 LGLPNFSASSAAGLSGVDGGLGGGAPPMMLQLGSGEEG 61 >At3g55220.1 68416.m06133 splicing factor, putative contains CPSF A subunit region (PF03178); contains weak WD-40 repeat (PF00400); similar to Splicing factor 3B subunit 3 (SF3b130)/spliceosomal protein/Splicing factor 3B subunit 3 (SAP 130)(KIAA0017)(SP:Q15393) Homo sapiens, EMBL:HSAJ1443_1 Length = 1214 Score = 27.9 bits (59), Expect = 9.5 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = -3 Query: 391 GRGERSPRRWLQPRLAVPRRASTSVPRTPA 302 GRG RS R L+P LA+ A + +P P+ Sbjct: 426 GRGPRSSLRILRPGLAITEMAVSQLPGQPS 455 >At3g55200.1 68416.m06131 splicing factor, putative contains CPSF A subunit region (PF03178); contains weak WD-40 repeat (PF00400); similar to Splicing factor 3B subunit 3 (SF3b130)/spliceosomal protein/Splicing factor 3B subunit 3 (SAP 130)(KIAA0017)(SP:Q15393) Homo sapiens, EMBL:HSAJ1443_1 Length = 1214 Score = 27.9 bits (59), Expect = 9.5 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = -3 Query: 391 GRGERSPRRWLQPRLAVPRRASTSVPRTPA 302 GRG RS R L+P LA+ A + +P P+ Sbjct: 426 GRGPRSSLRILRPGLAITEMAVSQLPGQPS 455 >At3g24540.1 68416.m03082 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 509 Score = 27.9 bits (59), Expect = 9.5 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = +3 Query: 120 PRNVRSGLPPRLQNRSQPDPA 182 PR+ + PPRL NR+ P PA Sbjct: 75 PRSPSTSTPPRLGNRNPPPPA 95 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,022,197 Number of Sequences: 28952 Number of extensions: 360503 Number of successful extensions: 1041 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 975 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1036 length of database: 12,070,560 effective HSP length: 81 effective length of database: 9,725,448 effective search space used: 2071520424 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -