Bombyx BLAST Result against uniref50

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BmNP01_FL5_M04
         (858 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q6AW70 Cluster: Coat protein; n=1; Bombyx mori Macula-l...    60   9e-08

>UniRef50_Q6AW70 Cluster: Coat protein; n=1; Bombyx mori Macula-like
           latent virus|Rep: Coat protein - Bombyx mori Macula-like
           latent virus
          Length = 237

 Score = 59.7 bits (138), Expect = 9e-08
 Identities = 33/67 (49%), Positives = 34/67 (50%)
 Frame = +1

Query: 538 LALMHQATLPXXLGYXXXXXXXXXXYTNHPRLDXHXHXSPAXXXXXXXXXGXXPPXSXRG 717
           LALMHQATLP  LGY          YTNHPRL+ H H S A         G       RG
Sbjct: 166 LALMHQATLPCDLGYINPIIKSPIPYTNHPRLNIHFHQS-ADAVLEGVRAGVKASVVIRG 224

Query: 718 SIXVSHP 738
           SI VSHP
Sbjct: 225 SISVSHP 231


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 385,794,140
Number of Sequences: 1657284
Number of extensions: 3740424
Number of successful extensions: 4057
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 3922
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4048
length of database: 575,637,011
effective HSP length: 100
effective length of database: 409,908,611
effective search space used: 75833093035
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)