BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_FL5_M04 (858 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF442747-1|AAL40947.1| 669|Tribolium castaneum ABC transmembran... 25 1.0 AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembran... 25 1.0 AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. 24 1.3 >AF442747-1|AAL40947.1| 669|Tribolium castaneum ABC transmembrane transporter protein. Length = 669 Score = 24.6 bits (51), Expect = 1.0 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = -2 Query: 644 KWXSSLGWLVYGIGDXMI 591 KW S L W YG G MI Sbjct: 586 KWLSFLSWFRYGNGALMI 603 >AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembrane transporter white protein. Length = 669 Score = 24.6 bits (51), Expect = 1.0 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = -2 Query: 644 KWXSSLGWLVYGIGDXMI 591 KW S L W YG G MI Sbjct: 586 KWLSFLSWFRYGNGALMI 603 >AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. Length = 697 Score = 24.2 bits (50), Expect = 1.3 Identities = 11/39 (28%), Positives = 17/39 (43%) Frame = +1 Query: 181 VSHPHSDGSSDPTRXLTXXXXXXVRSSXADTGTIYLXXA 297 +SH H+DG + P L AD T+++ A Sbjct: 232 MSHIHNDGDNKPDTILVNGFGRFKHFVGADNSTVFVPTA 270 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 88,790 Number of Sequences: 336 Number of extensions: 949 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 23763101 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -