BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_FL5_L24 (906 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1F7.09c |||allantoicase |Schizosaccharomyces pombe|chr 1|||M... 28 1.6 SPAC56E4.02c |alg13||N-acetylglucosaminyldiphosphodolichol N-ace... 28 1.6 SPAC4F8.01 |did4|SPAC644.03c, vps2|vacuolar sorting protein Did4... 28 2.1 SPAC6F6.17 |rif1|tap1, tap11, SPAPJ736.01|telomere length regula... 26 8.5 >SPAC1F7.09c |||allantoicase |Schizosaccharomyces pombe|chr 1|||Manual Length = 342 Score = 28.3 bits (60), Expect = 1.6 Identities = 14/40 (35%), Positives = 22/40 (55%), Gaps = 9/40 (22%) Frame = -1 Query: 336 PVLQPQFPCVPTQSFV---------DPIHLKICQYPHGGL 244 P+L P+ PC PTQ + + H+++C YP GG+ Sbjct: 133 PIL-PKLPCGPTQRHIYRFKEIPQQNFTHVRLCMYPDGGI 171 >SPAC56E4.02c |alg13||N-acetylglucosaminyldiphosphodolichol N-acetylglucosaminyltransferase Alg13 |Schizosaccharomyces pombe|chr 1|||Manual Length = 162 Score = 28.3 bits (60), Expect = 1.6 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = -2 Query: 164 YVARSESIMRDSDVAFSHSAALAIAQVRRNGNR 66 Y ES + D+ + SH+ A +I Q R+G R Sbjct: 63 YAPEIESYIHDASIVISHAGAGSILQTLRSGKR 95 >SPAC4F8.01 |did4|SPAC644.03c, vps2|vacuolar sorting protein Did4|Schizosaccharomyces pombe|chr 1|||Manual Length = 210 Score = 27.9 bits (59), Expect = 2.1 Identities = 10/25 (40%), Positives = 17/25 (68%) Frame = +3 Query: 240 VRVHRADTGRSSNELDRQTTEXERR 314 +R H+ GR+ ELDR+ T+ ++R Sbjct: 18 LRAHQRSLGRAERELDRERTKLDQR 42 >SPAC6F6.17 |rif1|tap1, tap11, SPAPJ736.01|telomere length regulator protein Rif1|Schizosaccharomyces pombe|chr 1|||Manual Length = 1400 Score = 25.8 bits (54), Expect = 8.5 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +1 Query: 46 MSTTYIILLPFLLTCAIASAAECENATSLS 135 +S TYIILLPF C A +++ +S Sbjct: 1023 LSKTYIILLPFQSLCPGGKQANHQSSEKMS 1052 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,980,828 Number of Sequences: 5004 Number of extensions: 30430 Number of successful extensions: 76 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 75 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 76 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 458501510 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -