BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_FL5_L24 (906 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g09360.1 68417.m01545 disease resistance protein (NBS-LRR cla... 29 3.2 At5g40580.2 68418.m04925 20S proteasome beta subunit B (PBB2) (P... 28 7.4 At5g40580.1 68418.m04924 20S proteasome beta subunit B (PBB2) (P... 28 7.4 At1g79380.1 68414.m09251 copine-related low similarity to SP|Q99... 28 7.4 At3g27430.2 68416.m03429 20S proteasome beta subunit B (PBB1) id... 28 9.8 At3g27430.1 68416.m03428 20S proteasome beta subunit B (PBB1) id... 28 9.8 >At4g09360.1 68417.m01545 disease resistance protein (NBS-LRR class), putative domain signature NBS-LRR exists, suggestive of a disease resistance protein. Length = 853 Score = 29.5 bits (63), Expect = 3.2 Identities = 23/72 (31%), Positives = 30/72 (41%) Frame = +1 Query: 40 HKMSTTYIILLPFLLTCAIASAAECENATSLSLMIDSLLATYDRESPPDSKIVVNLTLHL 219 H ST + P LL+ A CE + L S YD D I +NLT +L Sbjct: 718 HGTSTKISLFTPTLLSFAACILISCERSFYLQFPAFS----YDWNRKDDEVISINLTPNL 773 Query: 220 RHANIRESESTV 255 ++ E E TV Sbjct: 774 NLSSEIEEEETV 785 >At5g40580.2 68418.m04925 20S proteasome beta subunit B (PBB2) (PRCFC) identical to 20S proteasome beta subunit PBB2 [Arabidopsis thaliana] GI:3421104, cDNA proteasome subunit prcfc GI:2511575 Length = 274 Score = 28.3 bits (60), Expect = 7.4 Identities = 16/53 (30%), Positives = 27/53 (50%) Frame = +1 Query: 67 LLPFLLTCAIASAAECENATSLSLMIDSLLATYDRESPPDSKIVVNLTLHLRH 225 + P + C +AA+ E T M+ S L + ++ DS++V LTL +H Sbjct: 76 MAPNIYCCGAGTAADTEAVTD---MVSSQLRLHRYQTGRDSRVVTALTLLKKH 125 >At5g40580.1 68418.m04924 20S proteasome beta subunit B (PBB2) (PRCFC) identical to 20S proteasome beta subunit PBB2 [Arabidopsis thaliana] GI:3421104, cDNA proteasome subunit prcfc GI:2511575 Length = 274 Score = 28.3 bits (60), Expect = 7.4 Identities = 16/53 (30%), Positives = 27/53 (50%) Frame = +1 Query: 67 LLPFLLTCAIASAAECENATSLSLMIDSLLATYDRESPPDSKIVVNLTLHLRH 225 + P + C +AA+ E T M+ S L + ++ DS++V LTL +H Sbjct: 76 MAPNIYCCGAGTAADTEAVTD---MVSSQLRLHRYQTGRDSRVVTALTLLKKH 125 >At1g79380.1 68414.m09251 copine-related low similarity to SP|Q99829 Copine I {Homo sapiens} Length = 401 Score = 28.3 bits (60), Expect = 7.4 Identities = 22/83 (26%), Positives = 34/83 (40%) Frame = -2 Query: 434 GXXRA*XPRPVXXSRVXXSNHRQPSTSVPEXTXQCCSPNSPAFXLSRLSIQFI*RSASIR 255 G + PRP +N PST+ P Q + + P +R + F + Sbjct: 320 GLAKTIVPRPPPIPYTPPTNAELPSTASPASPEQ--TQSCPICLTNRKDVAF--SCGHMT 375 Query: 254 TVDSDSRMLACLKCRVRLTTILE 186 D S++ C CRVR+T L+ Sbjct: 376 CGDCGSKISNCPICRVRITNRLK 398 >At3g27430.2 68416.m03429 20S proteasome beta subunit B (PBB1) identical to 20S proteasome beta subunit PBB1 (PBB1) GB:AAC32066 [Arabidopsis thaliana] (Genetics 149 (2), 677-692 (1998)); contains Pfam profile: PF00227 proteasome A-type and B-type; Length = 273 Score = 27.9 bits (59), Expect = 9.8 Identities = 15/53 (28%), Positives = 27/53 (50%) Frame = +1 Query: 67 LLPFLLTCAIASAAECENATSLSLMIDSLLATYDRESPPDSKIVVNLTLHLRH 225 + P + C +AA+ E T M+ S L + ++ DS+++ LTL +H Sbjct: 76 MAPNIYCCGAGTAADTEAVTD---MVSSQLRLHRYQTGRDSRVITALTLLKKH 125 >At3g27430.1 68416.m03428 20S proteasome beta subunit B (PBB1) identical to 20S proteasome beta subunit PBB1 (PBB1) GB:AAC32066 [Arabidopsis thaliana] (Genetics 149 (2), 677-692 (1998)); contains Pfam profile: PF00227 proteasome A-type and B-type; Length = 267 Score = 27.9 bits (59), Expect = 9.8 Identities = 15/53 (28%), Positives = 27/53 (50%) Frame = +1 Query: 67 LLPFLLTCAIASAAECENATSLSLMIDSLLATYDRESPPDSKIVVNLTLHLRH 225 + P + C +AA+ E T M+ S L + ++ DS+++ LTL +H Sbjct: 76 MAPNIYCCGAGTAADTEAVTD---MVSSQLRLHRYQTGRDSRVITALTLLKKH 125 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,251,944 Number of Sequences: 28952 Number of extensions: 183249 Number of successful extensions: 396 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 392 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 396 length of database: 12,070,560 effective HSP length: 81 effective length of database: 9,725,448 effective search space used: 2139598560 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -