Bombyx BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BmNP01_FL5_L08
         (830 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB231585-1|BAE17127.1|  898|Apis mellifera Mahya protein.              32   0.006
AY463910-1|AAR24352.1|  843|Apis mellifera metabotropic glutamat...    22   8.0  
AB161181-1|BAD08343.1|  933|Apis mellifera metabotropic glutamat...    22   8.0  

>AB231585-1|BAE17127.1|  898|Apis mellifera Mahya protein.
          Length = 898

 Score = 32.3 bits (70), Expect = 0.006
 Identities = 23/61 (37%), Positives = 32/61 (52%), Gaps = 4/61 (6%)
 Frame = +3

Query: 171 FSEHFRNLGPVNGNLTGEQAKRFMLQSQLPPPV----LGQIWSLADTNADGKLDLKEFSI 338
           FS + RN    NGNL  E+ ++F     L        LG + S  DT+ DGKL++ EF +
Sbjct: 242 FSHYDRNN---NGNLEREELEQFAENEDLEELCRGCNLGHMISYDDTDGDGKLNVNEFYM 298

Query: 339 A 341
           A
Sbjct: 299 A 299


>AY463910-1|AAR24352.1|  843|Apis mellifera metabotropic glutamate
           receptor 1 protein.
          Length = 843

 Score = 21.8 bits (44), Expect = 8.0
 Identities = 7/9 (77%), Positives = 9/9 (100%)
 Frame = -1

Query: 161 LVCLYSPRV 135
           LVCLYSP++
Sbjct: 752 LVCLYSPKI 760


>AB161181-1|BAD08343.1|  933|Apis mellifera metabotropic glutamate
           receptor protein.
          Length = 933

 Score = 21.8 bits (44), Expect = 8.0
 Identities = 7/9 (77%), Positives = 9/9 (100%)
 Frame = -1

Query: 161 LVCLYSPRV 135
           LVCLYSP++
Sbjct: 842 LVCLYSPKI 850


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 226,363
Number of Sequences: 438
Number of extensions: 4964
Number of successful extensions: 7
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 7
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 7
length of database: 146,343
effective HSP length: 57
effective length of database: 121,377
effective search space used: 26581563
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)