BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_FL5_L03 (861 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC4F8.01 |did4|SPAC644.03c, vps2|vacuolar sorting protein Did4... 30 0.37 SPAC56E4.02c |alg13||N-acetylglucosaminyldiphosphodolichol N-ace... 28 1.5 SPCC1020.10 |oca2||serine/threonine protein kinase Oca2 |Schizos... 27 4.5 SPBC557.04 |ppk29||Ark1/Prk1 family protein kinase Ppk29|Schizos... 26 6.0 SPBC12C2.02c |ste20|ste16|sterility protein Ste20|Schizosaccharo... 26 7.9 SPAC6F6.17 |rif1|tap1, tap11, SPAPJ736.01|telomere length regula... 26 7.9 >SPAC4F8.01 |did4|SPAC644.03c, vps2|vacuolar sorting protein Did4|Schizosaccharomyces pombe|chr 1|||Manual Length = 210 Score = 30.3 bits (65), Expect = 0.37 Identities = 11/25 (44%), Positives = 19/25 (76%) Frame = +3 Query: 222 VRVHRANTGRSSNELDRQTTELERR 296 +R H+ + GR+ ELDR+ T+L++R Sbjct: 18 LRAHQRSLGRAERELDRERTKLDQR 42 >SPAC56E4.02c |alg13||N-acetylglucosaminyldiphosphodolichol N-acetylglucosaminyltransferase Alg13 |Schizosaccharomyces pombe|chr 1|||Manual Length = 162 Score = 28.3 bits (60), Expect = 1.5 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = -3 Query: 145 YVARSESIMRDSDVAFSHSAALAIAQVRRNGNR 47 Y ES + D+ + SH+ A +I Q R+G R Sbjct: 63 YAPEIESYIHDASIVISHAGAGSILQTLRSGKR 95 >SPCC1020.10 |oca2||serine/threonine protein kinase Oca2 |Schizosaccharomyces pombe|chr 3|||Manual Length = 650 Score = 26.6 bits (56), Expect = 4.5 Identities = 14/46 (30%), Positives = 24/46 (52%) Frame = +1 Query: 400 RARVSNNGSVSWIKRLDISTPISMQLDNWPNDMQTCTFKFGSRMHN 537 RA +++ + +KR DI + DNW ND+ C + G +H+ Sbjct: 588 RAVIAHMLELDPVKRYDIHRVFA---DNWINDISMCHMENGKVIHS 630 >SPBC557.04 |ppk29||Ark1/Prk1 family protein kinase Ppk29|Schizosaccharomyces pombe|chr 2|||Manual Length = 872 Score = 26.2 bits (55), Expect = 6.0 Identities = 10/24 (41%), Positives = 13/24 (54%) Frame = -1 Query: 663 GEXPPXHGPXXAPXWTXPSHPTLP 592 G PP P AP + P+ PT+P Sbjct: 353 GSRPPPPPPMPAPIYNVPNVPTVP 376 >SPBC12C2.02c |ste20|ste16|sterility protein Ste20|Schizosaccharomyces pombe|chr 2|||Manual Length = 1309 Score = 25.8 bits (54), Expect = 7.9 Identities = 14/51 (27%), Positives = 24/51 (47%) Frame = -2 Query: 578 CIFFCQSPKSISSLLCILEPNLNVQVCMSLGQLSNCIEIGVLMSKRFIQET 426 C+ C++ + + +C NL QV L++ EIG + RF+ T Sbjct: 942 CLEVCKTAVKVLNEVCARNENLLAQVVQLQPSLAHLGEIGSPLLLRFLATT 992 >SPAC6F6.17 |rif1|tap1, tap11, SPAPJ736.01|telomere length regulator protein Rif1|Schizosaccharomyces pombe|chr 1|||Manual Length = 1400 Score = 25.8 bits (54), Expect = 7.9 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +3 Query: 27 MSTTYIILLPFLLTCAIASAAECENATSLS 116 +S TYIILLPF C A +++ +S Sbjct: 1023 LSKTYIILLPFQSLCPGGKQANHQSSEKMS 1052 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,951,610 Number of Sequences: 5004 Number of extensions: 58058 Number of successful extensions: 166 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 164 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 166 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 428468660 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -