BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_FL5_L02 (823 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_04_0373 + 20732358-20732675,20733555-20734440,20734523-20735625 32 0.48 07_01_0373 + 2783596-2784933 32 0.63 09_04_0506 - 18188785-18190599 29 3.4 03_05_0824 + 27980191-27980243,27980633-27980671,27980974-279820... 29 3.4 02_01_0219 - 1437685-1437723,1437932-1438091,1438385-1438514,143... 29 3.4 04_03_0174 + 12263843-12265126 29 4.5 04_01_0041 - 464695-464850,467485-469029 29 5.9 01_05_0227 - 19512866-19514983 29 5.9 02_05_0788 + 31758119-31758384,31758482-31758634,31759385-317595... 28 7.8 >05_04_0373 + 20732358-20732675,20733555-20734440,20734523-20735625 Length = 768 Score = 32.3 bits (70), Expect = 0.48 Identities = 23/72 (31%), Positives = 37/72 (51%), Gaps = 2/72 (2%) Frame = +3 Query: 534 HPPLAISATSTRSSNPRIPYTNHPRLNIHFHQSPERRTXREFAPGL-KPPVVIRGSI-SV 707 HPP + + + NPR + NH RL+ + RR + A + PP +R +I +V Sbjct: 119 HPPPQSAGDLSAARNPRGAHFNHRRLHHPPIRLKHRRDGEQPANVVAMPPSKLRKAIGAV 178 Query: 708 SHPSSLGMAKXG 743 +S+G+AK G Sbjct: 179 KDQTSIGLAKVG 190 >07_01_0373 + 2783596-2784933 Length = 445 Score = 31.9 bits (69), Expect = 0.63 Identities = 12/28 (42%), Positives = 21/28 (75%) Frame = -3 Query: 92 EEEKALTKEGMAEAAETXKGTIXSMNRS 9 E+++ LTK G + +ET KG++ S++RS Sbjct: 151 EQQQQLTKSGCSSTSETSKGSVLSLSRS 178 >09_04_0506 - 18188785-18190599 Length = 604 Score = 29.5 bits (63), Expect = 3.4 Identities = 19/64 (29%), Positives = 28/64 (43%), Gaps = 2/64 (3%) Frame = +2 Query: 566 PIIKSPNSIHQPPQT*HPFPSIP*TPYXKGVRAGVKASGCHQRLHQRI--SPLVTGHG*X 739 P+ PN +H PPQ P + P P ++ G G H++ P+V G+G Sbjct: 120 PVPDRPNPVHLPPQPQPPVAAAPPPPPHNQIQPG-GGDGFHRQGGGNYGGGPIVVGNGGG 178 Query: 740 GFRP 751 G P Sbjct: 179 GDGP 182 >03_05_0824 + 27980191-27980243,27980633-27980671,27980974-27982023, 27983097-27983262,27983439-27983549,27983637-27983688, 27984691-27984859,27985604-27985883 Length = 639 Score = 29.5 bits (63), Expect = 3.4 Identities = 25/74 (33%), Positives = 37/74 (50%), Gaps = 4/74 (5%) Frame = +1 Query: 400 PSLKIPVTVDL--CWTTADVTVEGVNVLATPSSSRITIGGLALMHQATLPWRSR--LHQP 567 P KIP +++ C T+ D T ++ S+ +ITIG L L+ + WR R LH+P Sbjct: 220 PGSKIPCNLEVSDCLTSHDGTSA-----SSSSNEKITIGLLFLLQKLCKNWRLRRFLHRP 274 Query: 568 DHQIPEFHTPTTPD 609 +I TP D Sbjct: 275 -RRISNGTTPVFDD 287 >02_01_0219 - 1437685-1437723,1437932-1438091,1438385-1438514, 1438627-1438696,1439264-1439407,1439771-1439837, 1439970-1440019,1440386-1440559,1440881-1440934, 1441008-1441112 Length = 330 Score = 29.5 bits (63), Expect = 3.4 Identities = 25/85 (29%), Positives = 38/85 (44%), Gaps = 2/85 (2%) Frame = +1 Query: 283 TETKSNSVTVQSLPNVSSIIKGYRDAYLVNLEAVVFPSAPSL--KIPVTVDLCWTTADVT 456 TE +N V V L SS GY D + ++ V + K+ V +D TAD++ Sbjct: 167 TEAGANRVLVCDLH--SSQAMGYFDIPVDHVYGQVMNLIGDVRGKVAVMMDDMIDTADIS 224 Query: 457 VEGVNVLATPSSSRITIGGLALMHQ 531 + +N+L P G L+HQ Sbjct: 225 LPNINILMKPIKLGTIAKGAELLHQ 249 >04_03_0174 + 12263843-12265126 Length = 427 Score = 29.1 bits (62), Expect = 4.5 Identities = 16/43 (37%), Positives = 24/43 (55%) Frame = +3 Query: 624 HQSPERRTXREFAPGLKPPVVIRGSISVSHPSSLGMAKXGFAP 752 H +P RT AP L PV++ GS S + P +LG+ + +P Sbjct: 119 HDAPPHRTAS--APSL--PVLVSGSASAAPPVTLGLPRSASSP 157 >04_01_0041 - 464695-464850,467485-469029 Length = 566 Score = 28.7 bits (61), Expect = 5.9 Identities = 18/63 (28%), Positives = 32/63 (50%), Gaps = 1/63 (1%) Frame = +1 Query: 244 IIPFQRLYFDLTGTETKSNSVTVQSLPNVSSIIKGYRDAYLVNLEAVVFPS-APSLKIPV 420 +I R + D++ T +SN + V +LP VSS + Y D ++ + P P ++ V Sbjct: 40 LISVFRPFTDVSLTLCRSNYIGVTNLPIVSSECEAYYDDFVSGADFTARPQVVPPWRLAV 99 Query: 421 TVD 429 +D Sbjct: 100 PLD 102 >01_05_0227 - 19512866-19514983 Length = 705 Score = 28.7 bits (61), Expect = 5.9 Identities = 11/31 (35%), Positives = 19/31 (61%) Frame = -3 Query: 461 STVTSAVVQQRSTVTGILRLGAEGKTTASRL 369 S +T + +QQ + ++ LG GKTT ++L Sbjct: 18 SKLTESSIQQNIKIVSVIGLGGSGKTTLAKL 48 >02_05_0788 + 31758119-31758384,31758482-31758634,31759385-31759509, 31759650-31759678,31760943-31761008,31761059-31761125, 31761226-31761370,31761404-31761451,31762014-31762182, 31762645-31762779,31762858-31763064,31763608-31763735, 31763815-31763866,31764046-31764060,31764502-31764609 Length = 570 Score = 28.3 bits (60), Expect = 7.8 Identities = 21/86 (24%), Positives = 36/86 (41%) Frame = +1 Query: 235 QRLIIPFQRLYFDLTGTETKSNSVTVQSLPNVSSIIKGYRDAYLVNLEAVVFPSAPSLKI 414 Q I + ++ L N TV + N + GY+ +N+ + PSLK Sbjct: 198 QVFCIVLEMFFYQLLQLLKVPNEKTVNVIENAIQTLPGYQPPKHINIGEYISSHVPSLK- 256 Query: 415 PVTVDLCWTTADVTVEGVNVLATPSS 492 D C T ++ +EG++ L S+ Sbjct: 257 ----DFCEPTVEM-LEGMSALKALST 277 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,887,489 Number of Sequences: 37544 Number of extensions: 475511 Number of successful extensions: 1276 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 1234 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1276 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2256438528 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -