BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_FL5_L02 (823 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_35609| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.65 SB_6924| Best HMM Match : TTL (HMM E-Value=4.4e-09) 31 1.1 SB_8332| Best HMM Match : PDZ (HMM E-Value=1.3e-17) 30 2.6 SB_33380| Best HMM Match : Herpes_capsid (HMM E-Value=3) 29 3.4 SB_30122| Best HMM Match : YadA (HMM E-Value=2) 29 4.6 SB_24452| Best HMM Match : PKD_channel (HMM E-Value=0) 29 4.6 SB_57242| Best HMM Match : Extensin_2 (HMM E-Value=2.4) 28 8.0 >SB_35609| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 31.9 bits (69), Expect = 0.65 Identities = 22/56 (39%), Positives = 30/56 (53%), Gaps = 1/56 (1%) Frame = +3 Query: 525 ASSHPPLAISATSTRSSNPRIPYTNHPRLNIHFHQSP-ERRTXREFAPGLKPPVVI 689 ASS L+ +ATST +S+P P HP N+ FH SP R+ F + P +I Sbjct: 73 ASSSLALSFAATSTSTSHPLTPSFGHPP-NL-FHISPHSMRSADHFPTNMDPSSLI 126 >SB_6924| Best HMM Match : TTL (HMM E-Value=4.4e-09) Length = 458 Score = 31.1 bits (67), Expect = 1.1 Identities = 19/48 (39%), Positives = 23/48 (47%), Gaps = 2/48 (4%) Frame = +3 Query: 414 TSHS*PLLDYC*RHS*RSQCAGHPFILSHYYWRSRPY--ASSHPPLAI 551 T + LL YC R AGHPF+L Y + R Y +S PL I Sbjct: 91 TKYDIDLLGYCTEQEIRRVVAGHPFLLDGYKFDLRVYVLVTSCDPLRI 138 >SB_8332| Best HMM Match : PDZ (HMM E-Value=1.3e-17) Length = 1038 Score = 29.9 bits (64), Expect = 2.6 Identities = 11/32 (34%), Positives = 21/32 (65%) Frame = -2 Query: 609 VWGGWCMEFGDLMIGLM*PRSPGEGGLMHKGE 514 + GG C +G+L I ++ ++PG G++ KG+ Sbjct: 558 IGGGMCSPYGNLPIHILDIQNPGISGVLRKGD 589 >SB_33380| Best HMM Match : Herpes_capsid (HMM E-Value=3) Length = 474 Score = 29.5 bits (63), Expect = 3.4 Identities = 18/63 (28%), Positives = 28/63 (44%) Frame = -2 Query: 456 CDVSSSPTKVNCDWYFEARGGRKNDSLKIDKIRVAVAFYDGGDVR**LHSDTVRFGFGAS 277 C + P + W+F + G K DS + + + G V +HS VR G GA+ Sbjct: 275 CVRAHLPNAADQPWFFLSNTGAKIDSNNVQSLLRSFQRSTGVQVSKPIHSTAVRCGSGAT 334 Query: 276 KIE 268 + E Sbjct: 335 EEE 337 >SB_30122| Best HMM Match : YadA (HMM E-Value=2) Length = 408 Score = 29.1 bits (62), Expect = 4.6 Identities = 12/37 (32%), Positives = 22/37 (59%) Frame = +1 Query: 394 SAPSLKIPVTVDLCWTTADVTVEGVNVLATPSSSRIT 504 S P K+P+T T+A+VT +++ +PS + +T Sbjct: 239 SRPETKVPITTIGASTSAEVTTSQRDLMPSPSQAHVT 275 >SB_24452| Best HMM Match : PKD_channel (HMM E-Value=0) Length = 1433 Score = 29.1 bits (62), Expect = 4.6 Identities = 15/39 (38%), Positives = 26/39 (66%), Gaps = 3/39 (7%) Frame = +1 Query: 268 FDLTGTETKSNSVTVQS---LPNVSSIIKGYRDAYLVNL 375 F +TG E KS+S+T++ +P V ++ +G D +LV+L Sbjct: 485 FTITGQEGKSDSITIRHADVIPRV-ALARGNEDVFLVHL 522 >SB_57242| Best HMM Match : Extensin_2 (HMM E-Value=2.4) Length = 308 Score = 28.3 bits (60), Expect = 8.0 Identities = 22/56 (39%), Positives = 29/56 (51%), Gaps = 1/56 (1%) Frame = +3 Query: 483 PFILSHYYWRSRPYASSHPPLAISA-TSTRSSNPRIPYTNHPRLNIHFHQSPERRT 647 P +LS+ RP +P L S TST S++PRIPY+ L Q+ E RT Sbjct: 78 PLVLSYLDPLGRP---ENPVLLWSCLTSTHSADPRIPYSFGRVLPRPTRQTRESRT 130 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,125,726 Number of Sequences: 59808 Number of extensions: 490700 Number of successful extensions: 1380 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1164 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1377 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2299585728 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -