BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_FL5_K24 (953 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g05130.1 68418.m00544 SNF2 domain-containing protein / helica... 32 0.49 >At5g05130.1 68418.m00544 SNF2 domain-containing protein / helicase domain-containing protein / RING finger domain-containing protein similar to transcription factor RUSH-1alpha [Oryctolagus cuniculus] GI:1655930; contains Pfam profiles PF00271: Helicase conserved C-terminal domain, PF00176: SNF2 family N-terminal domain, PF00097: Zinc finger, C3HC4 type (RING finger) Length = 862 Score = 32.3 bits (70), Expect = 0.49 Identities = 15/69 (21%), Positives = 37/69 (53%), Gaps = 1/69 (1%) Frame = -2 Query: 211 LKCRVRLXTILESGGESRSYVARSESIM-RDSDVAFSHSAALAIAQVRRNGNKNNISRRH 35 + C++ + LE+ +S ++R ++ +SD +F S A+ + + NG+K ++ + Sbjct: 126 IPCQIHVFAKLEASSTVKSTISRGGLVLISESDTSFGLSEAVVVKEQMGNGDKRSVDKIF 185 Query: 34 FMTTDLLKL 8 + + +KL Sbjct: 186 KLVDENVKL 194 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,517,171 Number of Sequences: 28952 Number of extensions: 172993 Number of successful extensions: 542 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 518 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 539 length of database: 12,070,560 effective HSP length: 81 effective length of database: 9,725,448 effective search space used: 2295205728 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -