Bombyx BLAST Result against arabidopsis

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BmNP01_FL5_K24
         (953 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At5g05130.1 68418.m00544 SNF2 domain-containing protein / helica...    32   0.49 

>At5g05130.1 68418.m00544 SNF2 domain-containing protein / helicase
           domain-containing protein / RING finger
           domain-containing protein similar to transcription
           factor RUSH-1alpha [Oryctolagus cuniculus] GI:1655930;
           contains Pfam profiles PF00271: Helicase conserved
           C-terminal domain, PF00176: SNF2 family N-terminal
           domain, PF00097: Zinc finger, C3HC4 type (RING finger)
          Length = 862

 Score = 32.3 bits (70), Expect = 0.49
 Identities = 15/69 (21%), Positives = 37/69 (53%), Gaps = 1/69 (1%)
 Frame = -2

Query: 211 LKCRVRLXTILESGGESRSYVARSESIM-RDSDVAFSHSAALAIAQVRRNGNKNNISRRH 35
           + C++ +   LE+    +S ++R   ++  +SD +F  S A+ + +   NG+K ++ +  
Sbjct: 126 IPCQIHVFAKLEASSTVKSTISRGGLVLISESDTSFGLSEAVVVKEQMGNGDKRSVDKIF 185

Query: 34  FMTTDLLKL 8
            +  + +KL
Sbjct: 186 KLVDENVKL 194


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 10,517,171
Number of Sequences: 28952
Number of extensions: 172993
Number of successful extensions: 542
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 518
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 539
length of database: 12,070,560
effective HSP length: 81
effective length of database: 9,725,448
effective search space used: 2295205728
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)