BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_FL5_K22 (918 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g23150.1 68418.m02707 PWWP domain-containing protein identica... 43 3e-04 At1g54215.1 68414.m06180 proline-rich family protein contains pr... 39 0.004 At1g31810.1 68414.m03904 formin homology 2 domain-containing pro... 38 0.009 At4g13340.1 68417.m02084 leucine-rich repeat family protein / ex... 37 0.016 At3g22800.1 68416.m02874 leucine-rich repeat family protein / ex... 37 0.016 At4g15160.1 68417.m02327 protease inhibitor/seed storage/lipid t... 36 0.028 At5g07760.1 68418.m00888 formin homology 2 domain-containing pro... 34 0.11 At3g19430.1 68416.m02464 late embryogenesis abundant protein-rel... 33 0.20 At1g61080.1 68414.m06877 proline-rich family protein 33 0.20 At5g58160.1 68418.m07280 formin homology 2 domain-containing pro... 33 0.35 At5g07780.1 68418.m00890 formin homology 2 domain-containing pro... 33 0.35 At4g15200.1 68417.m02329 formin homology 2 domain-containing pro... 33 0.35 At1g02405.1 68414.m00187 proline-rich family protein contains pr... 33 0.35 At1g49750.1 68414.m05579 leucine-rich repeat family protein cont... 32 0.46 At2g15880.1 68415.m01820 leucine-rich repeat family protein / ex... 32 0.61 At5g54650.2 68418.m06805 formin homology 2 domain-containing pro... 31 0.81 At5g54650.1 68418.m06804 formin homology 2 domain-containing pro... 31 0.81 At3g24480.1 68416.m03070 leucine-rich repeat family protein / ex... 31 0.81 At1g59910.1 68414.m06749 formin homology 2 domain-containing pro... 31 0.81 At4g33970.1 68417.m04820 leucine-rich repeat family protein / ex... 31 1.1 At1g23040.1 68414.m02878 hydroxyproline-rich glycoprotein family... 31 1.1 At4g18670.1 68417.m02762 leucine-rich repeat family protein / ex... 31 1.4 At1g79730.1 68414.m09300 hydroxyproline-rich glycoprotein family... 31 1.4 At1g60200.1 68414.m06781 splicing factor PWI domain-containing p... 31 1.4 At2g25050.1 68415.m02996 formin homology 2 domain-containing pro... 30 1.9 At1g24150.1 68414.m03047 formin homology 2 domain-containing pro... 30 1.9 At1g20130.1 68414.m02518 family II extracellular lipase, putativ... 30 1.9 At5g48920.1 68418.m06052 hydroxyproline-rich glycoprotein family... 30 2.5 At4g27850.1 68417.m03999 proline-rich family protein contains pr... 30 2.5 At3g03776.1 68416.m00385 hydroxyproline-rich glycoprotein family... 30 2.5 At1g53260.1 68414.m06035 hypothetical protein low similarity to ... 30 2.5 At1g49490.1 68414.m05547 leucine-rich repeat family protein / ex... 30 2.5 At4g39260.1 68417.m05557 glycine-rich RNA-binding protein 8 (GRP... 29 3.3 At4g22470.1 68417.m03245 protease inhibitor/seed storage/lipid t... 29 3.3 At3g53330.1 68416.m05884 plastocyanin-like domain-containing pro... 29 3.3 At3g19020.1 68416.m02415 leucine-rich repeat family protein / ex... 29 3.3 At5g19800.1 68418.m02353 hydroxyproline-rich glycoprotein family... 29 4.3 At4g30460.1 68417.m04325 glycine-rich protein 29 4.3 At4g28300.2 68417.m04053 hydroxyproline-rich glycoprotein family... 29 4.3 At4g28300.1 68417.m04052 hydroxyproline-rich glycoprotein family... 29 4.3 At3g20850.1 68416.m02636 proline-rich family protein contains pr... 29 4.3 At3g19320.1 68416.m02450 leucine-rich repeat family protein cont... 29 4.3 At3g06140.1 68416.m00705 zinc finger (C3HC4-type RING finger) fa... 29 4.3 At1g49270.1 68414.m05524 protein kinase family protein contains ... 29 4.3 At1g10620.1 68414.m01204 protein kinase family protein contains ... 29 4.3 At5g56330.1 68418.m07031 carbonic anhydrase family protein conta... 29 5.7 At5g26080.1 68418.m03103 proline-rich family protein contains pr... 29 5.7 At3g22120.1 68416.m02792 protease inhibitor/seed storage/lipid t... 29 5.7 At2g29210.1 68415.m03550 splicing factor PWI domain-containing p... 29 5.7 At1g68725.1 68414.m07853 arabinogalactan-protein, putative (AGP1... 29 5.7 At1g27710.1 68414.m03387 glycine-rich protein 29 5.7 At5g38560.1 68418.m04662 protein kinase family protein contains ... 28 7.5 At5g19810.1 68418.m02354 proline-rich extensin-like family prote... 28 7.5 At5g08230.1 68418.m00965 PWWP domain-containing protein putative... 28 7.5 At4g19920.1 68417.m02918 disease resistance protein (TIR class),... 28 7.5 At3g55220.1 68416.m06133 splicing factor, putative contains CPSF... 28 7.5 At3g55200.1 68416.m06131 splicing factor, putative contains CPSF... 28 7.5 At3g50580.1 68416.m05532 proline-rich family protein contains pr... 28 7.5 At3g24550.1 68416.m03083 protein kinase family protein contains ... 28 7.5 At2g27390.1 68415.m03306 proline-rich family protein contains pr... 28 7.5 At1g67770.1 68414.m07733 RNA-binding protein, putative similar t... 28 7.5 At1g12040.1 68414.m01390 leucine-rich repeat family protein / ex... 28 7.5 At4g18570.1 68417.m02749 proline-rich family protein common fami... 28 10.0 At1g70990.1 68414.m08190 proline-rich family protein 28 10.0 At1g02710.1 68414.m00222 glycine-rich protein 28 10.0 >At5g23150.1 68418.m02707 PWWP domain-containing protein identical to cDNA putative transcription factor (HUA2) GI:4868119; contains Pfam profile PF00855: PWWP domain Length = 1392 Score = 42.7 bits (96), Expect = 3e-04 Identities = 19/47 (40%), Positives = 22/47 (46%) Frame = +2 Query: 719 PAXNLSXXXLPPPPXXXXXRPXPXPPXRPPLPXXNSXXSCXXPPPTP 859 P+ L LPPPP P P PP +PP P + S PPP P Sbjct: 1082 PSPPLPPSSLPPPPPAALFPPLPPPPSQPPPPPLSPPPSPPPPPPPP 1128 >At1g54215.1 68414.m06180 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 169 Score = 39.1 bits (87), Expect = 0.004 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +2 Query: 749 PPPPXXXXXRPXPXPPXRPPLPXXNSXXSCXXPPPTP 859 PPPP P P PP PP P N PPP P Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPAVNMSVETGIPPPPP 79 Score = 27.9 bits (59), Expect = 10.0 Identities = 19/50 (38%), Positives = 21/50 (42%), Gaps = 3/50 (6%) Frame = +2 Query: 719 PAXNLSXXX---LPPPPXXXXXRPXPXPPXRPPLPXXNSXXSCXXPPPTP 859 PA N+S PPPP +P PP PP P S PPP P Sbjct: 64 PAVNMSVETGIPPPPPPVTDMIKPLSSPP--PPQPPPRS-----QPPPKP 106 >At1g31810.1 68414.m03904 formin homology 2 domain-containing protein / FH2 domain-containing protein low similarity to SP|P48608 Diaphanous protein {Drosophila melanogaster}; contains Pfam profile PF02181: Formin Homology 2(FH2) Domain Length = 1201 Score = 37.9 bits (84), Expect = 0.009 Identities = 15/37 (40%), Positives = 17/37 (45%) Frame = +2 Query: 749 PPPPXXXXXRPXPXPPXRPPLPXXNSXXSCXXPPPTP 859 PPPP P PP PPLP ++ PPP P Sbjct: 684 PPPPPKANISNAPKPPAPPPLPPSSTRLGAPPPPPPP 720 Score = 33.5 bits (73), Expect = 0.20 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = +2 Query: 752 PPPXXXXXRPXPXPPXRPPLPXXNSXXSCXXPPPTP 859 PPP P P PP PP P S S PPP P Sbjct: 588 PPPLAQPPPPRPPPPPPPP-PSSRSIPSPSAPPPPP 622 Score = 30.7 bits (66), Expect = 1.4 Identities = 15/41 (36%), Positives = 16/41 (39%), Gaps = 4/41 (9%) Frame = +2 Query: 749 PPPPXXXXX----RPXPXPPXRPPLPXXNSXXSCXXPPPTP 859 PPPP + P PP PP P C PPP P Sbjct: 623 PPPPSFGSTGNKRQAQPPPPPPPPPPTRIPAAKCAPPPPPP 663 Score = 29.9 bits (64), Expect = 2.5 Identities = 14/37 (37%), Positives = 15/37 (40%) Frame = +2 Query: 749 PPPPXXXXXRPXPXPPXRPPLPXXNSXXSCXXPPPTP 859 PPPP PP PP P +S PP TP Sbjct: 644 PPPPPTRIPAAKCAPPPPPPPPTSHSGSIRVGPPSTP 680 Score = 29.1 bits (62), Expect = 4.3 Identities = 15/47 (31%), Positives = 16/47 (34%) Frame = +2 Query: 719 PAXNLSXXXLPPPPXXXXXRPXPXPPXRPPLPXXNSXXSCXXPPPTP 859 P L +PPP P PP PP S PPP P Sbjct: 578 PPPPLPSRSIPPPLAQPPPPRPPPPPPPPPSSRSIPSPSAPPPPPPP 624 Score = 28.3 bits (60), Expect = 7.5 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = +2 Query: 779 PXPXPPXRPPLPXXNSXXSCXXPPPTP 859 P P PP PPL + S PPP P Sbjct: 482 PPPPPPPPPPLFTSTTSFSPSQPPPPP 508 Score = 28.3 bits (60), Expect = 7.5 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = +2 Query: 779 PXPXPPXRPPLPXXNSXXSCXXPPP 853 P P PP PPLP + PPP Sbjct: 572 PPPPPPPPPPLPSRSIPPPLAQPPP 596 Score = 27.9 bits (59), Expect = 10.0 Identities = 16/42 (38%), Positives = 17/42 (40%), Gaps = 5/42 (11%) Frame = +2 Query: 749 PPPPXXXXXRPXPX--PPXRPPLPXXNSXXS---CXXPPPTP 859 PPPP P P PP PP P S + PPP P Sbjct: 603 PPPPPSSRSIPSPSAPPPPPPPPPSFGSTGNKRQAQPPPPPP 644 >At4g13340.1 68417.m02084 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 760 Score = 37.1 bits (82), Expect = 0.016 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +2 Query: 749 PPPPXXXXXRPXPXPPXRPPLPXXNSXXSCXXPPPTP 859 PPPP P P PP PP P S PPP P Sbjct: 456 PPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPP 492 Score = 36.7 bits (81), Expect = 0.022 Identities = 15/37 (40%), Positives = 16/37 (43%) Frame = +2 Query: 749 PPPPXXXXXRPXPXPPXRPPLPXXNSXXSCXXPPPTP 859 PPPP P P PP PP P + PPP P Sbjct: 457 PPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPPP 493 Score = 36.3 bits (80), Expect = 0.028 Identities = 15/37 (40%), Positives = 16/37 (43%) Frame = +2 Query: 749 PPPPXXXXXRPXPXPPXRPPLPXXNSXXSCXXPPPTP 859 PPPP P P PP PP P + PPP P Sbjct: 441 PPPPPPPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPP 477 Score = 33.5 bits (73), Expect = 0.20 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +2 Query: 749 PPPPXXXXXRPXPXPPXRPPLPXXNSXXSCXXPPPTP 859 PPPP P PP PP P S PPP P Sbjct: 440 PPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPPPPPPP 476 Score = 33.1 bits (72), Expect = 0.26 Identities = 14/37 (37%), Positives = 15/37 (40%) Frame = +2 Query: 749 PPPPXXXXXRPXPXPPXRPPLPXXNSXXSCXXPPPTP 859 PPPP P P P PP P + PPP P Sbjct: 472 PPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPPPPP 508 Score = 33.1 bits (72), Expect = 0.26 Identities = 16/41 (39%), Positives = 18/41 (43%), Gaps = 4/41 (9%) Frame = +2 Query: 749 PPPPXXXXXRPXPXPPXRPPLPXXN----SXXSCXXPPPTP 859 PPPP P P PP PP P + S PPP+P Sbjct: 487 PPPPPPPVYSPPPPPPPPPPPPVYSPPPPPVYSSPPPPPSP 527 Score = 31.5 bits (68), Expect = 0.81 Identities = 14/37 (37%), Positives = 15/37 (40%) Frame = +2 Query: 749 PPPPXXXXXRPXPXPPXRPPLPXXNSXXSCXXPPPTP 859 PPPP P PP PP P + PPP P Sbjct: 426 PPPPSPPPPVYSPPPPPPPPPPVYSPPPPPPPPPPPP 462 Score = 31.5 bits (68), Expect = 0.81 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +2 Query: 749 PPPPXXXXXRPXPXPPXRPPLPXXNSXXSCXXPPPTP 859 PPPP P P P PP P C PPP P Sbjct: 591 PPPPPTPVSSPPPTPVYSPPPP-----PPCIEPPPPP 622 Score = 30.7 bits (66), Expect = 1.4 Identities = 14/44 (31%), Positives = 15/44 (34%) Frame = +3 Query: 678 PXHXXPTLXPPRXHXPXTXPXXXSPXPXPPXXXAXXPXHPXAPP 809 P P PP P P SP P PP P + PP Sbjct: 442 PPPPPPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPPPVYSPPPP 485 Score = 30.7 bits (66), Expect = 1.4 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +2 Query: 749 PPPPXXXXXRPXPXPPXRPPLPXXNSXXSCXXPPPTP 859 PPPP P PP PP P PPP P Sbjct: 455 PPPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPP 491 Score = 30.7 bits (66), Expect = 1.4 Identities = 14/39 (35%), Positives = 15/39 (38%) Frame = +3 Query: 693 PTLXPPRXHXPXTXPXXXSPXPXPPXXXAXXPXHPXAPP 809 P PP P P SP P PP + P P PP Sbjct: 468 PPPPPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPPP 506 Score = 30.3 bits (65), Expect = 1.9 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +2 Query: 749 PPPPXXXXXRPXPXPPXRPPLPXXNSXXSCXXPPPTP 859 PPPP P P PP P S PPP P Sbjct: 471 PPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPPPP 507 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/41 (39%), Positives = 16/41 (39%), Gaps = 4/41 (9%) Frame = +2 Query: 749 PPPPXXXXXRPXPXP----PXRPPLPXXNSXXSCXXPPPTP 859 PPPP P P P P PP P C PPP P Sbjct: 502 PPPPPPPVYSPPPPPVYSSPPPPPSPAPTPVY-CTRPPPPP 541 Score = 30.3 bits (65), Expect = 1.9 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +2 Query: 749 PPPPXXXXXRPXPXPPXRPPLPXXNSXXSCXXPPPTP 859 PPPP P PP PP P PPPTP Sbjct: 563 PPPPHSSPPPHSPPPPHSPPPPIY--PYLSPPPPPTP 597 Score = 29.9 bits (64), Expect = 2.5 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +2 Query: 752 PPPXXXXXRPXPXPPXRPPLPXXNSXXSCXXPPPTP 859 PPP P PP PP P S PPP P Sbjct: 438 PPPPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPPPP 473 Score = 29.9 bits (64), Expect = 2.5 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +2 Query: 749 PPPPXXXXXRPXPXPPXRPPLPXXNSXXSCXXPPP 853 PPPP P P P PLP PPP Sbjct: 723 PPPPVIHQSPPPPSPEYEGPLPPVIGVSYASPPPP 757 Score = 29.5 bits (63), Expect = 3.3 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +2 Query: 749 PPPPXXXXXRPXPXPPXRPPLPXXNSXXSCXXPPPTP 859 PPPP P PP PP P PPP P Sbjct: 439 PPPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPPPPPP 475 Score = 29.5 bits (63), Expect = 3.3 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +2 Query: 749 PPPPXXXXXRPXPXPPXRPPLPXXNSXXSCXXPPPTP 859 PPPP P PP P P S PPP P Sbjct: 468 PPPPPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPP 504 Score = 29.5 bits (63), Expect = 3.3 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +2 Query: 749 PPPPXXXXXRPXPXPPXRPPLPXXNSXXSCXXPPPTP 859 PPPP P PP PP P PPP P Sbjct: 470 PPPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPPP 506 Score = 29.5 bits (63), Expect = 3.3 Identities = 14/44 (31%), Positives = 14/44 (31%) Frame = +3 Query: 678 PXHXXPTLXPPRXHXPXTXPXXXSPXPXPPXXXAXXPXHPXAPP 809 P P PP P P SP P PP P PP Sbjct: 473 PPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPPPPPVYSPPPPP 516 Score = 28.7 bits (61), Expect = 5.7 Identities = 15/40 (37%), Positives = 15/40 (37%), Gaps = 3/40 (7%) Frame = +2 Query: 749 PPPPXXXXXRPXP---XPPXRPPLPXXNSXXSCXXPPPTP 859 PPPP P P PP PP P PPP P Sbjct: 466 PPPPPPPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPP 505 Score = 27.9 bits (59), Expect = 10.0 Identities = 12/35 (34%), Positives = 13/35 (37%) Frame = +3 Query: 705 PPRXHXPXTXPXXXSPXPXPPXXXAXXPXHPXAPP 809 PP P P P P PP + P P PP Sbjct: 441 PPPPPPPVYSPPPPPPPPPPPPVYSPPPPPPPPPP 475 >At3g22800.1 68416.m02874 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycsimilar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 470 Score = 37.1 bits (82), Expect = 0.016 Identities = 16/37 (43%), Positives = 17/37 (45%) Frame = +2 Query: 749 PPPPXXXXXRPXPXPPXRPPLPXXNSXXSCXXPPPTP 859 PPPP P P PP PP P S PPP+P Sbjct: 384 PPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSP 420 Score = 34.7 bits (76), Expect = 0.087 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +2 Query: 749 PPPPXXXXXRPXPXPPXRPPLPXXNSXXSCXXPPPTP 859 PPPP P P PP PP P PPP P Sbjct: 381 PPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPP 417 Score = 34.3 bits (75), Expect = 0.11 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +2 Query: 749 PPPPXXXXXRPXPXPPXRPPLPXXNSXXSCXXPPPTP 859 PPPP P P PP PP P PPP P Sbjct: 382 PPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPP 418 Score = 31.9 bits (69), Expect = 0.61 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +2 Query: 749 PPPPXXXXXRPXPXPPXRPPLPXXNSXXSCXXPPPTP 859 PPPP P P PP PP P P P P Sbjct: 379 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPP 415 Score = 31.9 bits (69), Expect = 0.61 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +2 Query: 749 PPPPXXXXXRPXPXPPXRPPLPXXNSXXSCXXPPPTP 859 PPPP P P PP PP P PP P Sbjct: 380 PPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPP 416 Score = 30.7 bits (66), Expect = 1.4 Identities = 13/35 (37%), Positives = 14/35 (40%) Frame = +2 Query: 749 PPPPXXXXXRPXPXPPXRPPLPXXNSXXSCXXPPP 853 PPPP P P PP PP + PPP Sbjct: 388 PPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPP 422 Score = 30.3 bits (65), Expect = 1.9 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +2 Query: 749 PPPPXXXXXRPXPXPPXRPPLPXXNSXXSCXXPPP 853 PPPP P P PP PP PPP Sbjct: 403 PPPPPYVYPSPPPPPPSPPPYVYPPPPPPYVYPPP 437 Score = 29.5 bits (63), Expect = 3.3 Identities = 14/47 (29%), Positives = 17/47 (36%) Frame = +3 Query: 675 TPXHXXPTLXPPRXHXPXTXPXXXSPXPXPPXXXAXXPXHPXAPPYL 815 +P P PP P P P P P + P P PPY+ Sbjct: 378 SPPPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYV 424 Score = 29.1 bits (62), Expect = 4.3 Identities = 13/37 (35%), Positives = 14/37 (37%) Frame = +2 Query: 749 PPPPXXXXXRPXPXPPXRPPLPXXNSXXSCXXPPPTP 859 PPPP P P PP P + PPP P Sbjct: 395 PPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPPP 431 >At4g15160.1 68417.m02327 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to SP|Q00451|PRF1_LYCES 36.4 kDa proline-rich protein Lycopersicon esculentum, proline-rich cell wall protein [Medicago sativa] GI:3818416; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 428 Score = 36.3 bits (80), Expect = 0.028 Identities = 16/37 (43%), Positives = 17/37 (45%) Frame = +2 Query: 749 PPPPXXXXXRPXPXPPXRPPLPXXNSXXSCXXPPPTP 859 PPPP +P P P PP P C PPPTP Sbjct: 138 PPPPTV---KPPPPPVVTPPPPTPTPEAPCPPPPPTP 171 Score = 29.1 bits (62), Expect = 4.3 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +2 Query: 749 PPPPXXXXXRPXPXPPXRPPLPXXNSXXSCXXPPPTP 859 PPPP P P P PP PPP P Sbjct: 113 PPPPPTVKPPPPPTPYTPPPPTPYTPPPPTVKPPPPP 149 Score = 28.3 bits (60), Expect = 7.5 Identities = 15/37 (40%), Positives = 17/37 (45%) Frame = +2 Query: 749 PPPPXXXXXRPXPXPPXRPPLPXXNSXXSCXXPPPTP 859 PPPP +P P P +PP P PPPTP Sbjct: 105 PPPPPYV--KPPPPPTVKPPPPPT----PYTPPPPTP 135 Score = 28.3 bits (60), Expect = 7.5 Identities = 14/38 (36%), Positives = 14/38 (36%), Gaps = 2/38 (5%) Frame = +2 Query: 752 PPPXXXXXRPXPXPPXRPPLPXXNSXXS--CXXPPPTP 859 PPP P P P PP P PPPTP Sbjct: 121 PPPPPTPYTPPPPTPYTPPPPTVKPPPPPVVTPPPPTP 158 >At5g07760.1 68418.m00888 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 853 Score = 34.3 bits (75), Expect = 0.11 Identities = 16/37 (43%), Positives = 18/37 (48%), Gaps = 1/37 (2%) Frame = +2 Query: 749 PPPPXXXXXRPXPXPPXRPP-LPXXNSXXSCXXPPPT 856 PPPP R P PP PP LP ++ C PPT Sbjct: 56 PPPPPAMRRRVLPRPPPPPPPLPMFDAEVLCCCYPPT 92 Score = 31.9 bits (69), Expect = 0.61 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +2 Query: 746 LPPPPXXXXXRPXPXPPXRPPLPXXNSXXSCXXPPPTP 859 LPPPP R P PP PP P PPP P Sbjct: 40 LPPPPPPPMRRRAPLPP--PPPPAMRRRVLPRPPPPPP 75 >At3g19430.1 68416.m02464 late embryogenesis abundant protein-related / LEA protein-related similar to late embryogenesis abundant protein [Picea glauca] GI:1350543 Length = 559 Score = 33.5 bits (73), Expect = 0.20 Identities = 14/37 (37%), Positives = 15/37 (40%) Frame = +2 Query: 749 PPPPXXXXXRPXPXPPXRPPLPXXNSXXSCXXPPPTP 859 PPPP P P PP PP P PP +P Sbjct: 99 PPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSP 135 Score = 33.5 bits (73), Expect = 0.20 Identities = 14/37 (37%), Positives = 15/37 (40%) Frame = +2 Query: 749 PPPPXXXXXRPXPXPPXRPPLPXXNSXXSCXXPPPTP 859 PPPP P P PP PP P PP +P Sbjct: 117 PPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSP 153 Score = 31.5 bits (68), Expect = 0.81 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 1/37 (2%) Frame = +2 Query: 749 PPPPXXXXXRPXPXPPXRPPLPXXNSXXSCXXPP-PT 856 PPPP P P PP PP P PP PT Sbjct: 135 PPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVPT 171 Score = 31.5 bits (68), Expect = 0.81 Identities = 15/37 (40%), Positives = 16/37 (43%) Frame = +2 Query: 749 PPPPXXXXXRPXPXPPXRPPLPXXNSXXSCXXPPPTP 859 PPPP P P PP P P + PPPTP Sbjct: 153 PPPPTPTPSVPSPTPPV-PTDPMPSPPPPVSPPPPTP 188 Score = 29.9 bits (64), Expect = 2.5 Identities = 14/37 (37%), Positives = 15/37 (40%) Frame = +2 Query: 749 PPPPXXXXXRPXPXPPXRPPLPXXNSXXSCXXPPPTP 859 PPPP P P PP PP P PP +P Sbjct: 83 PPPPTPSV--PSPTPPVSPPPPTPTPSVPSPTPPVSP 117 Score = 28.7 bits (61), Expect = 5.7 Identities = 16/46 (34%), Positives = 18/46 (39%), Gaps = 1/46 (2%) Frame = +3 Query: 675 TPXHXXPTLXPPRXHXPXTX-PXXXSPXPXPPXXXAXXPXHPXAPP 809 TP P+ PP P T P SP P P P P +PP Sbjct: 139 TPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVPTDPMPSPPPPVSPP 184 Score = 28.7 bits (61), Expect = 5.7 Identities = 15/41 (36%), Positives = 15/41 (36%), Gaps = 4/41 (9%) Frame = +2 Query: 749 PPPPXXXXXRPXPXPPXRP----PLPXXNSXXSCXXPPPTP 859 P PP P P PP P P P S PPTP Sbjct: 165 PTPPVPTDPMPSPPPPVSPPPPTPTPSVPSPPDVTPTPPTP 205 >At1g61080.1 68414.m06877 proline-rich family protein Length = 907 Score = 33.5 bits (73), Expect = 0.20 Identities = 17/44 (38%), Positives = 18/44 (40%), Gaps = 7/44 (15%) Frame = +2 Query: 749 PPPPXXXXXRPXPXPPXR-------PPLPXXNSXXSCXXPPPTP 859 PPPP P P PP PP+P NS PPP P Sbjct: 553 PPPPGTQAAPPPPPPPPMQNRAPSPPPMPMGNSGSGGPPPPPPP 596 Score = 31.5 bits (68), Expect = 0.81 Identities = 17/40 (42%), Positives = 18/40 (45%) Frame = +2 Query: 749 PPPPXXXXXRPXPXPPXRPPLPXXNSXXSCXXPPPTPXXN 868 PPPP + P PP PP P N S PPP P N Sbjct: 550 PPPPPPPGTQAAPPPP--PPPPMQNRAPS---PPPMPMGN 584 Score = 30.3 bits (65), Expect = 1.9 Identities = 14/39 (35%), Positives = 17/39 (43%), Gaps = 2/39 (5%) Frame = +2 Query: 749 PPPPXXXXXRPXPX--PPXRPPLPXXNSXXSCXXPPPTP 859 PPPP +P PP PP P + + PPP P Sbjct: 492 PPPPTPPAFKPLKGSAPPPPPPPPLPTTIAAPPPPPPPP 530 Score = 29.1 bits (62), Expect = 4.3 Identities = 15/47 (31%), Positives = 17/47 (36%) Frame = +2 Query: 719 PAXNLSXXXLPPPPXXXXXRPXPXPPXRPPLPXXNSXXSCXXPPPTP 859 P N PPPP PP PP P + + PPP P Sbjct: 581 PMGNSGSGGPPPPPPPMPLANGATPPPPPP-PMAMANGAAGPPPPPP 626 Score = 28.7 bits (61), Expect = 5.7 Identities = 15/41 (36%), Positives = 16/41 (39%), Gaps = 4/41 (9%) Frame = +2 Query: 749 PPPPXXXXXRPXPXPPXR----PPLPXXNSXXSCXXPPPTP 859 PP P P P PP R PP P + PPP P Sbjct: 514 PPLPTTIAAPPPPPPPPRAAVAPPPPPPPPGTAAAPPPPPP 554 Score = 28.3 bits (60), Expect = 7.5 Identities = 14/41 (34%), Positives = 16/41 (39%), Gaps = 4/41 (9%) Frame = +2 Query: 749 PPPPXXXXXR----PXPXPPXRPPLPXXNSXXSCXXPPPTP 859 PPPP + P P PP PP+ PPP P Sbjct: 422 PPPPPLSFIKTASLPLPSPPPTPPIADIAISMPPPPPPPPP 462 Score = 28.3 bits (60), Expect = 7.5 Identities = 13/37 (35%), Positives = 14/37 (37%) Frame = +2 Query: 749 PPPPXXXXXRPXPXPPXRPPLPXXNSXXSCXXPPPTP 859 PPPP + PP P P PPPTP Sbjct: 461 PPPPAVMPLKHFAPPPPPPLPPAVMPLKHFAPPPPTP 497 Score = 28.3 bits (60), Expect = 7.5 Identities = 14/40 (35%), Positives = 15/40 (37%) Frame = +2 Query: 749 PPPPXXXXXRPXPXPPXRPPLPXXNSXXSCXXPPPTPXXN 868 PP P P PP PP+P N PPP N Sbjct: 578 PPMPMGNSGSGGPPPPP-PPMPLANGATPPPPPPPMAMAN 616 Score = 27.9 bits (59), Expect = 10.0 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +2 Query: 749 PPPPXXXXXRPXPXPPXRPPLPXXNSXXSCXXPPPTP 859 P PP P PP PP P PPP P Sbjct: 442 PTPPIADIAISMPPPPPPPPPPPAVMPLKHFAPPPPP 478 >At5g58160.1 68418.m07280 formin homology 2 domain-containing protein / FH2 domain-containing protein low similarity to SP|Q05858 Formin (Limb deformity protein) {Gallus gallus}; contains Pfam profile PF02181: Formin Homology 2(FH2) Domain Length = 1307 Score = 32.7 bits (71), Expect = 0.35 Identities = 15/37 (40%), Positives = 16/37 (43%) Frame = +2 Query: 749 PPPPXXXXXRPXPXPPXRPPLPXXNSXXSCXXPPPTP 859 PPPP P P PP PP P N + PP P Sbjct: 727 PPPP------PPPPPPPAPPTPQSNGISAMKSSPPAP 757 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/37 (35%), Positives = 14/37 (37%) Frame = +2 Query: 749 PPPPXXXXXRPXPXPPXRPPLPXXNSXXSCXXPPPTP 859 P PP P PP PP P + PPP P Sbjct: 758 PAPPRLPTHSASPPPPTAPPPPPLGQTRAPSAPPPPP 794 Score = 29.9 bits (64), Expect = 2.5 Identities = 18/50 (36%), Positives = 21/50 (42%), Gaps = 4/50 (8%) Frame = +2 Query: 722 AXNLSXXXLPPPPXXXXXR----PXPXPPXRPPLPXXNSXXSCXXPPPTP 859 A NL PPP + P P PP PP P +S + PPP P Sbjct: 664 ASNLGQPARSPPPISNSDKKPALPRPPPPP-PPPPMQHSTVTKVPPPPPP 712 Score = 29.9 bits (64), Expect = 2.5 Identities = 14/39 (35%), Positives = 16/39 (41%), Gaps = 2/39 (5%) Frame = +2 Query: 749 PPPPXXXXX--RPXPXPPXRPPLPXXNSXXSCXXPPPTP 859 PPPP + P PP PP P + PPP P Sbjct: 694 PPPPMQHSTVTKVPPPPPPAPPAPPTPIVHTSSPPPPPP 732 Score = 28.7 bits (61), Expect = 5.7 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +2 Query: 749 PPPPXXXXXRPXPXPPXRPPLPXXNSXXSCXXPPPTP 859 PPPP R PP PP S PPTP Sbjct: 776 PPPPPLGQTRAPSAPPPPPPKLGTKLSPSGPNVPPTP 812 >At5g07780.1 68418.m00890 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 464 Score = 32.7 bits (71), Expect = 0.35 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = +2 Query: 749 PPPPXXXXXRPXPXPPXRPPLPXXNSXXSCXXPPPT 856 PPPP R P PP PPLP C PP T Sbjct: 44 PPPPPPLMRRRAPPPPPPPPLP-----RPCSRPPKT 74 Score = 31.1 bits (67), Expect = 1.1 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +2 Query: 734 SXXXLPPPPXXXXXRPXPXPPXRPPLPXXNSXXSCXXPPP 853 S LPPPP R P PP PP P PPP Sbjct: 11 SLVPLPPPPPPLMRRRAPLPPPPPP-PLMRRRAPPPPPPP 49 Score = 29.9 bits (64), Expect = 2.5 Identities = 15/38 (39%), Positives = 16/38 (42%) Frame = +2 Query: 746 LPPPPXXXXXRPXPXPPXRPPLPXXNSXXSCXXPPPTP 859 LPPPP R PP PPL + PPP P Sbjct: 29 LPPPPPPPLMRRRAPPPPPPPLMRRRAPPP-PPPPPLP 65 >At4g15200.1 68417.m02329 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 600 Score = 32.7 bits (71), Expect = 0.35 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +2 Query: 749 PPPPXXXXXRPXPXPPXRPPLPXXNSXXSCXXPPPTP 859 PPPP P P PP PP P PPP P Sbjct: 265 PPPPPAAAPPPQP-PPPPPPKPQPPPPPKIARPPPAP 300 >At1g02405.1 68414.m00187 proline-rich family protein contains proline-rich region, INTERPRO:IPR000694 Length = 134 Score = 32.7 bits (71), Expect = 0.35 Identities = 15/37 (40%), Positives = 16/37 (43%) Frame = +2 Query: 749 PPPPXXXXXRPXPXPPXRPPLPXXNSXXSCXXPPPTP 859 PP P P P PP PP P +S PPP P Sbjct: 52 PPSPPPPSCTPSPPPPSPPP-PKKSSCPPSPLPPPPP 87 Score = 29.9 bits (64), Expect = 2.5 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +2 Query: 749 PPPPXXXXXRPXPXPPXRPPLPXXNSXXSCXXPPPTPXXN 868 PPPP P P PP PP PPP P N Sbjct: 55 PPPPSCTPSPPPPSPP--PPKKSSCPPSPLPPPPPPPPPN 92 >At1g49750.1 68414.m05579 leucine-rich repeat family protein contains leucine-rich repeats, Pfam:PF00560 Length = 494 Score = 32.3 bits (70), Expect = 0.46 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +2 Query: 749 PPPPXXXXXRPXPXPPXRPPLPXXNSXXSCXXPPPTP 859 PPPP P P PP PP P PPP P Sbjct: 71 PPPPSPPPCPPPPSPPPSPPPPQLPPPPQL--PPPAP 105 Score = 30.3 bits (65), Expect = 1.9 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +2 Query: 749 PPPPXXXXXRPXPXPPXRPPLPXXNSXXSCXXPPPTP 859 PPPP P P PP PP P S PP P Sbjct: 63 PPPPPP----PCPPPPSPPPCPPPPSPPPSPPPPQLP 95 Score = 29.9 bits (64), Expect = 2.5 Identities = 14/37 (37%), Positives = 15/37 (40%) Frame = +2 Query: 749 PPPPXXXXXRPXPXPPXRPPLPXXNSXXSCXXPPPTP 859 P P P PP PP P S C PPP+P Sbjct: 50 PSPEPEPEPADCPPPPPPPPCPPPPSPPPC-PPPPSP 85 Score = 29.9 bits (64), Expect = 2.5 Identities = 13/35 (37%), Positives = 14/35 (40%) Frame = +2 Query: 749 PPPPXXXXXRPXPXPPXRPPLPXXNSXXSCXXPPP 853 PPPP P P P PP P + PPP Sbjct: 64 PPPPPPCPPPPSPPPCPPPPSPPPSPPPPQLPPPP 98 Score = 29.1 bits (62), Expect = 4.3 Identities = 13/36 (36%), Positives = 14/36 (38%) Frame = +2 Query: 752 PPPXXXXXRPXPXPPXRPPLPXXNSXXSCXXPPPTP 859 P P P P PP PP P PPP+P Sbjct: 54 PEPEPADCPPPPPPPPCPPPPSPPPCPPPPSPPPSP 89 Score = 28.7 bits (61), Expect = 5.7 Identities = 14/44 (31%), Positives = 14/44 (31%) Frame = +3 Query: 678 PXHXXPTLXPPRXHXPXTXPXXXSPXPXPPXXXAXXPXHPXAPP 809 P P PP P P P P PP P APP Sbjct: 63 PPPPPPPCPPPPSPPPCPPPPSPPPSPPPPQLPPPPQLPPPAPP 106 >At2g15880.1 68415.m01820 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 727 Score = 31.9 bits (69), Expect = 0.61 Identities = 13/35 (37%), Positives = 14/35 (40%) Frame = +3 Query: 705 PPRXHXPXTXPXXXSPXPXPPXXXAXXPXHPXAPP 809 PP + P P SP P PP P H PP Sbjct: 521 PPPVYSPPPPPPVYSPPPPPPVHSPPPPVHSPPPP 555 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/35 (37%), Positives = 14/35 (40%) Frame = +2 Query: 749 PPPPXXXXXRPXPXPPXRPPLPXXNSXXSCXXPPP 853 PPPP P P P PP P + PPP Sbjct: 527 PPPPPPVYSPPPPPPVHSPPPPVHSPPPPVHSPPP 561 Score = 30.3 bits (65), Expect = 1.9 Identities = 15/45 (33%), Positives = 18/45 (40%) Frame = +3 Query: 675 TPXHXXPTLXPPRXHXPXTXPXXXSPXPXPPXXXAXXPXHPXAPP 809 +P H P PP + P P SP P PP P +PP Sbjct: 505 SPIHSPP---PPPVYSPPPPPPVYSPPPPPPVYSPPPPPPVHSPP 546 Score = 29.9 bits (64), Expect = 2.5 Identities = 13/36 (36%), Positives = 14/36 (38%) Frame = +2 Query: 752 PPPXXXXXRPXPXPPXRPPLPXXNSXXSCXXPPPTP 859 PPP P P PP P P +S PP P Sbjct: 527 PPPPPPVYSPPPPPPVHSPPPPVHSPPPPVHSPPPP 562 Score = 27.9 bits (59), Expect = 10.0 Identities = 15/40 (37%), Positives = 16/40 (40%), Gaps = 3/40 (7%) Frame = +2 Query: 749 PPPPXXXXXRPX--PXPPXR-PPLPXXNSXXSCXXPPPTP 859 PPPP P P PP PP P + PPP P Sbjct: 552 PPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVYSPPPPP 591 Score = 27.9 bits (59), Expect = 10.0 Identities = 15/40 (37%), Positives = 16/40 (40%), Gaps = 3/40 (7%) Frame = +2 Query: 749 PPPPXXXXXRPX--PXPPXR-PPLPXXNSXXSCXXPPPTP 859 PPPP P P PP PP P + PPP P Sbjct: 618 PPPPVHSPPPPVFSPPPPVHSPPPPVYSPPPPVYSPPPPP 657 >At5g54650.2 68418.m06805 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 900 Score = 31.5 bits (68), Expect = 0.81 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +2 Query: 749 PPPPXXXXXRPXPXPPXRPPLPXXNSXXSCXXPPPTP 859 PPPP P P RPP P PPP P Sbjct: 370 PPPPVPAPQMPSSAGPPRPPPPAPPPGSGGPKPPPPP 406 >At5g54650.1 68418.m06804 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 900 Score = 31.5 bits (68), Expect = 0.81 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +2 Query: 749 PPPPXXXXXRPXPXPPXRPPLPXXNSXXSCXXPPPTP 859 PPPP P P RPP P PPP P Sbjct: 370 PPPPVPAPQMPSSAGPPRPPPPAPPPGSGGPKPPPPP 406 >At3g24480.1 68416.m03070 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 494 Score = 31.5 bits (68), Expect = 0.81 Identities = 15/45 (33%), Positives = 17/45 (37%) Frame = +2 Query: 719 PAXNLSXXXLPPPPXXXXXRPXPXPPXRPPLPXXNSXXSCXXPPP 853 P+ L PPP P P PP P P + S PPP Sbjct: 416 PSPPLPPPVYSPPPSPPVFSPPPSPPVYSPPPPPSIHYSSPPPPP 460 Score = 30.3 bits (65), Expect = 1.9 Identities = 14/45 (31%), Positives = 16/45 (35%) Frame = +2 Query: 719 PAXNLSXXXLPPPPXXXXXRPXPXPPXRPPLPXXNSXXSCXXPPP 853 P ++ PPPP P P P PLP PPP Sbjct: 447 PPPSIHYSSPPPPPVHHSSPPPPSPEFEGPLPPVIGVSYASPPPP 491 Score = 29.5 bits (63), Expect = 3.3 Identities = 15/40 (37%), Positives = 16/40 (40%), Gaps = 2/40 (5%) Frame = +2 Query: 746 LPPPPXXXXXRPXPX--PPXRPPLPXXNSXXSCXXPPPTP 859 LPPPP P P PP PP+ PPP P Sbjct: 410 LPPPPPPSPPLPPPVYSPPPSPPVFSPPPSPPVYSPPPPP 449 >At1g59910.1 68414.m06749 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02128 Length = 929 Score = 31.5 bits (68), Expect = 0.81 Identities = 15/41 (36%), Positives = 16/41 (39%), Gaps = 4/41 (9%) Frame = +2 Query: 749 PPPPXXXXXRPXPXPPXR----PPLPXXNSXXSCXXPPPTP 859 PPPP P P PP + PP P PPP P Sbjct: 386 PPPPPSAAAPPPPPPPKKGPAAPPPPPPPGKKGAGPPPPPP 426 Score = 28.7 bits (61), Expect = 5.7 Identities = 14/40 (35%), Positives = 15/40 (37%), Gaps = 3/40 (7%) Frame = +2 Query: 749 PPPPXXXXXRPXPXPPXR---PPLPXXNSXXSCXXPPPTP 859 PP P P P PP PP P + PPP P Sbjct: 375 PPGPANQTSPPPPPPPSAAAPPPPPPPKKGPAAPPPPPPP 414 >At4g33970.1 68417.m04820 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 699 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/35 (37%), Positives = 14/35 (40%) Frame = +2 Query: 749 PPPPXXXXXRPXPXPPXRPPLPXXNSXXSCXXPPP 853 PPPP P P P PP P + PPP Sbjct: 550 PPPPPVYSPPPPPPPVHSPPPPVFSPPPPVYSPPP 584 Score = 29.9 bits (64), Expect = 2.5 Identities = 14/37 (37%), Positives = 15/37 (40%) Frame = +2 Query: 749 PPPPXXXXXRPXPXPPXRPPLPXXNSXXSCXXPPPTP 859 PPPP P PP PP P + PPP P Sbjct: 582 PPPPVHSPPPPVHSPP--PPAPVHSPPPPVHSPPPPP 616 Score = 28.7 bits (61), Expect = 5.7 Identities = 12/35 (34%), Positives = 12/35 (34%) Frame = +3 Query: 705 PPRXHXPXTXPXXXSPXPXPPXXXAXXPXHPXAPP 809 PP H P P P P PP P PP Sbjct: 544 PPPVHSPPPPPVYSPPPPPPPVHSPPPPVFSPPPP 578 Score = 27.9 bits (59), Expect = 10.0 Identities = 12/36 (33%), Positives = 14/36 (38%) Frame = +2 Query: 749 PPPPXXXXXRPXPXPPXRPPLPXXNSXXSCXXPPPT 856 PPPP P P PP P + PPP+ Sbjct: 596 PPPPAPVHSPPPPVHSPPPPPPVYSPPPPVFSPPPS 631 >At1g23040.1 68414.m02878 hydroxyproline-rich glycoprotein family protein contains proline-rich domains, INTERPRO:IPR000694 Length = 144 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +2 Query: 752 PPPXXXXXRPXPXPPXRPPLPXXNSXXSCXXPPP 853 PPP P PP PP P C PPP Sbjct: 64 PPPPSPPPPACPPPPALPPPPPKKVSSYCPPPPP 97 >At4g18670.1 68417.m02762 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 839 Score = 30.7 bits (66), Expect = 1.4 Identities = 13/35 (37%), Positives = 14/35 (40%) Frame = +2 Query: 749 PPPPXXXXXRPXPXPPXRPPLPXXNSXXSCXXPPP 853 PPPP +P P P PLP PPP Sbjct: 802 PPPPVIHHSQPPPPPIYEGPLPPIPGISYASPPPP 836 Score = 29.5 bits (63), Expect = 3.3 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +2 Query: 749 PPPPXXXXXRPXPXPPXRPPLPXXNSXXSCXXPPPTP 859 PPP P P PP LP PPP P Sbjct: 703 PPPAPYYYSSPQPPPPPHYSLPPPTPTYHYISPPPPP 739 >At1g79730.1 68414.m09300 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 589 Score = 30.7 bits (66), Expect = 1.4 Identities = 16/42 (38%), Positives = 17/42 (40%), Gaps = 4/42 (9%) Frame = +2 Query: 746 LPPPPXXXXXRPXPXPPXRPP----LPXXNSXXSCXXPPPTP 859 LP PP P P PP PP P + S PPP P Sbjct: 11 LPQPPSQNSLAPPPPPPSLPPPVPPPPPSHQPYSYPPPPPPP 52 >At1g60200.1 68414.m06781 splicing factor PWI domain-containing protein / RNA recognition motif (RRM)-containing protein contains Pfam profiles PF01480: PWI domain, PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 899 Score = 30.7 bits (66), Expect = 1.4 Identities = 17/52 (32%), Positives = 19/52 (36%), Gaps = 5/52 (9%) Frame = +2 Query: 719 PAXNLSXXXLPPPPXXXXXRPX-----PXPPXRPPLPXXNSXXSCXXPPPTP 859 P N + PPPP P P PP PP +S PPP P Sbjct: 27 PNPNPNPSLTPPPPQQHSQPPVAPLVPPGPPYAPPAQIPSSLLPTNLPPPPP 78 >At2g25050.1 68415.m02996 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02128 Length = 1111 Score = 30.3 bits (65), Expect = 1.9 Identities = 13/37 (35%), Positives = 14/37 (37%) Frame = +2 Query: 749 PPPPXXXXXRPXPXPPXRPPLPXXNSXXSCXXPPPTP 859 PPPP P PPLP + PPP P Sbjct: 606 PPPPLQSHRSALSSSPLPPPLPPKKLLATTNPPPPPP 642 >At1g24150.1 68414.m03047 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 725 Score = 30.3 bits (65), Expect = 1.9 Identities = 13/35 (37%), Positives = 15/35 (42%) Frame = +2 Query: 749 PPPPXXXXXRPXPXPPXRPPLPXXNSXXSCXXPPP 853 PPPP + PP PP N+ S PPP Sbjct: 245 PPPPPPIPVKQSATPPPPPPPKLKNNGPSPPPPPP 279 Score = 30.3 bits (65), Expect = 1.9 Identities = 15/39 (38%), Positives = 16/39 (41%), Gaps = 2/39 (5%) Frame = +2 Query: 749 PPPPXXXXXRPXPXPPXRPPLPXXN--SXXSCXXPPPTP 859 PPPP P PP PPL S + PPP P Sbjct: 260 PPPPPPKLKNNGPSPPPPPPLKKTAALSSSASKKPPPAP 298 Score = 28.7 bits (61), Expect = 5.7 Identities = 11/28 (39%), Positives = 13/28 (46%) Frame = +2 Query: 776 RPXPXPPXRPPLPXXNSXXSCXXPPPTP 859 +P P PP PP P + PPP P Sbjct: 238 KPDPTPPPPPPPPIPVKQSATPPPPPPP 265 >At1g20130.1 68414.m02518 family II extracellular lipase, putative contains Pfam profile PF00657: GDSL-like Lipase/Acylhydrolase; similar to EXL3 (PMID:11431566) Length = 1006 Score = 30.3 bits (65), Expect = 1.9 Identities = 12/37 (32%), Positives = 14/37 (37%) Frame = +2 Query: 749 PPPPXXXXXRPXPXPPXRPPLPXXNSXXSCXXPPPTP 859 PP P +P P P +P P C PP P Sbjct: 69 PPTPPKPQPKPAPPPEPKPAPPPAPKPVPCPSPPKPP 105 Score = 29.1 bits (62), Expect = 4.3 Identities = 13/37 (35%), Positives = 14/37 (37%) Frame = +2 Query: 749 PPPPXXXXXRPXPXPPXRPPLPXXNSXXSCXXPPPTP 859 P P P P P +P P S C PPP P Sbjct: 22 PVAPPGPSPCPSPPPKPQPKPPPAPSPSPCPSPPPKP 58 Score = 27.9 bits (59), Expect = 10.0 Identities = 13/37 (35%), Positives = 14/37 (37%) Frame = +2 Query: 749 PPPPXXXXXRPXPXPPXRPPLPXXNSXXSCXXPPPTP 859 P PP +P P PP PP P P P P Sbjct: 52 PSPPPKPQPKPVP-PPACPPTPPKPQPKPAPPPEPKP 87 Score = 27.9 bits (59), Expect = 10.0 Identities = 12/37 (32%), Positives = 13/37 (35%) Frame = +2 Query: 749 PPPPXXXXXRPXPXPPXRPPLPXXNSXXSCXXPPPTP 859 P PP P P PP PP + P P P Sbjct: 99 PSPPKPPAPTPKPVPPHGPPPKPAPAPTPAPSPKPAP 135 >At5g48920.1 68418.m06052 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 205 Score = 29.9 bits (64), Expect = 2.5 Identities = 15/39 (38%), Positives = 18/39 (46%), Gaps = 1/39 (2%) Frame = +2 Query: 746 LPPPPXXXXXRPXP-XPPXRPPLPXXNSXXSCXXPPPTP 859 +PPPP P P PP PP P + PPP+P Sbjct: 24 VPPPPSHISPPPPPFSPPHHPPPPHFSPPHQ---PPPSP 59 Score = 28.3 bits (60), Expect = 7.5 Identities = 18/65 (27%), Positives = 19/65 (29%) Frame = +3 Query: 615 PXXPTXXSXXXXXXXXXXXGTPXHXXPTLXPPRXHXPXTXPXXXSPXPXPPXXXAXXPXH 794 P P+ S P H P PP P P SP P P P H Sbjct: 25 PPPPSHISPPPPPFSPPHHPPPPHFSPPHQPPPSPYPHPHPPPPSPYPHP--HQPPPPPH 82 Query: 795 PXAPP 809 PP Sbjct: 83 VLPPP 87 >At4g27850.1 68417.m03999 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 577 Score = 29.9 bits (64), Expect = 2.5 Identities = 15/38 (39%), Positives = 17/38 (44%) Frame = +2 Query: 746 LPPPPXXXXXRPXPXPPXRPPLPXXNSXXSCXXPPPTP 859 LPPPP P P P P P +S PPP+P Sbjct: 174 LPPPPSPS---PTPGPDSPLPSPGPDSPLPLPGPPPSP 208 >At3g03776.1 68416.m00385 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965; Length = 177 Score = 29.9 bits (64), Expect = 2.5 Identities = 13/37 (35%), Positives = 14/37 (37%) Frame = +2 Query: 749 PPPPXXXXXRPXPXPPXRPPLPXXNSXXSCXXPPPTP 859 PPPP + P PP PP PPTP Sbjct: 124 PPPPPPYPRQVHPQPPAPPPYKFHQKEPVAKSFPPTP 160 >At1g53260.1 68414.m06035 hypothetical protein low similarity to SP|Q38732 DAG protein, chloroplast precursor {Antirrhinum majus} Length = 358 Score = 29.9 bits (64), Expect = 2.5 Identities = 16/50 (32%), Positives = 18/50 (36%) Frame = +2 Query: 719 PAXNLSXXXLPPPPXXXXXRPXPXPPXRPPLPXXNSXXSCXXPPPTPXXN 868 P N PPPP P P +PP N + PPP P N Sbjct: 193 PPPNQGMGGAPPPPPHIGNNPNMPPHIQPP----NMNQNYRGPPPPPNMN 238 >At1g49490.1 68414.m05547 leucine-rich repeat family protein / extensin family protein contains similarity to disease resistance protein GI:3894383 from [Lycopersicon esculentum]; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 847 Score = 29.9 bits (64), Expect = 2.5 Identities = 14/37 (37%), Positives = 15/37 (40%), Gaps = 2/37 (5%) Frame = +2 Query: 749 PPPPXXXXXRPXPXPPXR--PPLPXXNSXXSCXXPPP 853 PPPP P P PP PP P + PPP Sbjct: 575 PPPPVASPPPPSPPPPVHSPPPPPVFSPPPPVFSPPP 611 Score = 29.1 bits (62), Expect = 4.3 Identities = 13/35 (37%), Positives = 16/35 (45%) Frame = +2 Query: 749 PPPPXXXXXRPXPXPPXRPPLPXXNSXXSCXXPPP 853 PPPP R PP +PP+P + PPP Sbjct: 523 PPPPKVEDTR---VPPPQPPMPSPSPPSPIYSPPP 554 Score = 27.9 bits (59), Expect = 10.0 Identities = 14/39 (35%), Positives = 15/39 (38%) Frame = +2 Query: 752 PPPXXXXXRPXPXPPXRPPLPXXNSXXSCXXPPPTPXXN 868 PPP P P P PP P + PPPT N Sbjct: 609 PPPPSPVYSPPP-PSHSPPPPVYSPPPPTFSPPPTHNTN 646 >At4g39260.1 68417.m05557 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 169 Score = 29.5 bits (63), Expect = 3.3 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = -1 Query: 852 GGGXXHEXXELXXGKGGRXGGXGXGRXXXXXGGG 751 GGG +E G GG GG G G GGG Sbjct: 120 GGGGGYERRSGGYGSGGGGGGRGYGGGGRREGGG 153 >At4g22470.1 68417.m03245 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to hydroxyproline-rich glycoprotein DZ-HRGP from Volvox carteri f. nagariensis GP|6523547; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 375 Score = 29.5 bits (63), Expect = 3.3 Identities = 18/51 (35%), Positives = 21/51 (41%), Gaps = 5/51 (9%) Frame = +2 Query: 722 AXNLSXXXLPPPPXXXXXRPXPXPP---XRPPLP--XXNSXXSCXXPPPTP 859 A N S PPPP P P PP +PP P + + PPP P Sbjct: 23 ADNHSVYCPPPPPCICICNPGPPPPQPDPQPPTPPTFQPAPPANDQPPPPP 73 >At3g53330.1 68416.m05884 plastocyanin-like domain-containing protein similar to mavicyanin SP:P80728 from [Cucurbita pepo] Length = 310 Score = 29.5 bits (63), Expect = 3.3 Identities = 13/37 (35%), Positives = 14/37 (37%) Frame = +2 Query: 749 PPPPXXXXXRPXPXPPXRPPLPXXNSXXSCXXPPPTP 859 PPPP R P P PP + PPP P Sbjct: 123 PPPPSKTHERSRPITPSPPPPSKTHEPSRPNTPPPPP 159 >At3g19020.1 68416.m02415 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 956 Score = 29.5 bits (63), Expect = 3.3 Identities = 14/37 (37%), Positives = 15/37 (40%) Frame = +2 Query: 749 PPPPXXXXXRPXPXPPXRPPLPXXNSXXSCXXPPPTP 859 PPPP P PP PP P + PPP P Sbjct: 788 PPPPVHSPPPPVHSPP--PPSPIYSPPPPVFSPPPKP 822 Score = 28.3 bits (60), Expect = 7.5 Identities = 13/36 (36%), Positives = 14/36 (38%) Frame = +2 Query: 752 PPPXXXXXRPXPXPPXRPPLPXXNSXXSCXXPPPTP 859 PPP P P P PP P +S PP P Sbjct: 734 PPPPPVFSPPPPAPIYSPPPPPVHSPPPPVHSPPPP 769 Score = 27.9 bits (59), Expect = 10.0 Identities = 15/40 (37%), Positives = 16/40 (40%), Gaps = 3/40 (7%) Frame = +2 Query: 749 PPPPXXXXXRPX--PXPPXR-PPLPXXNSXXSCXXPPPTP 859 PPPP P P PP PP P + PPP P Sbjct: 649 PPPPVHSPPPPVFSPPPPMHSPPPPVYSPPPPVHSPPPPP 688 Score = 27.9 bits (59), Expect = 10.0 Identities = 15/40 (37%), Positives = 16/40 (40%), Gaps = 3/40 (7%) Frame = +2 Query: 749 PPPPXXXXXRPX--PXPPXR-PPLPXXNSXXSCXXPPPTP 859 PPPP P P PP PP P + PPP P Sbjct: 699 PPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVQSPPPPP 738 >At5g19800.1 68418.m02353 hydroxyproline-rich glycoprotein family protein similar to extensin [Catharanthus roseus] gi|1486263|dbj|BAA13175; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 96 Score = 29.1 bits (62), Expect = 4.3 Identities = 13/37 (35%), Positives = 15/37 (40%) Frame = +2 Query: 749 PPPPXXXXXRPXPXPPXRPPLPXXNSXXSCXXPPPTP 859 PPPP P PP PP P ++ PP P Sbjct: 37 PPPPPVYSPPISPPPPPPPPPPQSHAAAYKRYSPPPP 73 Score = 29.1 bits (62), Expect = 4.3 Identities = 13/37 (35%), Positives = 14/37 (37%) Frame = +2 Query: 749 PPPPXXXXXRPXPXPPXRPPLPXXNSXXSCXXPPPTP 859 PPPP P PP PP + PPP P Sbjct: 38 PPPPVYSPPISPPPPPPPPPPQSHAAAYKRYSPPPPP 74 >At4g30460.1 68417.m04325 glycine-rich protein Length = 162 Score = 29.1 bits (62), Expect = 4.3 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -1 Query: 858 GVGGGXXHEXXELXXGKGGRXGGXGXGRXXXXXGGGG 748 G GGG H G GGR GG G G GGG Sbjct: 118 GSGGGGGHGGG--GGGGGGRGGGGGSGNGEGYGEGGG 152 >At4g28300.2 68417.m04053 hydroxyproline-rich glycoprotein family protein Length = 438 Score = 29.1 bits (62), Expect = 4.3 Identities = 14/40 (35%), Positives = 16/40 (40%), Gaps = 2/40 (5%) Frame = +2 Query: 746 LPPPPXXXXXRPXPXPPXRPP--LPXXNSXXSCXXPPPTP 859 +PPPP P P P PP L + PPP P Sbjct: 182 MPPPPTQLQNTPAPVPVSTPPSQLQAPPAQSQFMPPPPAP 221 >At4g28300.1 68417.m04052 hydroxyproline-rich glycoprotein family protein Length = 496 Score = 29.1 bits (62), Expect = 4.3 Identities = 14/40 (35%), Positives = 16/40 (40%), Gaps = 2/40 (5%) Frame = +2 Query: 746 LPPPPXXXXXRPXPXPPXRPP--LPXXNSXXSCXXPPPTP 859 +PPPP P P P PP L + PPP P Sbjct: 240 MPPPPTQLQNTPAPVPVSTPPSQLQAPPAQSQFMPPPPAP 279 >At3g20850.1 68416.m02636 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 134 Score = 29.1 bits (62), Expect = 4.3 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +2 Query: 734 SXXXLPPPPXXXXXRPXPXPPXRPPLPXXNSXXSCXXPPPTP 859 S LPPPP P P PP P PPPTP Sbjct: 50 SPADLPPPPTPVYS---PPPADLPPPPTPYYSPPADLPPPTP 88 >At3g19320.1 68416.m02450 leucine-rich repeat family protein contains leucine-rich repeats, Pfam:PF00560; Length = 493 Score = 29.1 bits (62), Expect = 4.3 Identities = 14/38 (36%), Positives = 16/38 (42%), Gaps = 1/38 (2%) Frame = +2 Query: 749 PPPPXXXXXRPXPXP-PXRPPLPXXNSXXSCXXPPPTP 859 PPPP P P P P P P + + PPP P Sbjct: 71 PPPPPQSLPPPSPSPEPEHYPPPPYHHYITPSPPPPRP 108 >At3g06140.1 68416.m00705 zinc finger (C3HC4-type RING finger) family protein contains Pfam profile: PF00097 Zinc finger, C3HC4 type (RING finger) Length = 359 Score = 29.1 bits (62), Expect = 4.3 Identities = 16/42 (38%), Positives = 16/42 (38%), Gaps = 2/42 (4%) Frame = +2 Query: 749 PPPPXXXXXRPXPXPPXRPPLPXXNSXXSCXXP--PPTPXXN 868 PPPP P P PP PP N P PP P N Sbjct: 24 PPPPPYYYLDPPPPPPPFPPHYDYNYSNYHLSPPLPPQPQIN 65 >At1g49270.1 68414.m05524 protein kinase family protein contains Pfam domain PF00069: Protein kinase domain Length = 699 Score = 29.1 bits (62), Expect = 4.3 Identities = 15/40 (37%), Positives = 16/40 (40%), Gaps = 3/40 (7%) Frame = +2 Query: 749 PPPPXXXXXRPXPXPPXR---PPLPXXNSXXSCXXPPPTP 859 PPPP P P PPLP +S S PP P Sbjct: 44 PPPPSSPDIAPPPQQQQESPPPPLPENSSDGSSSSSPPPP 83 >At1g10620.1 68414.m01204 protein kinase family protein contains serine/threonine protein kinases active-site signature, PROSITE:PS00108 Length = 718 Score = 29.1 bits (62), Expect = 4.3 Identities = 16/47 (34%), Positives = 17/47 (36%) Frame = +2 Query: 719 PAXNLSXXXLPPPPXXXXXRPXPXPPXRPPLPXXNSXXSCXXPPPTP 859 P L L PPP P P P L N+ S PP TP Sbjct: 118 PKPQLPPPSLFPPPSLVNQLPDPRPNDNNILEPINNPISLPSPPSTP 164 >At5g56330.1 68418.m07031 carbonic anhydrase family protein contains proline-rich extensin domains, INTERPRO:IPR002965; contains Pfam profile PF00194: Eukaryotic-type carbonic anhydrase Length = 350 Score = 28.7 bits (61), Expect = 5.7 Identities = 12/36 (33%), Positives = 14/36 (38%) Frame = +2 Query: 752 PPPXXXXXRPXPXPPXRPPLPXXNSXXSCXXPPPTP 859 P P +P P P PP P + P PTP Sbjct: 66 PAPAPTPPKPKPAPAPTPPKPKPKPAPTPPNPKPTP 101 Score = 27.9 bits (59), Expect = 10.0 Identities = 12/36 (33%), Positives = 13/36 (36%) Frame = +2 Query: 752 PPPXXXXXRPXPXPPXRPPLPXXNSXXSCXXPPPTP 859 P P +P P PP P P P PTP Sbjct: 48 PTPPKPKPKPAPTPPKPKPAPAPTPPKPKPAPAPTP 83 >At5g26080.1 68418.m03103 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 141 Score = 28.7 bits (61), Expect = 5.7 Identities = 15/39 (38%), Positives = 15/39 (38%), Gaps = 2/39 (5%) Frame = +2 Query: 749 PPPPXXXXXRPXPX--PPXRPPLPXXNSXXSCXXPPPTP 859 PPPP P P PP P P PPPTP Sbjct: 67 PPPPPIYSPPPPPIYPPPIYSPPPPPIYPPPIYSPPPTP 105 >At3g22120.1 68416.m02792 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to SP|Q00451|PRF1_LYCES 36.4 kDa proline-rich protein Lycopersicon esculentum, proline-rich cell wall protein [Medicago sativa] GI:3818416; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 334 Score = 28.7 bits (61), Expect = 5.7 Identities = 14/39 (35%), Positives = 15/39 (38%), Gaps = 2/39 (5%) Frame = +2 Query: 749 PP--PPXXXXXRPXPXPPXRPPLPXXNSXXSCXXPPPTP 859 PP PP P PP P P + PPPTP Sbjct: 130 PPTKPPPSTPKPPTTKPPPSTPKPPHHKPPPTPCPPPTP 168 >At2g29210.1 68415.m03550 splicing factor PWI domain-containing protein contains Pfam profile PF01480: PWI domain Length = 878 Score = 28.7 bits (61), Expect = 5.7 Identities = 23/67 (34%), Positives = 33/67 (49%) Frame = +1 Query: 133 RKRNITVPHDRLAPRNVRSGVSPRLQNRSQPDPAFETR*HS*VRVHRADTGRSSNELDRQ 312 RKR ++ R R+VR +SPR + P F +R S +R HR R ++E RQ Sbjct: 250 RKRRLSNSRRRSRSRSVRRSLSPRRRRIHSP---FRSRSRSPIRRHR----RPTHEGRRQ 302 Query: 313 TTELERR 333 + RR Sbjct: 303 SPAPSRR 309 >At1g68725.1 68414.m07853 arabinogalactan-protein, putative (AGP19) non-consensus splice site at the intron:exon boundary (AT:exon) Length = 247 Score = 28.7 bits (61), Expect = 5.7 Identities = 16/46 (34%), Positives = 19/46 (41%), Gaps = 1/46 (2%) Frame = +3 Query: 675 TPXHXXPTLXPPRXHXPXTXPXXXSPXP-XPPXXXAXXPXHPXAPP 809 +P PT+ PP P P P P PP A P P +PP Sbjct: 103 SPPASAPTVSPPPVSPPPA-PTSPPPTPASPPPAPASPPPAPASPP 147 >At1g27710.1 68414.m03387 glycine-rich protein Length = 212 Score = 28.7 bits (61), Expect = 5.7 Identities = 15/44 (34%), Positives = 17/44 (38%) Frame = -3 Query: 808 GGAXGWXGXXAXXXGGXGXGEXXXGXVXGXXLRGGXXVGXXWXG 677 GG GW G GG G G G G + GG +G G Sbjct: 143 GGGLGWDG--GNGGGGPGYGSGGGGIGGGGGIGGGVIIGGGGGG 184 >At5g38560.1 68418.m04662 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 681 Score = 28.3 bits (60), Expect = 7.5 Identities = 14/39 (35%), Positives = 16/39 (41%), Gaps = 2/39 (5%) Frame = +2 Query: 749 PP--PPXXXXXRPXPXPPXRPPLPXXNSXXSCXXPPPTP 859 PP PP P P PP P +S PPP+P Sbjct: 36 PPVTPPPSPPQSPPPVVSSSPPPPVVSSPPPSSSPPPSP 74 Score = 27.9 bits (59), Expect = 10.0 Identities = 12/35 (34%), Positives = 13/35 (37%) Frame = +2 Query: 749 PPPPXXXXXRPXPXPPXRPPLPXXNSXXSCXXPPP 853 PPPP P PP PP+ PPP Sbjct: 56 PPPPVVSSPPPSSSPPPSPPVITSPPPTVASSPPP 90 >At5g19810.1 68418.m02354 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 249 Score = 28.3 bits (60), Expect = 7.5 Identities = 14/36 (38%), Positives = 16/36 (44%) Frame = +2 Query: 749 PPPPXXXXXRPXPXPPXRPPLPXXNSXXSCXXPPPT 856 PPPP R P PP PP + S PPP+ Sbjct: 194 PPPPPYKYGRVYPPPPP-PPQAARSYKRSPPPPPPS 228 >At5g08230.1 68418.m00965 PWWP domain-containing protein putative transcription factor (HUA2) - Arabidopsis thaliana, EMBL:AF116556 Length = 1445 Score = 28.3 bits (60), Expect = 7.5 Identities = 13/36 (36%), Positives = 15/36 (41%) Frame = +2 Query: 749 PPPPXXXXXRPXPXPPXRPPLPXXNSXXSCXXPPPT 856 PP P P P PP PP P + PPP+ Sbjct: 1126 PPLPHESPPSPPPQPPSSPP-PPSSPPQLAPAPPPS 1160 >At4g19920.1 68417.m02918 disease resistance protein (TIR class), putative domain signature TIR exists, suggestive of a disease resistance protein. Length = 274 Score = 28.3 bits (60), Expect = 7.5 Identities = 16/43 (37%), Positives = 16/43 (37%), Gaps = 6/43 (13%) Frame = +2 Query: 749 PPPPXXXXXRPXPXPP------XRPPLPXXNSXXSCXXPPPTP 859 PPPP RP P P RPPLP PP P Sbjct: 6 PPPPPIPESRPRPLTPPVLLTRPRPPLPYARPLQPPQSLPPRP 48 >At3g55220.1 68416.m06133 splicing factor, putative contains CPSF A subunit region (PF03178); contains weak WD-40 repeat (PF00400); similar to Splicing factor 3B subunit 3 (SF3b130)/spliceosomal protein/Splicing factor 3B subunit 3 (SAP 130)(KIAA0017)(SP:Q15393) Homo sapiens, EMBL:HSAJ1443_1 Length = 1214 Score = 28.3 bits (60), Expect = 7.5 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = -2 Query: 443 GRGERSPRRWLQPRLAVPRQASTSVPRTPA 354 GRG RS R L+P LA+ A + +P P+ Sbjct: 426 GRGPRSSLRILRPGLAITEMAVSQLPGQPS 455 >At3g55200.1 68416.m06131 splicing factor, putative contains CPSF A subunit region (PF03178); contains weak WD-40 repeat (PF00400); similar to Splicing factor 3B subunit 3 (SF3b130)/spliceosomal protein/Splicing factor 3B subunit 3 (SAP 130)(KIAA0017)(SP:Q15393) Homo sapiens, EMBL:HSAJ1443_1 Length = 1214 Score = 28.3 bits (60), Expect = 7.5 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = -2 Query: 443 GRGERSPRRWLQPRLAVPRQASTSVPRTPA 354 GRG RS R L+P LA+ A + +P P+ Sbjct: 426 GRGPRSSLRILRPGLAITEMAVSQLPGQPS 455 >At3g50580.1 68416.m05532 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 265 Score = 28.3 bits (60), Expect = 7.5 Identities = 14/38 (36%), Positives = 16/38 (42%) Frame = +2 Query: 746 LPPPPXXXXXRPXPXPPXRPPLPXXNSXXSCXXPPPTP 859 +P P P P P PP P S + PPPTP Sbjct: 117 VPHPTPKKSPSPPPTPSLPPPAPK-KSPSTPSLPPPTP 153 >At3g24550.1 68416.m03083 protein kinase family protein contains Pfam domain PF00069: Protein kinase domain Length = 652 Score = 28.3 bits (60), Expect = 7.5 Identities = 13/37 (35%), Positives = 14/37 (37%) Frame = +2 Query: 749 PPPPXXXXXRPXPXPPXRPPLPXXNSXXSCXXPPPTP 859 PP P P P P P LP + S P P P Sbjct: 44 PPSPSTNSTSPPPSSPLPPSLPPPSPPGSLTPPLPQP 80 Score = 27.9 bits (59), Expect = 10.0 Identities = 12/36 (33%), Positives = 14/36 (38%) Frame = +2 Query: 752 PPPXXXXXRPXPXPPXRPPLPXXNSXXSCXXPPPTP 859 PPP P P P P +S PPP+P Sbjct: 34 PPPTTTPSSPPPSPSTNSTSPPPSSPLPPSLPPPSP 69 >At2g27390.1 68415.m03306 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 134 Score = 28.3 bits (60), Expect = 7.5 Identities = 14/45 (31%), Positives = 14/45 (31%) Frame = +2 Query: 719 PAXNLSXXXLPPPPXXXXXRPXPXPPXRPPLPXXNSXXSCXXPPP 853 P L PPPP P PP PP PPP Sbjct: 71 PRFELPPPLFPPPPLPRLPPPLLPPPEEPPREPPPPPPPPEEPPP 115 Score = 27.9 bits (59), Expect = 10.0 Identities = 18/49 (36%), Positives = 18/49 (36%), Gaps = 4/49 (8%) Frame = +2 Query: 719 PAXNLSXXXLPPP-PXXXXXRPXPXP---PXRPPLPXXNSXXSCXXPPP 853 P LS PPP P P P P P PPLP PPP Sbjct: 35 PLLPLSPPPSPPPSPSSPPRLPPPFPALFPPEPPLPPRFELPPPLFPPP 83 >At1g67770.1 68414.m07733 RNA-binding protein, putative similar to terminal ear1 gb|AAC39463.1 Length = 527 Score = 28.3 bits (60), Expect = 7.5 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 785 PXPPXRPPLPXXNSXXSCXXPPPTP 859 P PP PP P S S PPP P Sbjct: 45 PPPPPPPPPPLYFSYFSLPPPPPPP 69 >At1g12040.1 68414.m01390 leucine-rich repeat family protein / extensin family protein (LRX1) similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 744 Score = 28.3 bits (60), Expect = 7.5 Identities = 15/38 (39%), Positives = 17/38 (44%), Gaps = 1/38 (2%) Frame = +2 Query: 749 PPPPXXXXXRPX-PXPPXRPPLPXXNSXXSCXXPPPTP 859 PPPP P P PP PP P + PPP+P Sbjct: 612 PPPPSPLYYPPVTPSPP--PPSPVYYPPVTPSPPPPSP 647 Score = 28.3 bits (60), Expect = 7.5 Identities = 15/38 (39%), Positives = 17/38 (44%), Gaps = 1/38 (2%) Frame = +2 Query: 749 PPPPXXXXXRPX-PXPPXRPPLPXXNSXXSCXXPPPTP 859 PPPP P P PP PP P + PPP+P Sbjct: 627 PPPPSPVYYPPVTPSPP--PPSPVYYPPVTPSPPPPSP 662 Score = 27.9 bits (59), Expect = 10.0 Identities = 15/37 (40%), Positives = 16/37 (43%) Frame = +2 Query: 749 PPPPXXXXXRPXPXPPXRPPLPXXNSXXSCXXPPPTP 859 PPPP P P PP P S S PPP+P Sbjct: 495 PPPPYVYSSPPPPYVYSSPPPPYVYS--SPPPPPPSP 529 >At4g18570.1 68417.m02749 proline-rich family protein common family members: At3g25690, At4g04980, At5g61090 [Arabidopsis thaliana] Length = 642 Score = 27.9 bits (59), Expect = 10.0 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +2 Query: 749 PPPPXXXXXRPXPXPPXRPP 808 PPPP P P PP PP Sbjct: 324 PPPPPSVSKAPPPPPPPPPP 343 >At1g70990.1 68414.m08190 proline-rich family protein Length = 176 Score = 27.9 bits (59), Expect = 10.0 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +2 Query: 749 PPPPXXXXXRPXPXPPXRPPLPXXNSXXSCXXPPPT 856 PPPP PP PP P S C PP T Sbjct: 96 PPPPSPPPPSQACPPPPLPPSPPKKSY--CPPPPST 129 >At1g02710.1 68414.m00222 glycine-rich protein Length = 96 Score = 27.9 bits (59), Expect = 10.0 Identities = 15/37 (40%), Positives = 17/37 (45%) Frame = -1 Query: 858 GVGGGXXHEXXELXXGKGGRXGGXGXGRXXXXXGGGG 748 G GGG + KGG GG G G+ GGGG Sbjct: 52 GEGGGGEGGGGQ-KISKGGGGGGSGGGQRSSSGGGGG 87 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,884,381 Number of Sequences: 28952 Number of extensions: 363251 Number of successful extensions: 3635 Number of sequences better than 10.0: 65 Number of HSP's better than 10.0 without gapping: 1140 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2777 length of database: 12,070,560 effective HSP length: 81 effective length of database: 9,725,448 effective search space used: 2178500352 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -