BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_FL5_K21 (857 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC114377-1|AAI14378.1| 44|Homo sapiens Unknown (protein for MG... 36 0.14 >BC114377-1|AAI14378.1| 44|Homo sapiens Unknown (protein for MGC:134704) protein. Length = 44 Score = 36.3 bits (80), Expect = 0.14 Identities = 18/34 (52%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Frame = -2 Query: 787 MIGRXDXEGSKS-TSYERLXATSQYPCGNFXGTS 689 MIGR D EGSKS + + YPCGNF TS Sbjct: 1 MIGRADIEGSKSDVAMNAWPPQASYPCGNFSDTS 34 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 119,203,483 Number of Sequences: 237096 Number of extensions: 2633727 Number of successful extensions: 5297 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 4965 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5292 length of database: 76,859,062 effective HSP length: 89 effective length of database: 55,757,518 effective search space used: 10928473528 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -