BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_FL5_K15 (862 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY263366-1|AAO92605.1| 139|Apis mellifera octopamine receptor p... 23 2.7 AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor p... 23 2.7 AF004169-1|AAC13418.1| 371|Apis mellifera ultraviolet-sensitive... 23 4.8 >AY263366-1|AAO92605.1| 139|Apis mellifera octopamine receptor protein. Length = 139 Score = 23.4 bits (48), Expect = 2.7 Identities = 11/42 (26%), Positives = 20/42 (47%) Frame = +2 Query: 233 SWDMKMKFWSDMLRQWCKHRKDPIVSSADARAAFQRKGRTPA 358 S D + F S + + +CK R + + +D R R+P+ Sbjct: 66 SKDFRFAFKSIICKCFCKRRTNTLRRGSDGSQLAMRNDRSPS 107 >AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor protein. Length = 587 Score = 23.4 bits (48), Expect = 2.7 Identities = 11/42 (26%), Positives = 20/42 (47%) Frame = +2 Query: 233 SWDMKMKFWSDMLRQWCKHRKDPIVSSADARAAFQRKGRTPA 358 S D + F S + + +CK R + + +D R R+P+ Sbjct: 514 SKDFRFAFKSIICKCFCKRRTNTLRRGSDGSQLAMRNDRSPS 555 >AF004169-1|AAC13418.1| 371|Apis mellifera ultraviolet-sensitive opsin protein. Length = 371 Score = 22.6 bits (46), Expect = 4.8 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = +1 Query: 112 PMMGLPDRGIPEDKLPQCWYD 174 P+MG+ R +PE L C +D Sbjct: 180 PVMGVWGRFVPEGFLTSCSFD 200 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 210,999 Number of Sequences: 438 Number of extensions: 4662 Number of successful extensions: 5 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 27795333 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -