BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_FL5_K08 (851 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY705398-1|AAU12507.1| 555|Anopheles gambiae nicotinic acetylch... 25 3.9 AY705397-1|AAU12506.1| 555|Anopheles gambiae nicotinic acetylch... 25 3.9 AY705396-1|AAU12505.1| 710|Anopheles gambiae nicotinic acetylch... 24 6.7 AF313909-1|AAL99382.1| 1024|Anopheles gambiae collagen IV alpha ... 24 6.7 AF543192-1|AAN40409.1| 636|Anopheles gambiae amino acid transpo... 23 8.9 >AY705398-1|AAU12507.1| 555|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 4 protein. Length = 555 Score = 24.6 bits (51), Expect = 3.9 Identities = 10/52 (19%), Positives = 26/52 (50%) Frame = +1 Query: 4 WRKRELPG*SCQ*LYACLKD*AMHVSVQAVLRRYREWLNISVLVP*ILLSYL 159 W E+P + Y C + + ++ +RR + +++++P + +S+L Sbjct: 209 WDILEVPAVRNEKFYTCCDEPYLDITFNITMRRKTLFYTVNIIIPCMGISFL 260 >AY705397-1|AAU12506.1| 555|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 4 protein. Length = 555 Score = 24.6 bits (51), Expect = 3.9 Identities = 10/52 (19%), Positives = 26/52 (50%) Frame = +1 Query: 4 WRKRELPG*SCQ*LYACLKD*AMHVSVQAVLRRYREWLNISVLVP*ILLSYL 159 W E+P + Y C + + ++ +RR + +++++P + +S+L Sbjct: 209 WDILEVPAVRNEKFYTCCDEPYLDITFNITMRRKTLFYTVNIIIPCMGISFL 260 >AY705396-1|AAU12505.1| 710|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 3 protein. Length = 710 Score = 23.8 bits (49), Expect = 6.7 Identities = 10/52 (19%), Positives = 26/52 (50%) Frame = +1 Query: 4 WRKRELPG*SCQ*LYACLKD*AMHVSVQAVLRRYREWLNISVLVP*ILLSYL 159 W E+P + Y C + + ++ +RR + +++++P + +S+L Sbjct: 205 WDILEVPAVRNEKFYTCCDEPYLDITFNITMRRKTLFYTVNLIIPCMGISFL 256 >AF313909-1|AAL99382.1| 1024|Anopheles gambiae collagen IV alpha 1 chain protein. Length = 1024 Score = 23.8 bits (49), Expect = 6.7 Identities = 12/30 (40%), Positives = 16/30 (53%), Gaps = 1/30 (3%) Frame = +2 Query: 716 FGHLVH-ALGRTAGGAXLSSAGLCLNASKA 802 + L+H A+G GG LS G CL +A Sbjct: 936 YSFLMHTAVGHGGGGQSLSGPGSCLEDFRA 965 >AF543192-1|AAN40409.1| 636|Anopheles gambiae amino acid transporter Ag_AAT8 protein. Length = 636 Score = 23.4 bits (48), Expect = 8.9 Identities = 11/22 (50%), Positives = 12/22 (54%), Gaps = 1/22 (4%) Frame = +2 Query: 719 GHLVHALGRT-AGGAXLSSAGL 781 GHL H G+T G S AGL Sbjct: 385 GHLAHVTGKTDVGNVVKSDAGL 406 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 888,383 Number of Sequences: 2352 Number of extensions: 17009 Number of successful extensions: 72 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 72 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 72 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 90545769 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -