BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_FL5_K08 (851 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC114377-1|AAI14378.1| 44|Homo sapiens Unknown (protein for MG... 74 8e-13 AL356489-1|CAC88180.1| 130|Homo sapiens T cell receptor beta va... 30 9.3 >BC114377-1|AAI14378.1| 44|Homo sapiens Unknown (protein for MGC:134704) protein. Length = 44 Score = 73.7 bits (173), Expect = 8e-13 Identities = 33/37 (89%), Positives = 34/37 (91%) Frame = -2 Query: 565 MIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSC*K 455 MIGRADIEGSKS+VAMNAW PQASYPCGNFS TSC K Sbjct: 1 MIGRADIEGSKSDVAMNAWPPQASYPCGNFSDTSCLK 37 >AL356489-1|CAC88180.1| 130|Homo sapiens T cell receptor beta variable 25/OR9-2 protein. Length = 130 Score = 30.3 bits (65), Expect = 9.3 Identities = 15/35 (42%), Positives = 21/35 (60%), Gaps = 1/35 (2%) Frame = -2 Query: 643 SHDGLTPAHVPF*WVNNPTLGEFCF-AMIGRADIE 542 S +G+TP H PF WVN+ G+ C + + R IE Sbjct: 60 SRNGITP-HPPFLWVNSTEKGDLCSESTVSRIRIE 93 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 123,221,974 Number of Sequences: 237096 Number of extensions: 2613133 Number of successful extensions: 3944 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3828 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3944 length of database: 76,859,062 effective HSP length: 89 effective length of database: 55,757,518 effective search space used: 10816958492 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -