BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_FL5_K06 (1208 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_02_0127 + 12140843-12140966,12141170-12141567 36 0.064 01_01_0570 - 4231100-4232560 36 0.064 03_05_0688 + 26762668-26762893,26763027-26763101,26763865-267640... 35 0.11 07_03_0560 + 19479597-19480667 35 0.15 07_01_0080 + 587674-588510 35 0.15 03_05_0690 + 26778567-26778804,26778950-26779024,26779995-267800... 35 0.15 07_03_1751 - 29215074-29216270 34 0.19 12_01_0838 - 7830944-7831444 33 0.34 01_06_0719 + 31474028-31474476,31474881-31474939,31479145-31479983 33 0.34 08_01_0003 + 30085-30195,30289-30365,31080-31136,31668-33560,336... 33 0.45 06_02_0122 - 12095385-12095713,12096018-12096120 33 0.45 06_01_0486 - 3455030-3455770 33 0.45 03_05_0704 - 26953474-26953643,26953770-26953801,26953915-269540... 33 0.45 12_01_0841 - 7873458-7874225 33 0.60 06_03_0790 - 24636805-24637770 33 0.60 03_02_0765 + 11000724-11002496 33 0.60 02_01_0458 + 3291563-3291733,3292082-3292769,3292847-3293363,329... 33 0.60 07_03_0177 - 14770777-14772045 32 0.79 06_02_0175 - 12624608-12625297 32 0.79 12_02_1174 - 26696869-26698191 32 1.0 10_01_0100 + 1209424-1209538,1210373-1211073,1211158-1211379,121... 32 1.0 07_03_0558 + 19461369-19462448 32 1.0 03_01_0515 - 3864796-3865425 32 1.0 02_05_0686 - 30900748-30902167,30903442-30904742 32 1.0 08_01_0539 + 4679392-4681282,4682060-4682104,4682403-4683560,468... 31 1.4 07_01_0516 - 3850252-3852870 31 1.4 04_03_0098 + 11183039-11183752 31 1.4 02_04_0400 - 22608519-22608844,22609044-22609122 31 1.4 01_06_1678 - 39095986-39096205,39096400-39096477,39096578-390969... 31 1.4 03_06_0365 - 33399422-33399925,33400470-33400583,33400762-334009... 31 1.8 08_01_0202 - 1638978-1639571 30 3.2 08_01_0059 - 394001-394708 30 3.2 04_04_0233 + 23801944-23802598,23802914-23803047,23803548-238037... 30 3.2 03_05_0576 + 25765137-25766420 30 3.2 03_02_0071 + 5425722-5427154,5427259-5427464,5428445-5428686,542... 30 3.2 10_03_0023 - 7151465-7152111,7152222-7152405 30 4.2 09_06_0107 + 20907560-20908491,20908511-20908625,20908967-209090... 30 4.2 09_04_0506 - 18188785-18190599 30 4.2 08_02_0796 - 21300251-21300373,21300846-21301721 30 4.2 08_01_0375 - 3307206-3307316,3307870-3307965,3308061-3308132,330... 30 4.2 07_03_0559 + 19475893-19476783 30 4.2 06_01_0194 + 1503350-1503554,1504399-1504490,1504835-1504935,150... 30 4.2 06_01_0178 + 1386981-1387505 30 4.2 05_04_0303 - 20010761-20011756 30 4.2 03_03_0008 - 13674602-13674708,13675272-13675439,13676169-136767... 30 4.2 03_02_0514 + 9038606-9039790,9040211-9040432,9040548-9040655,904... 30 4.2 12_02_0299 - 17051570-17052474,17053542-17053755 29 5.5 06_03_1326 - 29355467-29355817 29 5.5 06_01_0145 + 1092764-1093351 29 5.5 05_01_0028 + 182528-183852,183967-184127,184872-185116,185330-18... 29 5.5 04_04_0057 + 22410167-22411330 29 5.5 04_01_0069 - 697811-697876,697956-698166,698265-698359,698448-69... 29 5.5 02_02_0140 + 7125914-7126264,7126426-7126677,7126766-7126861,712... 29 5.5 01_07_0021 - 40533864-40534583,40534779-40534814,40534909-405350... 29 5.5 09_04_0629 - 19098087-19098516,19099120-19099370 29 7.3 09_02_0543 + 10427321-10428315,10428440-10429154 29 7.3 08_01_0774 + 7482311-7482919,7484012-7484077,7484211-7484384,748... 29 7.3 07_03_1155 - 24413270-24413728 29 7.3 05_07_0236 - 28582157-28582552,28582639-28582911,28583324-285835... 29 7.3 05_01_0210 + 1583176-1584177 29 7.3 04_04_0679 + 27214577-27215023 29 7.3 03_02_0155 - 5974118-5974173,5974242-5974314,5974393-5974500,597... 29 7.3 02_01_0275 - 1828300-1828344,1828396-1828531,1828623-1829317 29 7.3 01_06_0146 + 26969011-26969995,26970878-26970930 29 7.3 10_08_0223 - 15986763-15987575 29 9.7 10_06_0039 - 9966744-9967535,9968241-9968482,9969021-9969223,996... 29 9.7 10_02_0157 - 5954439-5954801,5956244-5956270,5956465-5956526,595... 29 9.7 09_04_0081 - 14400293-14400397,14400953-14401036,14401144-144012... 29 9.7 06_02_0126 + 12130409-12130532,12131015-12131373 29 9.7 05_01_0004 - 34967-35149,35340-35501,36078-36225,36309-36385,365... 29 9.7 02_01_0163 + 1135592-1135623,1135718-1135816,1135904-1135960,113... 29 9.7 >06_02_0127 + 12140843-12140966,12141170-12141567 Length = 173 Score = 35.9 bits (79), Expect = 0.064 Identities = 16/34 (47%), Positives = 17/34 (50%) Frame = +1 Query: 25 GGXGGXGGXGGGGXGXGXXXXXGXGGXXXXEGMG 126 GG GG GG GGGG G G GG +G G Sbjct: 117 GGYGGYGGYGGGGYGGYNKGYGGGGGGGYSKGFG 150 >01_01_0570 - 4231100-4232560 Length = 486 Score = 35.9 bits (79), Expect = 0.064 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = +1 Query: 25 GGXGGXGGXGGGGXGXGXXXXXGXGGXXXXEGMG 126 G GG GG GGGG G G G GG G G Sbjct: 82 GAAGGLGGGGGGGGGLGGSGGLGGGGMGGSGGFG 115 Score = 33.5 bits (73), Expect = 0.34 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = +1 Query: 25 GGXGGXGGXGGGGXGXGXXXXXGXGGXXXXEGMG 126 G GG G GGGG G G G GG GMG Sbjct: 186 GRFGGGGMGGGGGFGGGAGGGVGGGGELGGGGMG 219 Score = 32.3 bits (70), Expect = 0.79 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 1/35 (2%) Frame = +1 Query: 25 GGXGGXGG-XGGGGXGXGXXXXXGXGGXXXXEGMG 126 GG GG GG GG G G G G GG G G Sbjct: 191 GGMGGGGGFGGGAGGGVGGGGELGGGGMGGGSGFG 225 Score = 31.1 bits (67), Expect = 1.8 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +1 Query: 25 GGXGGXGGXGGGGXGXGXXXXXGXGGXXXXEGMG 126 G GG GG G G G G G GG G G Sbjct: 167 GAGGGFGGGAGAGGGVGGGGRFGGGGMGGGGGFG 200 Score = 29.9 bits (64), Expect = 4.2 Identities = 16/36 (44%), Positives = 17/36 (47%), Gaps = 2/36 (5%) Frame = +1 Query: 25 GGXGGXGGXG--GGGXGXGXXXXXGXGGXXXXEGMG 126 GG GG GG G GGG G G GG G+G Sbjct: 92 GGGGGLGGSGGLGGGGMGGSGGFGGGGGGGVGGGVG 127 Score = 29.9 bits (64), Expect = 4.2 Identities = 16/36 (44%), Positives = 17/36 (47%), Gaps = 2/36 (5%) Frame = +1 Query: 25 GGXGGX--GGXGGGGXGXGXXXXXGXGGXXXXEGMG 126 GG GG GG GGG G G G GG G+G Sbjct: 262 GGMGGDIGGGAGGGVGGGGGGGMGGGGGFGGGGGVG 297 Score = 29.5 bits (63), Expect = 5.5 Identities = 17/35 (48%), Positives = 17/35 (48%), Gaps = 1/35 (2%) Frame = +1 Query: 25 GGXGGXGGXGGG-GXGXGXXXXXGXGGXXXXEGMG 126 GG GG G GGG G G G G GG GMG Sbjct: 216 GGMGGGSGFGGGAGGGFGAGGGVG-GGIGVGGGMG 249 Score = 29.1 bits (62), Expect = 7.3 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +1 Query: 25 GGXGGXGGXGGGGXGXGXXXXXGXGGXXXXEGMG 126 GG G GG G GG G G GG G G Sbjct: 140 GGLRGGGGVGAGGGGGFGGGAGGGGGIGAGGGFG 173 Score = 28.7 bits (61), Expect = 9.7 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = +1 Query: 25 GGXGGXGGXGGGGXGXGXXXXXGXGGXXXXEGMG 126 GG GG G G GG G G G G G+G Sbjct: 90 GGGGGGGLGGSGGLGGGGMGGSGGFGGGGGGGVG 123 >03_05_0688 + 26762668-26762893,26763027-26763101,26763865-26764032, 26764983-26765114,26765538-26765677,26765840-26765908, 26766325-26766435,26766854-26766973,26768223-26768324, 26769608-26769778,26769865-26769944,26770119-26770182 Length = 485 Score = 35.1 bits (77), Expect = 0.11 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = +1 Query: 25 GGXGGXGGXGGGGXGXGXXXXXGXGGXXXXEGMG 126 G GG GG GGGG G G G G GMG Sbjct: 11 GRDGGGGGGGGGGGGGGGVDPAGGGSGGGGPGMG 44 >07_03_0560 + 19479597-19480667 Length = 356 Score = 34.7 bits (76), Expect = 0.15 Identities = 17/35 (48%), Positives = 18/35 (51%), Gaps = 1/35 (2%) Frame = +1 Query: 25 GGXGGXGG-XGGGGXGXGXXXXXGXGGXXXXEGMG 126 GG GG GG GGGG G G G GG G+G Sbjct: 91 GGAGGGGGLGGGGGKGGGFGGGVGGGGGGEGGGLG 125 Score = 33.5 bits (73), Expect = 0.34 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = +1 Query: 25 GGXGGXGGXGGGGXGXGXXXXXGXGGXXXXEGMG 126 GG GG GG GGGG G GG GMG Sbjct: 200 GGAGGGGGMGGGGGGGFGGGGGKGGGFGAGGGMG 233 Score = 31.9 bits (69), Expect = 1.0 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +1 Query: 28 GXGGXGGXGGGGXGXGXXXXXGXGGXXXXEGMG 126 G GG GG GGGG G GG G+G Sbjct: 283 GGGGGGGLGGGGGAGGGLGGGAGGGLGHGGGLG 315 Score = 31.5 bits (68), Expect = 1.4 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +1 Query: 25 GGXGGXGGXGGGGXGXGXXXXXGXGGXXXXEGMG 126 GG GG GG GGG G G G G G+G Sbjct: 100 GGGGGKGGGFGGGVGGGGGGEGGGLGGGGGGGLG 133 Score = 31.5 bits (68), Expect = 1.4 Identities = 15/27 (55%), Positives = 15/27 (55%), Gaps = 1/27 (3%) Frame = +1 Query: 25 GGXGGX-GGXGGGGXGXGXXXXXGXGG 102 GG GG GG GGGG G G G GG Sbjct: 118 GGEGGGLGGGGGGGLGGGGGGGVGGGG 144 Score = 31.5 bits (68), Expect = 1.4 Identities = 15/27 (55%), Positives = 15/27 (55%), Gaps = 1/27 (3%) Frame = +1 Query: 25 GGXGGXGG-XGGGGXGXGXXXXXGXGG 102 GG GG GG GGGG G G G GG Sbjct: 234 GGAGGGGGLGGGGGGGMGGGGGGGMGG 260 Score = 30.3 bits (65), Expect = 3.2 Identities = 17/35 (48%), Positives = 17/35 (48%), Gaps = 1/35 (2%) Frame = +1 Query: 25 GGXGGX-GGXGGGGXGXGXXXXXGXGGXXXXEGMG 126 GG GG GG GGGG G G G GG G G Sbjct: 244 GGGGGGMGGGGGGGMGGGAGGGFG-GGAGGGAGQG 277 Score = 30.3 bits (65), Expect = 3.2 Identities = 16/37 (43%), Positives = 17/37 (45%), Gaps = 3/37 (8%) Frame = +1 Query: 25 GGXGGXGGXG---GGGXGXGXXXXXGXGGXXXXEGMG 126 GG GG G G GGG G G G GG G+G Sbjct: 298 GGLGGGAGGGLGHGGGLGGGLGHGGGLGGGGFGVGVG 334 Score = 29.9 bits (64), Expect = 4.2 Identities = 16/36 (44%), Positives = 17/36 (47%), Gaps = 2/36 (5%) Frame = +1 Query: 25 GGXGGXG--GXGGGGXGXGXXXXXGXGGXXXXEGMG 126 GG GG G G GGGG G G GG G+G Sbjct: 65 GGFGGDGGFGGGGGGGLGGGGGFGGGGGAGGGGGLG 100 Score = 29.9 bits (64), Expect = 4.2 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +2 Query: 23 GXXXGGXGGRXGGXXGWGXXXXXEXGGGXGXRG 121 G GG GG GG G+G GGG G G Sbjct: 71 GGFGGGGGGGLGGGGGFGGGGGAGGGGGLGGGG 103 Score = 29.5 bits (63), Expect = 5.5 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = +1 Query: 28 GXGGXGGXGGGGXGXGXXXXXGXGG 102 G GG GG GGGG G G G GG Sbjct: 125 GGGGGGGLGGGG-GGGVGGGGGQGG 148 Score = 29.1 bits (62), Expect = 7.3 Identities = 17/35 (48%), Positives = 17/35 (48%), Gaps = 1/35 (2%) Frame = +1 Query: 25 GGXGGXGGXG-GGGXGXGXXXXXGXGGXXXXEGMG 126 GG G GG G GGG G G G GG GMG Sbjct: 218 GGGGKGGGFGAGGGMGGGAGGGGGLGGGGGG-GMG 251 Score = 29.1 bits (62), Expect = 7.3 Identities = 14/27 (51%), Positives = 14/27 (51%), Gaps = 1/27 (3%) Frame = +1 Query: 25 GGXGGXGGXGG-GGXGXGXXXXXGXGG 102 GG GG G GG GG G G G GG Sbjct: 268 GGAGGGAGQGGSGGLGGGGGGGLGGGG 294 Score = 28.7 bits (61), Expect = 9.7 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 3/36 (8%) Frame = +1 Query: 28 GXGGXGGXG---GGGXGXGXXXXXGXGGXXXXEGMG 126 G GG GG G GGG G G G GG G G Sbjct: 251 GGGGGGGMGGGAGGGFGGGAGGGAGQGGSGGLGGGG 286 >07_01_0080 + 587674-588510 Length = 278 Score = 34.7 bits (76), Expect = 0.15 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -3 Query: 120 PLXPSPPPXSXXXXXPXPXXPPXLPPXPP 34 P P PPP S P P PP PP PP Sbjct: 91 PPPPPPPPPSSGSPPPPPPPPPPPPPPPP 119 Score = 34.7 bits (76), Expect = 0.15 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -3 Query: 120 PLXPSPPPXSXXXXXPXPXXPPXLPPXPP 34 P P PPP S P P PP PP PP Sbjct: 92 PPPPPPPPSSGSPPPPPPPPPPPPPPPPP 120 Score = 33.1 bits (72), Expect = 0.45 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = -3 Query: 111 PSPPPXSXXXXXPXPXXPPXLPPXPPXXXP 22 P PPP P P PP PP PP P Sbjct: 92 PPPPPPPPSSGSPPPPPPPPPPPPPPPPPP 121 Score = 29.9 bits (64), Expect = 4.2 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = -3 Query: 111 PSPPPXSXXXXXPXPXXPPXLPPXPPXXXP 22 P PPP P PP PP PP P Sbjct: 91 PPPPPPPPPSSGSPPPPPPPPPPPPPPPPP 120 >03_05_0690 + 26778567-26778804,26778950-26779024,26779995-26780099, 26780869-26781000,26781432-26781571,26782213-26782323, 26782690-26782812,26784166-26784267,26784536-26784546, 26784878-26785103,26785363-26785401,26785413-26785583, 26785674-26785753,26785976-26786039 Length = 538 Score = 34.7 bits (76), Expect = 0.15 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = +1 Query: 25 GGXGGXGGXGGGGXGXGXXXXXGXGGXXXXEGMG 126 GG GG GG GGGG G G G GMG Sbjct: 15 GGGGGGGGGGGGGGGGVGGDRGGGGSGGGGPGMG 48 >07_03_1751 - 29215074-29216270 Length = 398 Score = 34.3 bits (75), Expect = 0.19 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +1 Query: 25 GGXGGXGGXGGGGXGXGXXXXXGXGGXXXXEGMG 126 GG GG GG GGGG G G G G+G Sbjct: 121 GGLGGGGGLGGGGGGGAGGGLGGGAGGGAGAGVG 154 Score = 31.9 bits (69), Expect = 1.0 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = +1 Query: 25 GGXGGXGGXGGGGXGXGXXXXXGXGGXXXXEGMG 126 GG GG GG GGG G GG G+G Sbjct: 183 GGSGGGGGLGGGAGGGAGVGGGAGGGAGGGGGLG 216 Score = 31.9 bits (69), Expect = 1.0 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = +1 Query: 25 GGXGGXGGXGGGGXGXGXXXXXGXGGXXXXEGMG 126 GG GG GG GGG G GG G+G Sbjct: 235 GGHGGGGGLGGGAGGGAGVGGGAGGGAGAGGGLG 268 Score = 30.7 bits (66), Expect = 2.4 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = +1 Query: 25 GGXGGXGGXGGGGXGXGXXXXXGXGGXXXXEGMG 126 GG G GG GGG G G GG G+G Sbjct: 197 GGAGVGGGAGGGAGGGGGLGGGAGGGAGGGGGLG 230 Score = 30.7 bits (66), Expect = 2.4 Identities = 17/35 (48%), Positives = 18/35 (51%), Gaps = 1/35 (2%) Frame = +1 Query: 25 GGXGGXGGXGGG-GXGXGXXXXXGXGGXXXXEGMG 126 GG GG GG GGG G G G G GG G+G Sbjct: 221 GGAGGGGGLGGGAGGGHGGGGGLG-GGAGGGAGVG 254 Score = 30.3 bits (65), Expect = 3.2 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = +1 Query: 25 GGXGGXGGXGGGGXGXGXXXXXGXGGXXXXEGMG 126 GG G GG GGG G G GG G+G Sbjct: 211 GGGGLGGGAGGGAGGGGGLGGGAGGGHGGGGGLG 244 Score = 29.5 bits (63), Expect = 5.5 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 2/36 (5%) Frame = +1 Query: 25 GGXGGX--GGXGGGGXGXGXXXXXGXGGXXXXEGMG 126 GG GG GG GGGG G G G G G G Sbjct: 291 GGFGGGKGGGFGGGGGGGGGAGAGGGFGGGKGGGFG 326 Score = 29.1 bits (62), Expect = 7.3 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +1 Query: 25 GGXGGXGGXGGGGXGXGXXXXXGXGGXXXXEGMG 126 GG G GG GGG G G GG G G Sbjct: 285 GGAGAGGGFGGGKGGGFGGGGGGGGGAGAGGGFG 318 Score = 29.1 bits (62), Expect = 7.3 Identities = 14/27 (51%), Positives = 14/27 (51%), Gaps = 1/27 (3%) Frame = +1 Query: 25 GGXGGXGGXGGG-GXGXGXXXXXGXGG 102 GG GG G GGG G G G G GG Sbjct: 305 GGGGGGAGAGGGFGGGKGGGFGGGFGG 331 >12_01_0838 - 7830944-7831444 Length = 166 Score = 33.5 bits (73), Expect = 0.34 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +1 Query: 25 GGXGGXGGXGGGGXGXGXXXXXGXGGXXXXEGMG 126 GG GG GG G G G G G GG G G Sbjct: 40 GGGGGGGGGNGSGSGSGYGYNYGKGGGQSGGGQG 73 >01_06_0719 + 31474028-31474476,31474881-31474939,31479145-31479983 Length = 448 Score = 33.5 bits (73), Expect = 0.34 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +1 Query: 25 GGXGGXGGXGGGGXGXGXXXXXGXGGXXXXEGMG 126 GG G GG GGG G G G GG G+G Sbjct: 281 GGGKGGGGGGGGNTGGGIGGSTGGGGRGAGAGVG 314 >08_01_0003 + 30085-30195,30289-30365,31080-31136,31668-33560, 33643-34147,34250-34358,34436-34548,34619-34806, 35481-36129,36169-36691,36760-36911,37042-37141, 37301-37416 Length = 1530 Score = 33.1 bits (72), Expect = 0.45 Identities = 15/29 (51%), Positives = 16/29 (55%) Frame = -3 Query: 120 PLXPSPPPXSXXXXXPXPXXPPXLPPXPP 34 PL PSPPP + P P P LPP PP Sbjct: 1159 PLPPSPPPAT---PPPPPPLSPSLPPPPP 1184 Score = 29.9 bits (64), Expect = 4.2 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = -3 Query: 117 LXPSPPPXSXXXXXPXPXXPPXLPPXPPXXXP 22 L P PPP P PP LP PP P Sbjct: 1179 LPPPPPPPPLPSGPPPQPAPPPLPIQPPPIPP 1210 Score = 29.5 bits (63), Expect = 5.5 Identities = 14/34 (41%), Positives = 14/34 (41%), Gaps = 1/34 (2%) Frame = -3 Query: 120 PLXPSPPPXSXXXXXPXPXX-PPXLPPXPPXXXP 22 PL PPP P P PP PP PP P Sbjct: 1133 PLDAPPPPPLPEGPPPLPSDSPPCQPPLPPSPPP 1166 Score = 29.1 bits (62), Expect = 7.3 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -3 Query: 120 PLXPSPPPXSXXXXXPXPXXPPXLPPXPP 34 P P PPP P P PP LP PP Sbjct: 1166 PATPPPPP-PLSPSLPPPPPPPPLPSGPP 1193 >06_02_0122 - 12095385-12095713,12096018-12096120 Length = 143 Score = 33.1 bits (72), Expect = 0.45 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +2 Query: 23 GXXXGGXGGRXGGXXGWGXXXXXEXGGGXGXRGW 124 G GG GG GG G G GGG G GW Sbjct: 109 GGSGGGYGGGYGGGYGGGYGGGGGYGGGYGGGGW 142 >06_01_0486 - 3455030-3455770 Length = 246 Score = 33.1 bits (72), Expect = 0.45 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = -3 Query: 120 PLXPSPPPXSXXXXXPXPXXPPXLPPXPPXXXP 22 P P PPP P P PP +PP P P Sbjct: 81 PPTPRPPPTPPYVPSPPPYVPPYIPPPTPPYVP 113 Score = 29.1 bits (62), Expect = 7.3 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -3 Query: 120 PLXPSPPPXSXXXXXPXPXXPPXLPPXPPXXXP 22 P P P P S P P PP PP PP P Sbjct: 122 PYVPPPTPPS-----PPPYVPPPTPPSPPPYVP 149 Score = 29.1 bits (62), Expect = 7.3 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = -3 Query: 120 PLXPSPPPXSXXXXXPXPXXPPXLPPXPP 34 P PSPPP P P PP +PP P Sbjct: 127 PTPPSPPPYVPPPTPPSP--PPYVPPPSP 153 >03_05_0704 - 26953474-26953643,26953770-26953801,26953915-26954009, 26954107-26954180,26954283-26954412,26954522-26954585, 26954660-26954722,26954795-26954937,26955386-26955523, 26955610-26955731,26955805-26955976,26956559-26956630, 26956753-26956887,26956987-26957103,26957184-26957316, 26957455-26957561,26958060-26958077,26958235-26958379, 26958472-26958671,26960744-26961421 Length = 935 Score = 33.1 bits (72), Expect = 0.45 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = +2 Query: 35 GGXGGRXGGXXGWGXXXXXEXGGGXGXRG 121 GG GGR GG G G GGG G RG Sbjct: 6 GGGGGRRGGRGGGGGREGGGGGGGGGGRG 34 >12_01_0841 - 7873458-7874225 Length = 255 Score = 32.7 bits (71), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +1 Query: 25 GGXGGXGGXGGGGXGXGXXXXXGXGGXXXXEGMG 126 GG GG G GGGG G G G G G G Sbjct: 39 GGGGGGGEGGGGGSGYGEGYGQGGGASGGGYGQG 72 >06_03_0790 - 24636805-24637770 Length = 321 Score = 32.7 bits (71), Expect = 0.60 Identities = 16/42 (38%), Positives = 17/42 (40%) Frame = +3 Query: 24 GXXXGXGGXGXGGXXXGGXXXXGXGGXXXXRGDGXRXXXGGD 149 G G GG G GG GG G GG G+G GD Sbjct: 116 GGGGGRGGGGGGGGGGGGGGGGGGGGGGGGGGNGGDDGDNGD 157 Score = 31.5 bits (68), Expect = 1.4 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 23 GXXXGGXGGRXGGXXGWGXXXXXEXGGGXGXRG 121 G GG GGR GG G G GGG G G Sbjct: 112 GGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGGG 144 >03_02_0765 + 11000724-11002496 Length = 590 Score = 32.7 bits (71), Expect = 0.60 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +1 Query: 25 GGXGGXGGXGGGGXGXGXXXXXGXGGXXXXEGMG 126 GG GG GG GGG G G G G G+G Sbjct: 122 GGLGGGGGLGGGAGGGGGLGSGGGLGGGAGGGLG 155 Score = 31.5 bits (68), Expect = 1.4 Identities = 15/27 (55%), Positives = 15/27 (55%), Gaps = 1/27 (3%) Frame = +1 Query: 25 GGXGGXGG-XGGGGXGXGXXXXXGXGG 102 GG GG GG GGGG G G G GG Sbjct: 46 GGFGGGGGLGGGGGAGGGFGGGLGHGG 72 Score = 31.5 bits (68), Expect = 1.4 Identities = 15/27 (55%), Positives = 15/27 (55%), Gaps = 1/27 (3%) Frame = +1 Query: 25 GGXGGXGG-XGGGGXGXGXXXXXGXGG 102 GG GG GG GGGG G G G GG Sbjct: 84 GGLGGGGGLGGGGGAGGGFGGGLGHGG 110 Score = 31.1 bits (67), Expect = 1.8 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 28 GXGGXGGXGGGGXGXGXXXXXGXGGXXXXEGMG 126 G GG GG GGG G G GG G G Sbjct: 447 GAGGGGGLGGGAGGGGGLDGGAGGGAEAGGGFG 479 Score = 30.7 bits (66), Expect = 2.4 Identities = 17/35 (48%), Positives = 18/35 (51%), Gaps = 1/35 (2%) Frame = +1 Query: 25 GGXGGXGGXG-GGGXGXGXXXXXGXGGXXXXEGMG 126 GG GG GG G GGG G G G GG G+G Sbjct: 132 GGAGGGGGLGSGGGLGGGAGGGLG-GGAGGGGGLG 165 Score = 29.1 bits (62), Expect = 7.3 Identities = 14/27 (51%), Positives = 14/27 (51%), Gaps = 1/27 (3%) Frame = +1 Query: 25 GGXGGX-GGXGGGGXGXGXXXXXGXGG 102 GG GG G GGGG G G G GG Sbjct: 320 GGLGGGAGAGGGGGLGGGAGGGGGLGG 346 Score = 29.1 bits (62), Expect = 7.3 Identities = 14/27 (51%), Positives = 14/27 (51%), Gaps = 1/27 (3%) Frame = +1 Query: 25 GGXGGX-GGXGGGGXGXGXXXXXGXGG 102 GG GG G GGGG G G G GG Sbjct: 360 GGLGGGAGAGGGGGLGGGAGGGGGLGG 386 Score = 29.1 bits (62), Expect = 7.3 Identities = 14/27 (51%), Positives = 14/27 (51%), Gaps = 1/27 (3%) Frame = +1 Query: 25 GGXGGXGG-XGGGGXGXGXXXXXGXGG 102 GG GG G GGGG G G G GG Sbjct: 400 GGLGGGAGTGGGGGLGGGAGGGGGLGG 426 Score = 29.1 bits (62), Expect = 7.3 Identities = 14/27 (51%), Positives = 14/27 (51%), Gaps = 1/27 (3%) Frame = +1 Query: 25 GGXGGXGGXGGG-GXGXGXXXXXGXGG 102 GG GG G GGG G G G G GG Sbjct: 508 GGLGGGAGAGGGFGGGKGGGFGGGLGG 534 >02_01_0458 + 3291563-3291733,3292082-3292769,3292847-3293363, 3293438-3293637,3294137-3294372,3294469-3295302 Length = 881 Score = 32.7 bits (71), Expect = 0.60 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -3 Query: 117 LXPSPPPXSXXXXXPXPXXPPXLPPXPP 34 L P PPP P P PP PP PP Sbjct: 351 LMPPPPPPPPPPPPPPPPPPPRPPPPPP 378 Score = 29.9 bits (64), Expect = 4.2 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = -3 Query: 120 PLXPSPPPXSXXXXXPXPXXPPXLPPXPP 34 P PPP P P PP PP PP Sbjct: 349 PKLMPPPPPPPPPPPPPPPPPPPRPPPPP 377 Score = 29.1 bits (62), Expect = 7.3 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -3 Query: 120 PLXPSPPPXSXXXXXPXPXXPPXLPPXPP 34 P P PPP P P PP PP PP Sbjct: 353 PPPPPPPPPPPPPPPPPPPRPP--PPPPP 379 Score = 28.7 bits (61), Expect = 9.7 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = -2 Query: 97 PLPXXXXPPXXXPPXPXPPXPXXXP 23 P P PP PP P PP P P Sbjct: 353 PPPPPPPPPPPPPPPPPPPRPPPPP 377 >07_03_0177 - 14770777-14772045 Length = 422 Score = 32.3 bits (70), Expect = 0.79 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +1 Query: 25 GGXGGXGGXGGGGXGXGXXXXXGXGGXXXXEGMG 126 GG GG GG GG G G G G G G G Sbjct: 373 GGGGGFGGGGGSGIGGGFGKGGGFGFGVGGGGFG 406 Score = 31.5 bits (68), Expect = 1.4 Identities = 15/27 (55%), Positives = 15/27 (55%), Gaps = 1/27 (3%) Frame = +1 Query: 25 GGXGGXGGXGGG-GXGXGXXXXXGXGG 102 GG GG GG GGG G G G G GG Sbjct: 231 GGLGGGGGLGGGIGKGGGLGGGIGKGG 257 Score = 31.5 bits (68), Expect = 1.4 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = +1 Query: 25 GGXGGXGGXGGGGXGXGXXXXXGXGGXXXXEGMG 126 GG GG GG GGG G G G GG G G Sbjct: 359 GGLGGGGGL-GGGGGGGGGGFGGGGGSGIGGGFG 391 Score = 31.1 bits (67), Expect = 1.8 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +1 Query: 25 GGXGGXGGXGGGGXGXGXXXXXGXGGXXXXEGMG 126 GG G GG GGG G G G GG G+G Sbjct: 81 GGGGFGGGGGGGLGGGGGGGLGGGGGFGKGGGVG 114 Score = 29.5 bits (63), Expect = 5.5 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +1 Query: 28 GXGGXGGXGGGGXGXGXXXXXGXGGXXXXEGMG 126 G GG G GGGG G G G G G+G Sbjct: 62 GKGGGFGGGGGGGGGGGFGGGGGFGGGGGGGLG 94 Score = 29.1 bits (62), Expect = 7.3 Identities = 14/27 (51%), Positives = 14/27 (51%), Gaps = 1/27 (3%) Frame = +1 Query: 25 GGXGGXGGXGGG-GXGXGXXXXXGXGG 102 GG GG G GGG G G G G GG Sbjct: 313 GGLGGGSGLGGGIGKGGGLGGSFGKGG 339 Score = 28.7 bits (61), Expect = 9.7 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = +2 Query: 23 GXXXGGXGGRXGGXXGWGXXXXXEXGGGXG 112 G GG GG GG G+G GGG G Sbjct: 69 GGGGGGGGGGFGGGGGFGGGGGGGLGGGGG 98 Score = 28.7 bits (61), Expect = 9.7 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = +1 Query: 25 GGXGGXGGXGGGGXGXGXXXXXGXGG 102 GG G GG GGGG G G G GG Sbjct: 261 GGFGKGGGLGGGG-GLGGGEDGGLGG 285 >06_02_0175 - 12624608-12625297 Length = 229 Score = 32.3 bits (70), Expect = 0.79 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +2 Query: 23 GXXXGGXGGRXGGXXGWGXXXXXEXGGGXGXRGW 124 G GG GG GG G G GGG G R W Sbjct: 97 GSSGGGGGGGGGGGGGGGGGGGGGGGGGGGRRCW 130 >12_02_1174 - 26696869-26698191 Length = 440 Score = 31.9 bits (69), Expect = 1.0 Identities = 13/36 (36%), Positives = 15/36 (41%) Frame = -3 Query: 129 AXHPLXPSPPPXSXXXXXPXPXXPPXLPPXPPXXXP 22 A P+ P PPP P PP + P PP P Sbjct: 118 ALSPVPPPPPPPRTRTRVEPPHRPPPVKPQPPPSLP 153 Score = 31.5 bits (68), Expect = 1.4 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = -3 Query: 120 PLXPSPPPXSXXXXXPXPXXPPXLPPXPPXXXP 22 P+ P PPP P P PP PP PP P Sbjct: 143 PVKPQPPPS---LPPPPPPPPPPPPPRPPSVKP 172 Score = 29.9 bits (64), Expect = 4.2 Identities = 14/34 (41%), Positives = 14/34 (41%), Gaps = 1/34 (2%) Frame = -3 Query: 120 PLXPSPPPXSXXXXXPXPXXPPXL-PPXPPXXXP 22 P P PP P P PP L PP PP P Sbjct: 162 PPPPRPPSVKPPVVQPKPQPPPSLQPPSPPPPPP 195 Score = 28.7 bits (61), Expect = 9.7 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = -2 Query: 97 PLPXXXXPPXXXPPXPXPPXPXXXP 23 P P PP PP P PP P P Sbjct: 141 PPPVKPQPPPSLPPPPPPPPPPPPP 165 >10_01_0100 + 1209424-1209538,1210373-1211073,1211158-1211379, 1211452-1211878,1212091-1213219,1213623-1213746, 1214207-1214278,1215480-1215578,1215617-1215640, 1215704-1215745,1215815-1215895,1215983-1216114, 1216115-1216196,1216271-1216365,1218499-1218570, 1218676-1218792,1219379-1219447,1219521-1219587, 1219886-1220025 Length = 1269 Score = 31.9 bits (69), Expect = 1.0 Identities = 13/34 (38%), Positives = 14/34 (41%) Frame = -3 Query: 123 HPLXPSPPPXSXXXXXPXPXXPPXLPPXPPXXXP 22 +P P PPP P P PP P PP P Sbjct: 746 NPPAPPPPPLMTGKKAPAPPPPPPQAPKPPGTVP 779 Score = 30.7 bits (66), Expect = 2.4 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -3 Query: 129 AXHPLXPSPPPXSXXXXXPXPXXPPXLPPXPP 34 A P P PPP S P PP PP PP Sbjct: 543 APPPPPPPPPPPSGNKPAFSPPPPPPPPPPPP 574 Score = 30.3 bits (65), Expect = 3.2 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = -3 Query: 129 AXHPLXPSPPPXSXXXXXPXPXXPPXLPPXPPXXXP 22 A P P PPP P PP PP PP P Sbjct: 541 AAAPPPPPPPPPPPSGNKPAFSPPPPPPPPPPPPLP 576 >07_03_0558 + 19461369-19462448 Length = 359 Score = 31.9 bits (69), Expect = 1.0 Identities = 15/26 (57%), Positives = 15/26 (57%) Frame = +1 Query: 25 GGXGGXGGXGGGGXGXGXXXXXGXGG 102 GG GG GG GGGG G G G GG Sbjct: 129 GGLGGGGGFGGGG-GGGLGGGGGHGG 153 Score = 31.1 bits (67), Expect = 1.8 Identities = 17/37 (45%), Positives = 17/37 (45%), Gaps = 3/37 (8%) Frame = +1 Query: 25 GGXGGXGGXGGG---GXGXGXXXXXGXGGXXXXEGMG 126 GG GG GG GGG G G G G GG G G Sbjct: 143 GGLGGGGGHGGGFGAGGGVGGGAGGGVGGGGGFGGGG 179 Score = 29.5 bits (63), Expect = 5.5 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +1 Query: 28 GXGGXGGXGGGGXGXGXXXXXGXGGXXXXEGMG 126 G GG GG GGGG G G G G+G Sbjct: 138 GGGGGGGLGGGGGHGGGFGAGGGVGGGAGGGVG 170 Score = 28.7 bits (61), Expect = 9.7 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = +2 Query: 35 GGXGGRXGGXXGWGXXXXXEXGGGXGXRG 121 GG GG GG G+G GGG G G Sbjct: 125 GGAGGGLGGGGGFGGGGGGGLGGGGGHGG 153 Score = 28.7 bits (61), Expect = 9.7 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = +2 Query: 23 GXXXGGXGGRXGGXXGWGXXXXXEXGGGXG 112 G GG GG GG G+G GGG G Sbjct: 159 GGVGGGAGGGVGGGGGFGGGGGGGLGGGHG 188 >03_01_0515 - 3864796-3865425 Length = 209 Score = 31.9 bits (69), Expect = 1.0 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = -3 Query: 117 LXPSPPPXSXXXXXPXPXXPPXLPPXPPXXXP 22 + P PPP S P P PP PP PP P Sbjct: 70 MPPPPPPPSVTSSPPPPPLPP--PPPPPAASP 99 Score = 31.5 bits (68), Expect = 1.4 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -3 Query: 129 AXHPLXPSPPPXSXXXXXPXPXXPPXLPPXPP 34 A PL P PPP P P PP PP PP Sbjct: 65 AAGPLMPPPPPPPSVTSSPPP--PPLPPPPPP 94 Score = 31.1 bits (67), Expect = 1.8 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = -2 Query: 100 PPLPXXXXPPXXXPPXPXPPXPXXXP 23 PPLP PP PP P P P P Sbjct: 86 PPLPPPPPPPAASPPPPPPSPPPPSP 111 Score = 30.7 bits (66), Expect = 2.4 Identities = 15/38 (39%), Positives = 16/38 (42%), Gaps = 5/38 (13%) Frame = -3 Query: 120 PLXPSPPPXSXXXXXPXPXXPP-----XLPPXPPXXXP 22 PL P PPP + P P PP PP PP P Sbjct: 87 PLPPPPPPPAASPPPPPPSPPPPSPVKSSPPPPPAWSP 124 Score = 28.7 bits (61), Expect = 9.7 Identities = 13/32 (40%), Positives = 15/32 (46%), Gaps = 3/32 (9%) Frame = -3 Query: 108 SPPPXSXXXXXPXPXXPPXL---PPXPPXXXP 22 SPPP + P P PP + PP PP P Sbjct: 60 SPPPPAAGPLMPPPPPPPSVTSSPPPPPLPPP 91 >02_05_0686 - 30900748-30902167,30903442-30904742 Length = 906 Score = 31.9 bits (69), Expect = 1.0 Identities = 14/34 (41%), Positives = 14/34 (41%), Gaps = 1/34 (2%) Frame = -3 Query: 120 PLXPSPPPXSXXXXXPXPXXPP-XLPPXPPXXXP 22 P P PPP P P PP PP PP P Sbjct: 311 PAPPPPPPPKPAAAAPPPPPPPKAAPPPPPPKGP 344 Score = 30.3 bits (65), Expect = 3.2 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = -3 Query: 120 PLXPSPPPXSXXXXXPXPXXPPXLPPXPP 34 P P PPP + P P P PP PP Sbjct: 341 PKGPPPPPPAKGPPPPPPPKGPSPPPPPP 369 Score = 29.5 bits (63), Expect = 5.5 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = -3 Query: 120 PLXPSPPPXSXXXXXPXPXXPPXLPPXPPXXXP 22 P +PPP P P P PP PP P Sbjct: 321 PAAAAPPPPPPPKAAPPPPPPKGPPPPPPAKGP 353 Score = 28.7 bits (61), Expect = 9.7 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = -3 Query: 111 PSPPPXSXXXXXPXPXXPPXLPPXPP 34 P PPP P P P PP PP Sbjct: 345 PPPPPAKGPPPPPPPKGPSPPPPPPP 370 >08_01_0539 + 4679392-4681282,4682060-4682104,4682403-4683560, 4683834-4684204,4684290-4684835,4684927-4685027, 4685117-4685933,4686025-4686213,4686313-4686384, 4686477-4686587,4686647-4686652,4686694-4686794, 4687714-4687813,4687891-4687986,4688157-4688273, 4688367-4688492,4688566-4688619,4688745-4688992, 4689087-4689195,4689284-4689583,4689799-4689963 Length = 2240 Score = 31.5 bits (68), Expect = 1.4 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -3 Query: 120 PLXPSPPPXSXXXXXPXPXXPPXLPPXP 37 PL P PPP P PP LPP P Sbjct: 429 PLPPPPPPPPPPPPPLPPNMPPPLPPPP 456 Score = 30.3 bits (65), Expect = 3.2 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = -3 Query: 120 PLXPSPPPXSXXXXXPXPXXPPXLPPXPPXXXP 22 P P PPP P P P PP PP P Sbjct: 426 PPPPLPPPPPPPPPPPPPLPPNMPPPLPPPPEP 458 Score = 29.5 bits (63), Expect = 5.5 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = -3 Query: 111 PSPPPXSXXXXXPXPXXPPXLPPXPPXXXP 22 P PPP P P PP P PP P Sbjct: 425 PPPPPLPPPPPPPPPPPPPLPPNMPPPLPP 454 >07_01_0516 - 3850252-3852870 Length = 872 Score = 31.5 bits (68), Expect = 1.4 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -3 Query: 117 LXPSPPPXSXXXXXPXPXXPPXLPPXPP 34 L P PPP S P P PP P PP Sbjct: 15 LPPQPPPTSRPLPPPPPPPPPAHGPSPP 42 >04_03_0098 + 11183039-11183752 Length = 237 Score = 31.5 bits (68), Expect = 1.4 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +1 Query: 25 GGXGGXGGXGGGGXGXGXXXXXGXGGXXXXEGMG 126 GG GG GG GGG G G G G G Sbjct: 164 GGGGGAGGGSGGGGASGGGSGTGRSGNAVGTGQG 197 >02_04_0400 - 22608519-22608844,22609044-22609122 Length = 134 Score = 31.5 bits (68), Expect = 1.4 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 23 GXXXGGXGGRXGGXXGWGXXXXXEXGGGXGXRG 121 G GG GGR GG G G GGG G G Sbjct: 55 GGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGGG 87 >01_06_1678 - 39095986-39096205,39096400-39096477,39096578-39096949, 39097374-39097671,39097867-39098077,39098331-39099023 Length = 623 Score = 31.5 bits (68), Expect = 1.4 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = -3 Query: 111 PSPPPXSXXXXXPXPXXPPXLPPXPP 34 P PPP P P PP PP PP Sbjct: 121 PPPPPHPPEDPPPHPPHPPDHPPPPP 146 >03_06_0365 - 33399422-33399925,33400470-33400583,33400762-33400929, 33401305-33401547,33402148-33402231,33402323-33403098, 33404423-33404636 Length = 700 Score = 31.1 bits (67), Expect = 1.8 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +1 Query: 25 GGXGGXGGXGGGGXGXGXXXXXGXGGXXXXEGMG 126 GG GG G GGGG G G G G G G Sbjct: 661 GGGGGGYGGGGGGYGGGGYGGGGGYGGGYGGGQG 694 >08_01_0202 - 1638978-1639571 Length = 197 Score = 30.3 bits (65), Expect = 3.2 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +2 Query: 23 GXXXGGXGGRXGGXXGWGXXXXXEXGGGXGXRG 121 G GG GGR GG G+G GG G G Sbjct: 90 GYGGGGGGGRYGGDRGYGGGGGGYGGGDRGYGG 122 Score = 29.5 bits (63), Expect = 5.5 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = +2 Query: 35 GGXGGRXGGXXGWGXXXXXEXGGGXGXR 118 GG GG GG G+G GGG G R Sbjct: 108 GGGGGYGGGDRGYGGGGGYGGGGGGGSR 135 >08_01_0059 - 394001-394708 Length = 235 Score = 30.3 bits (65), Expect = 3.2 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -3 Query: 120 PLXPSPPPXSXXXXXPXPXXPPXLPPXPPXXXP 22 P P PPP P P PP PP PP P Sbjct: 14 PATPPPPPRRA----PPPPSPPIRPPPPPTPRP 42 >04_04_0233 + 23801944-23802598,23802914-23803047,23803548-23803730, 23804145-23804318 Length = 381 Score = 30.3 bits (65), Expect = 3.2 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -3 Query: 120 PLXPSPPPXSXXXXXPXPXXPPXLPPXPP 34 P PSPPP S P PP P PP Sbjct: 10 PPTPSPPPFSSRPRVVGPPPPPPSDPPPP 38 >03_05_0576 + 25765137-25766420 Length = 427 Score = 30.3 bits (65), Expect = 3.2 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = -3 Query: 111 PSPPPXSXXXXXPXPXXPPXLPPXPP 34 PSP P P P PP PP PP Sbjct: 69 PSPSPSPSPSPPPQPSSPPPPPPSPP 94 >03_02_0071 + 5425722-5427154,5427259-5427464,5428445-5428686, 5428788-5429570 Length = 887 Score = 30.3 bits (65), Expect = 3.2 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = -3 Query: 111 PSPPPXSXXXXXPXPXXPPXLPPXPP 34 PSP P P P PP PP PP Sbjct: 338 PSPRPVQPSNAPPPPPPPPPPPPPPP 363 Score = 29.1 bits (62), Expect = 7.3 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = -3 Query: 120 PLXPSPPPXSXXXXXPXPXXPPXLPPXPP 34 P P PPP P P PP PP P Sbjct: 356 PPPPPPPPPPKLNTAPKPPPPPPPPPSVP 384 >10_03_0023 - 7151465-7152111,7152222-7152405 Length = 276 Score = 29.9 bits (64), Expect = 4.2 Identities = 14/30 (46%), Positives = 14/30 (46%), Gaps = 1/30 (3%) Frame = -3 Query: 120 PLXPSPPPXSXXXXX-PXPXXPPXLPPXPP 34 PL P PPP S P P P PP PP Sbjct: 215 PLTPQPPPSSLIPPVLPLPLLNPPPPPPPP 244 Score = 29.9 bits (64), Expect = 4.2 Identities = 11/26 (42%), Positives = 12/26 (46%) Frame = -3 Query: 111 PSPPPXSXXXXXPXPXXPPXLPPXPP 34 P PPP P P PP +P PP Sbjct: 238 PPPPPPPPSLLPPVPLLPPLIPGVPP 263 >09_06_0107 + 20907560-20908491,20908511-20908625,20908967-20909058, 20909293-20909556,20910714-20911494 Length = 727 Score = 29.9 bits (64), Expect = 4.2 Identities = 13/34 (38%), Positives = 15/34 (44%) Frame = -3 Query: 123 HPLXPSPPPXSXXXXXPXPXXPPXLPPXPPXXXP 22 H + +PPP P P PP PP PP P Sbjct: 67 HHVSAAPPPPQTPPSPPPPPPPP--PPPPPPLSP 98 >09_04_0506 - 18188785-18190599 Length = 604 Score = 29.9 bits (64), Expect = 4.2 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = -3 Query: 120 PLXPSPPPXSXXXXXPXPXXPPXLPPXPPXXXP 22 PL PPP PP LPP PP P Sbjct: 73 PLQAPPPPPQQQQQQQQLQAPPSLPPPPPQRQP 105 Score = 29.1 bits (62), Expect = 7.3 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +1 Query: 25 GGXGGXGGXGGGGXGXGXXXXXGXGGXXXXEGMG 126 G GG G GGGG G G G GMG Sbjct: 307 GNYGGGRGGGGGGPGGGGGGGGGGNWGRGGGGMG 340 >08_02_0796 - 21300251-21300373,21300846-21301721 Length = 332 Score = 29.9 bits (64), Expect = 4.2 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = -3 Query: 123 HPLXPSPPPXSXXXXXPXPXXPPXLPPXPP 34 H P PP P P PP PP PP Sbjct: 87 HRRLPEAPPSPPLLALPPPPPPPPPPPPPP 116 Score = 28.7 bits (61), Expect = 9.7 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = -2 Query: 100 PPLPXXXXPPXXXPPXPXPPXP 35 PPL PP PP P PP P Sbjct: 97 PPLLALPPPPPPPPPPPPPPQP 118 >08_01_0375 - 3307206-3307316,3307870-3307965,3308061-3308132, 3308247-3308315,3308427-3308513,3308753-3308858, 3309118-3309237,3309327-3309406,3309497-3309878, 3310746-3310814,3311460-3312202 Length = 644 Score = 29.9 bits (64), Expect = 4.2 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = -3 Query: 111 PSPPPXSXXXXXPXPXXPPXLPPXPPXXXP 22 P PPP P PP PP PP P Sbjct: 92 PPPPPPPYGVNSSQPPPPPPPPPSPPPSAP 121 Score = 29.5 bits (63), Expect = 5.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = -3 Query: 120 PLXPSPPPXSXXXXXPXPXXPPXLPPXP 37 P P PPP S P P PP P P Sbjct: 106 PPPPPPPPPSPPPSAPPPPPPPPTQPPP 133 >07_03_0559 + 19475893-19476783 Length = 296 Score = 29.9 bits (64), Expect = 4.2 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +1 Query: 28 GXGGXGGXGGGGXGXGXXXXXGXGGXXXXEGMG 126 G GG GG GGGG G GG G+G Sbjct: 88 GGGGGGGLGGGGCEGGGFGGGVGGGSGAGGGLG 120 Score = 29.5 bits (63), Expect = 5.5 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = +1 Query: 28 GXGGXGGXGGGGXGXGXXXXXGXGG 102 G GG GG GGGG G G G GG Sbjct: 162 GGGGGGGFGGGG-GGGIGGGGGKGG 185 >06_01_0194 + 1503350-1503554,1504399-1504490,1504835-1504935, 1506186-1506276,1506616-1506674,1506764-1506884, 1506959-1507027,1507321-1507373,1507688-1507796, 1507895-1508065,1508148-1508306,1508561-1508650, 1508751-1508933,1509837-1510027,1510340-1510787 Length = 713 Score = 29.9 bits (64), Expect = 4.2 Identities = 16/34 (47%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Frame = +2 Query: 23 GXXXGGXGGR-XGGXXGWGXXXXXEXGGGXGXRG 121 G GG GGR GG G G GGG G RG Sbjct: 670 GRGRGGGGGRGRGGGGGGGRGGGGGGGGGRGGRG 703 >06_01_0178 + 1386981-1387505 Length = 174 Score = 29.9 bits (64), Expect = 4.2 Identities = 15/42 (35%), Positives = 16/42 (38%) Frame = +3 Query: 24 GXXXGXGGXGXGGXXXGGXXXXGXGGXXXXRGDGXRXXXGGD 149 G G GG G G G G GG G G + GGD Sbjct: 93 GGGGGGGGKGRKGGRGGDGGSGGAGGRGGDGGSGGQGGRGGD 134 >05_04_0303 - 20010761-20011756 Length = 331 Score = 29.9 bits (64), Expect = 4.2 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +1 Query: 28 GXGGXGGXGGGGXGXGXXXXXGXGGXXXXEGMG 126 G GG GG GGG G G GG G+G Sbjct: 45 GGGGGGGVGGGVVGGDGVGGGGGGGGGGGGGVG 77 >03_03_0008 - 13674602-13674708,13675272-13675439,13676169-13676787, 13676868-13677330,13677855-13678036,13678093-13678235, 13678315-13678423,13679000-13679456,13680490-13682473, 13682507-13682626,13682920-13682971 Length = 1467 Score = 29.9 bits (64), Expect = 4.2 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = -3 Query: 123 HPLXPSPPPXSXXXXXPXPXXPPXLPPXPP 34 H L P P P P PP +PP PP Sbjct: 1112 HTLGPPLPDDRPPSPPPLPSSPPPVPPPPP 1141 >03_02_0514 + 9038606-9039790,9040211-9040432,9040548-9040655, 9041608-9041802,9041905-9042153,9042525-9042672, 9042673-9042779,9043311-9043475,9044506-9045948 Length = 1273 Score = 29.9 bits (64), Expect = 4.2 Identities = 15/35 (42%), Positives = 16/35 (45%), Gaps = 1/35 (2%) Frame = +2 Query: 23 GXXXGGXGGRXGG-XXGWGXXXXXEXGGGXGXRGW 124 G GG GG GG GWG GGG G G+ Sbjct: 89 GGFGGGAGGPLGGGGGGWGAGGGGGGGGGGGGGGF 123 >12_02_0299 - 17051570-17052474,17053542-17053755 Length = 372 Score = 29.5 bits (63), Expect = 5.5 Identities = 11/26 (42%), Positives = 12/26 (46%) Frame = -2 Query: 100 PPLPXXXXPPXXXPPXPXPPXPXXXP 23 PP+P PP P P PP P P Sbjct: 227 PPIPFLTPPPPPFLPFPLPPIPFLTP 252 Score = 29.5 bits (63), Expect = 5.5 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = -2 Query: 100 PPLPXXXXPPXXXPPXPXPPXPXXXP 23 P P PP PP P PP P P Sbjct: 273 PAFPFPHLPPIFSPPSPPPPPPPAFP 298 Score = 29.5 bits (63), Expect = 5.5 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = -2 Query: 100 PPLPXXXXPPXXXPPXPXPPXP 35 PPLP P PP P PP P Sbjct: 311 PPLPSFYPSPPPPPPPPPPPPP 332 Score = 28.7 bits (61), Expect = 9.7 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = -3 Query: 111 PSPPPXSXXXXXPXPXXPPXLPPXPPXXXP 22 PSPPP P P P PP P P Sbjct: 318 PSPPPPPPPPPPPPPSFPWPFPPLAPLFPP 347 >06_03_1326 - 29355467-29355817 Length = 116 Score = 29.5 bits (63), Expect = 5.5 Identities = 13/33 (39%), Positives = 15/33 (45%) Frame = +2 Query: 23 GXXXGGXGGRXGGXXGWGXXXXXEXGGGXGXRG 121 G GG GG+ GG G GGG G +G Sbjct: 14 GGGGGGGGGKGGGGGSGGGGRSGGGGGGGGGKG 46 >06_01_0145 + 1092764-1093351 Length = 195 Score = 29.5 bits (63), Expect = 5.5 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = +3 Query: 24 GXXXGXGGXGXGGXXXGGXXXXGXGGXXXXRGDGXRXXXGGD 149 G G GG G G G G GG GDG R GGD Sbjct: 132 GGCGGVGGRGRKGGRGGRGGRGGSGGFGG--GDGGRGGRGGD 171 Score = 28.7 bits (61), Expect = 9.7 Identities = 16/42 (38%), Positives = 17/42 (40%) Frame = +3 Query: 24 GXXXGXGGXGXGGXXXGGXXXXGXGGXXXXRGDGXRXXXGGD 149 G G GG G G GG G GG G+G GGD Sbjct: 144 GGRGGRGGRGGSGGFGGGDG--GRGGRGGDGGEGRGGGRGGD 183 >05_01_0028 + 182528-183852,183967-184127,184872-185116,185330-186073 Length = 824 Score = 29.5 bits (63), Expect = 5.5 Identities = 13/30 (43%), Positives = 15/30 (50%), Gaps = 1/30 (3%) Frame = -3 Query: 120 PLXPSPPPX-SXXXXXPXPXXPPXLPPXPP 34 PL P+PPP + P P PP P PP Sbjct: 94 PLLPTPPPPPASISPTPAPPLPPPPAPAPP 123 Score = 29.5 bits (63), Expect = 5.5 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = -3 Query: 111 PSPPPXSXXXXXPXPXXPPXLPPXPPXXXP 22 P PPP S P PP P PP P Sbjct: 99 PPPPPASISPTPAPPLPPPPAPAPPPTPTP 128 >04_04_0057 + 22410167-22411330 Length = 387 Score = 29.5 bits (63), Expect = 5.5 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = -3 Query: 120 PLXPSPPPXSXXXXXPXPXXPPXLPPXPPXXXP 22 P P PPP + P P P P PP P Sbjct: 181 PPPPPPPPPAAAAASPSPERSPRCQPSPPPPPP 213 >04_01_0069 - 697811-697876,697956-698166,698265-698359,698448-698513, 698595-698643,698720-698770,698856-698908,699263-699331, 699874-699928,700011-700099,700217-700302,700376-700432, 700575-700716,701637-702032 Length = 494 Score = 29.5 bits (63), Expect = 5.5 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = -3 Query: 111 PSPPPXSXXXXXPXPXXPPXLPPXPPXXXP 22 P PPP S P P P P PP P Sbjct: 70 PRPPPPSTTTAPPPPAAPAVTPARPPPQQP 99 >02_02_0140 + 7125914-7126264,7126426-7126677,7126766-7126861, 7127013-7127187,7127283-7127363,7127451-7127548, 7127828-7127920,7128607-7128678,7128998-7129117, 7129210-7129260,7130026-7130211,7130355-7130411 Length = 543 Score = 29.5 bits (63), Expect = 5.5 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -3 Query: 123 HPLXPSPPPXSXXXXXPXPXXPPXLPPXPPXXXP 22 H L PSPPP S P P PP PP P Sbjct: 20 HHLLPSPPPSS--SLLPPLLPSPPRPPSPPSPLP 51 >01_07_0021 - 40533864-40534583,40534779-40534814,40534909-40535048, 40535837-40535922,40536430-40536653,40536770-40536865, 40538766-40538833,40539945-40540055,40540799-40540955 Length = 545 Score = 29.5 bits (63), Expect = 5.5 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = -3 Query: 105 PPPXSXXXXXPXPXXPPXLPPXPP 34 PPP S P PP +PP PP Sbjct: 438 PPPESTSPPPPPTSDPPPVPPPPP 461 >09_04_0629 - 19098087-19098516,19099120-19099370 Length = 226 Score = 29.1 bits (62), Expect = 7.3 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +2 Query: 35 GGXGGRXGGXXGWGXXXXXEXGGGXGXRGWXA 130 GG R GG G GGG G +GW A Sbjct: 96 GGGDARPGGLQRRGTSAKKRGGGGGGAQGWEA 127 >09_02_0543 + 10427321-10428315,10428440-10429154 Length = 569 Score = 29.1 bits (62), Expect = 7.3 Identities = 11/33 (33%), Positives = 14/33 (42%) Frame = -3 Query: 120 PLXPSPPPXSXXXXXPXPXXPPXLPPXPPXXXP 22 P + PP + P P P +PP PP P Sbjct: 20 PAPQATPPPAIPESGPPPPPAPDMPPPPPTPAP 52 >08_01_0774 + 7482311-7482919,7484012-7484077,7484211-7484384, 7484473-7484603,7484726-7484802,7484981-7485064, 7487885-7488066,7488189-7488266,7489813-7489945, 7491610-7491670,7491861-7491942,7492143-7492271, 7492510-7492653,7493102-7493204,7493382-7493513, 7494127-7494485,7495149-7495229,7495384-7495450, 7495636-7495706,7496087-7496178,7496365-7496458, 7497692-7497789,7498206-7498341,7498599-7498618, 7498781-7498876,7498973-7499060,7499171-7499288, 7499738-7499759,7500203-7500326,7500625-7500702, 7500837-7500955,7501816-7501869,7502260-7502362, 7503133-7503261,7503345-7503453,7503788-7503819 Length = 1424 Score = 29.1 bits (62), Expect = 7.3 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = -2 Query: 100 PPLPXXXXPPXXXPPXPXPPXP 35 PPLP PP PP P P P Sbjct: 155 PPLPLPPPPPPPMPPIPLPHMP 176 >07_03_1155 - 24413270-24413728 Length = 152 Score = 29.1 bits (62), Expect = 7.3 Identities = 15/42 (35%), Positives = 15/42 (35%), Gaps = 1/42 (2%) Frame = -3 Query: 144 HXXXXAXH-PLXPSPPPXSXXXXXPXPXXPPXLPPXPPXXXP 22 H A H P P PP P P PP LP P P Sbjct: 30 HLEEKAPHFPAVPELPPHPELPELPKPELPPPLPELPRPVVP 71 >05_07_0236 - 28582157-28582552,28582639-28582911,28583324-28583560, 28583653-28583694,28583782-28583964,28584393-28584524, 28585605-28586057 Length = 571 Score = 29.1 bits (62), Expect = 7.3 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = -3 Query: 123 HPLXPSPPPXSXXXXXPXPXXPPXLPPXPPXXXP 22 HP P+ PP S P PP LPP P P Sbjct: 92 HPA-PTMPPPSSGSGHTLPSPPPPLPPLLPPPQP 124 >05_01_0210 + 1583176-1584177 Length = 333 Score = 29.1 bits (62), Expect = 7.3 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -3 Query: 123 HPLXPSPPPXSXXXXXPXPXXPPXLPPXPP 34 HPL SPP P P PP PP PP Sbjct: 16 HPLLASPP----HHFAPDPLPPPPPPPPPP 41 >04_04_0679 + 27214577-27215023 Length = 148 Score = 29.1 bits (62), Expect = 7.3 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +2 Query: 23 GXXXGGXGGRXGGXXGWGXXXXXEXGGGXGXRGWXA 130 G GG GGR G G GG G GW A Sbjct: 75 GGGGGGVGGRGGSSGRGGHGGGFGWAGGQGHGGWGA 110 >03_02_0155 - 5974118-5974173,5974242-5974314,5974393-5974500, 5975189-5976914,5977065-5977620,5978008-5978485 Length = 998 Score = 29.1 bits (62), Expect = 7.3 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = -3 Query: 120 PLXPSPPPXSXXXXXPXPXXPPXLPPXPPXXXP 22 P P PP + P PP PP PP P Sbjct: 71 PPPPRPPSFAPENALPPSSPPPPSPPPPPPSSP 103 >02_01_0275 - 1828300-1828344,1828396-1828531,1828623-1829317 Length = 291 Score = 29.1 bits (62), Expect = 7.3 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = -3 Query: 120 PLXPSPPPXSXXXXXPXPXXPPXLPPXPPXXXP 22 P P PPP P P P P PP P Sbjct: 108 PYRPPPPPRKKPQFQPPPQPPRAWDPSPPPPPP 140 >01_06_0146 + 26969011-26969995,26970878-26970930 Length = 345 Score = 29.1 bits (62), Expect = 7.3 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = -3 Query: 108 SPPPXSXXXXXPXPXXPPXLPPXPP 34 +PPP P PP LPP PP Sbjct: 102 APPPAPAPDQPAPPSPPPSLPPSPP 126 >10_08_0223 - 15986763-15987575 Length = 270 Score = 28.7 bits (61), Expect = 9.7 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +2 Query: 23 GXXXGGXGGRXGGXXGWGXXXXXEXGGGXGXRG 121 G GG GG G GWG G G G G Sbjct: 37 GGGGGGGGGGGGTNGGWGSGSGAGAGAGYGESG 69 >10_06_0039 - 9966744-9967535,9968241-9968482,9969021-9969223, 9969333-9970645 Length = 849 Score = 28.7 bits (61), Expect = 9.7 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = -3 Query: 120 PLXPSPPPXSXXXXXPXPXXPPXLPPXPPXXXP 22 P P PPP P PP PP P P Sbjct: 329 PAPPPPPPPPSRFNNTTPKPPPPPPPPEPPTGP 361 >10_02_0157 - 5954439-5954801,5956244-5956270,5956465-5956526, 5956971-5957592 Length = 357 Score = 28.7 bits (61), Expect = 9.7 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = -2 Query: 100 PPLPXXXXPPXXXPPXPXPPXP 35 PPLP PP PP PP P Sbjct: 63 PPLPPLTPPPAIVPPALPPPPP 84 >09_04_0081 - 14400293-14400397,14400953-14401036,14401144-14401214, 14401293-14401380,14401487-14401678,14401772-14402704 Length = 490 Score = 28.7 bits (61), Expect = 9.7 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = -3 Query: 111 PSPPPXSXXXXXPXPXXPPXLPPXPP 34 P PP P P PP PP PP Sbjct: 140 PPPPHVPKAAPPPPPPPPPHAPPGPP 165 >06_02_0126 + 12130409-12130532,12131015-12131373 Length = 160 Score = 28.7 bits (61), Expect = 9.7 Identities = 13/34 (38%), Positives = 15/34 (44%) Frame = +2 Query: 23 GXXXGGXGGRXGGXXGWGXXXXXEXGGGXGXRGW 124 G G GG GG G+G GGG G G+ Sbjct: 80 GYGGGNGGGYGGGYGGYGGGYGGGYGGGGGGGGY 113 >05_01_0004 - 34967-35149,35340-35501,36078-36225,36309-36385, 36507-36577,36850-37263,37518-38268 Length = 601 Score = 28.7 bits (61), Expect = 9.7 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = -2 Query: 100 PPLPXXXXPPXXXPPXPXPPXP 35 PPLP P PP P PP P Sbjct: 64 PPLPSATPPLAASPPPPPPPPP 85 >02_01_0163 + 1135592-1135623,1135718-1135816,1135904-1135960, 1136053-1136116,1136174-1136392,1138562-1138945 Length = 284 Score = 28.7 bits (61), Expect = 9.7 Identities = 12/34 (35%), Positives = 12/34 (35%) Frame = -3 Query: 123 HPLXPSPPPXSXXXXXPXPXXPPXLPPXPPXXXP 22 H P PP P P P PP PP P Sbjct: 161 HQQRPPPPRTRQVNPAPPPVPSPSAPPLPPQPPP 194 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,491,661 Number of Sequences: 37544 Number of extensions: 300814 Number of successful extensions: 4139 Number of sequences better than 10.0: 71 Number of HSP's better than 10.0 without gapping: 1068 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2916 length of database: 14,793,348 effective HSP length: 84 effective length of database: 11,639,652 effective search space used: 3701409336 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -