BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_FL5_K04 (840 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_02_0014 - 2977053-2977296,2977719-2978098 29 3.5 06_01_0328 + 2379610-2380359,2380479-2381108,2381222-2381764 29 4.6 >09_02_0014 - 2977053-2977296,2977719-2978098 Length = 207 Score = 29.5 bits (63), Expect = 3.5 Identities = 15/58 (25%), Positives = 30/58 (51%) Frame = +3 Query: 60 ENQRGKKTLIELDSSSGIVRRHERCSISGRSFRAIVAEKPLLXLFHYLLGWAESVRGR 233 E++RG T E+++ + + R +I R ++ ++PL+ +F L G A + R Sbjct: 59 EDRRGTVTTDEIETPNLLTRVEIEDTIIAREAELLIPKRPLILVFVVLFGSASTTTSR 116 >06_01_0328 + 2379610-2380359,2380479-2381108,2381222-2381764 Length = 640 Score = 29.1 bits (62), Expect = 4.6 Identities = 12/26 (46%), Positives = 15/26 (57%) Frame = -3 Query: 310 LNGDERXRHVTTLHAWNETPCARRYY 233 L+G TT AW ETPCA R++ Sbjct: 550 LDGGGGGGEKTTTEAWVETPCAHRFH 575 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,836,915 Number of Sequences: 37544 Number of extensions: 255277 Number of successful extensions: 545 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 538 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 545 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2326952232 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -