BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_FL5_J24 (984 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_02_1291 + 25930056-25930067,25930289-25930334,25930434-259305... 29 4.3 01_03_0088 + 12327339-12328092,12329474-12329601,12330249-123304... 29 7.5 >08_02_1291 + 25930056-25930067,25930289-25930334,25930434-25930546, 25930645-25930930,25931357-25931421,25931642-25931693, 25931774-25931883,25932611-25932641,25932853-25933004, 25934622-25934840 Length = 361 Score = 29.5 bits (63), Expect = 4.3 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = -1 Query: 225 HGGLGLTNVSMSQMQGQVDYDFGVGGRLPI 136 +GG L ++Q G Y +G GGRLP+ Sbjct: 100 YGGPALPRYGIAQFPGGSGYPYGYGGRLPM 129 >01_03_0088 + 12327339-12328092,12329474-12329601,12330249-12330474, 12332638-12332765,12332880-12333033,12333408-12333841 Length = 607 Score = 28.7 bits (61), Expect = 7.5 Identities = 15/37 (40%), Positives = 19/37 (51%), Gaps = 2/37 (5%) Frame = -3 Query: 388 SXXXRRCXQPPXPXTTSGLHPAFRXHQXKCC--SPIP 284 S RR QPP P T +G +PAFR + P+P Sbjct: 51 SNRRRRHDQPPNPTTGNGGNPAFRAPHLRTAYRKPVP 87 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,961,119 Number of Sequences: 37544 Number of extensions: 194209 Number of successful extensions: 365 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 357 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 365 length of database: 14,793,348 effective HSP length: 82 effective length of database: 11,714,740 effective search space used: 2870111300 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -