BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_FL5_J24 (984 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY705404-1|AAU12513.1| 406|Anopheles gambiae nicotinic acetylch... 29 0.28 DQ974163-1|ABJ52803.1| 595|Anopheles gambiae serpin 4B protein. 25 2.6 >AY705404-1|AAU12513.1| 406|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 9 protein. Length = 406 Score = 28.7 bits (61), Expect = 0.28 Identities = 11/42 (26%), Positives = 20/42 (47%) Frame = +1 Query: 169 VNLTLHLRHAHIRESESTVRILADLQMNWIDKXLIWXAGEWG 294 V + + H I E +ST+ + ++ +W D L W +G Sbjct: 65 VETGITITHVEINEIKSTLSVYGWMKFSWNDPKLTWNPASYG 106 >DQ974163-1|ABJ52803.1| 595|Anopheles gambiae serpin 4B protein. Length = 595 Score = 25.4 bits (53), Expect = 2.6 Identities = 12/25 (48%), Positives = 14/25 (56%) Frame = +3 Query: 105 LMIDSLLXNVRSGVSPRLQNRSQPD 179 L + SL RS +SP L SQPD Sbjct: 360 LGVSSLFQAERSNLSPMLNEESQPD 384 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 445,988 Number of Sequences: 2352 Number of extensions: 6157 Number of successful extensions: 14 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 563,979 effective HSP length: 65 effective length of database: 411,099 effective search space used: 107707938 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -