SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BmNP01_FL5_J23
         (931 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At5g58160.1 68418.m07280 formin homology 2 domain-containing pro...    27   0.99 
At4g09360.1 68417.m01545 disease resistance protein (NBS-LRR cla...    30   2.5  
At4g13340.1 68417.m02084 leucine-rich repeat family protein / ex...    25   8.2  

>At5g58160.1 68418.m07280 formin homology 2 domain-containing
           protein / FH2 domain-containing protein low similarity
           to SP|Q05858 Formin (Limb deformity protein) {Gallus
           gallus}; contains Pfam profile PF02181: Formin Homology
           2(FH2) Domain
          Length = 1307

 Score = 26.6 bits (56), Expect(2) = 0.99
 Identities = 9/13 (69%), Positives = 9/13 (69%)
 Frame = +1

Query: 736 PPPSPPPXXPXAP 774
           PPP PPP  P AP
Sbjct: 727 PPPPPPPPPPPAP 739



 Score = 23.0 bits (47), Expect(2) = 0.99
 Identities = 8/21 (38%), Positives = 10/21 (47%)
 Frame = +1

Query: 694 PXVGXSXDQXXXAXPPPSPPP 756
           P +  S  +     PPP PPP
Sbjct: 675 PPISNSDKKPALPRPPPPPPP 695


>At4g09360.1 68417.m01545 disease resistance protein (NBS-LRR
           class), putative domain signature NBS-LRR exists,
           suggestive of a disease resistance protein.
          Length = 853

 Score = 29.9 bits (64), Expect = 2.5
 Identities = 23/72 (31%), Positives = 31/72 (43%)
 Frame = +2

Query: 41  HKMSTTYIILLPFLLTCAIASAAECENATSLSLMIDSLLATYDRDSPPDSKIVVNLTLHL 220
           H  ST   +  P LL+ A      CE +  L     S    YD +   D  I +NLT +L
Sbjct: 718 HGTSTKISLFTPTLLSFAACILISCERSFYLQFPAFS----YDWNRKDDEVISINLTPNL 773

Query: 221 RHANIRESESTV 256
             ++  E E TV
Sbjct: 774 NLSSEIEEEETV 785


>At4g13340.1 68417.m02084 leucine-rich repeat family protein /
           extensin family protein similar to extensin-like protein
           [Lycopersicon esculentum] gi|5917664|gb|AAD55979;
           contains leucine-rich repeats, Pfam:PF00560; contains
           proline rich extensin domains, INTERPRO:IPR002965
          Length = 760

 Score = 24.6 bits (51), Expect(2) = 8.2
 Identities = 8/10 (80%), Positives = 8/10 (80%)
 Frame = +1

Query: 736 PPPSPPPXXP 765
           PPPSPPP  P
Sbjct: 483 PPPSPPPPPP 492



 Score = 21.8 bits (44), Expect(2) = 8.2
 Identities = 7/12 (58%), Positives = 7/12 (58%)
 Frame = +1

Query: 739 PPSPPPXXPXAP 774
           PP PPP  P  P
Sbjct: 497 PPPPPPPPPPPP 508


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 15,511,178
Number of Sequences: 28952
Number of extensions: 320961
Number of successful extensions: 1983
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 1129
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1762
length of database: 12,070,560
effective HSP length: 81
effective length of database: 9,725,448
effective search space used: 2217402144
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -