BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_FL5_J21 (859 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY703685-1|AAU12681.1| 200|Apis mellifera abdominal-A protein. 24 1.6 >AY703685-1|AAU12681.1| 200|Apis mellifera abdominal-A protein. Length = 200 Score = 24.2 bits (50), Expect = 1.6 Identities = 15/79 (18%), Positives = 34/79 (43%), Gaps = 1/79 (1%) Frame = -1 Query: 508 CPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHAG-VLNGDERFRHVTTLH 332 C +P S+ + L+ + + + Q NSP + P H+G + R ++++ Sbjct: 30 CTTSPATASLESSLSAAAVAAAAVNYAQQHNSPSPTGSSPQHSGSSASTSPAARTTSSMY 89 Query: 331 AWNETPCARRYYRPRTASA 275 + A +++ + A A Sbjct: 90 PYVSAAAAHHHHQQQQAVA 108 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 186,088 Number of Sequences: 438 Number of extensions: 3764 Number of successful extensions: 5 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 27673956 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -