BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_FL5_J14 (853 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_24443| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 1.0 SB_31409| Best HMM Match : Drf_FH1 (HMM E-Value=1.3) 29 4.8 >SB_24443| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 27.5 bits (58), Expect(2) = 1.0 Identities = 10/34 (29%), Positives = 16/34 (47%) Frame = -3 Query: 581 VSELPTRHDRSIIAIEVSLEICTCLNFLQ*LVTC 480 V+ P H +I + +CTC N Q ++ C Sbjct: 94 VNTRPNVHQNDVIVVNTRPNVCTCNNSCQQMLLC 127 Score = 22.6 bits (46), Expect(2) = 1.0 Identities = 8/22 (36%), Positives = 14/22 (63%) Frame = -3 Query: 419 QNVRCDDFFVTQIFHRGNRDVI 354 Q + C ++FVT I H ++V+ Sbjct: 123 QMLLCSEWFVTPILHNSLQNVV 144 >SB_31409| Best HMM Match : Drf_FH1 (HMM E-Value=1.3) Length = 391 Score = 29.1 bits (62), Expect = 4.8 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = -1 Query: 631 VLVPYNSSSSHWLKNDSCRNYPLVMTDPLLRSKFH 527 +L+P N +S + D CR + L DP S++H Sbjct: 198 ILLPKNRTSLERRRGDICRRHELERCDPRRSSRYH 232 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 25,672,813 Number of Sequences: 59808 Number of extensions: 524473 Number of successful extensions: 1114 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1053 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1113 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2419355818 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -