BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_FL5_J14 (853 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC077727-1|AAH77727.1| 541|Homo sapiens DKFZP564J0863 protein p... 32 3.0 AK023383-1|BAB14552.1| 541|Homo sapiens protein ( Homo sapiens ... 32 3.0 BC053508-1|AAH53508.1| 412|Homo sapiens ARL6IP2 protein protein. 31 7.0 AK026946-1|BAB15598.1| 579|Homo sapiens protein ( Homo sapiens ... 31 7.0 AF449187-2|AAM97341.1| 579|Homo sapiens ARL6IP2 protein. 31 7.0 AF449187-1|AAM97342.1| 583|Homo sapiens ARL6IP2 protein. 31 7.0 AC016995-1|AAX88950.1| 579|Homo sapiens unknown protein. 31 7.0 >BC077727-1|AAH77727.1| 541|Homo sapiens DKFZP564J0863 protein protein. Length = 541 Score = 31.9 bits (69), Expect = 3.0 Identities = 19/58 (32%), Positives = 30/58 (51%), Gaps = 3/58 (5%) Frame = -3 Query: 479 CISVSKRHVMTSTVKLGNMSQNVRCDDFFVTQIFHRGNR---DVITRLTYAAFTFLWR 315 C ++ MTS+V++ N+SQN++ DD Q+F R D I + + FL R Sbjct: 156 CATIFALSTMTSSVQIYNLSQNIQEDDLQQLQLFTEYGRLAMDEIFQKPFQTLMFLVR 213 >AK023383-1|BAB14552.1| 541|Homo sapiens protein ( Homo sapiens cDNA FLJ13321 fis, clone OVARC1001703, weakly similar to Mus musculus ARL-6 interacting protein-2 (Aip-2) mRNA. ). Length = 541 Score = 31.9 bits (69), Expect = 3.0 Identities = 19/58 (32%), Positives = 30/58 (51%), Gaps = 3/58 (5%) Frame = -3 Query: 479 CISVSKRHVMTSTVKLGNMSQNVRCDDFFVTQIFHRGNR---DVITRLTYAAFTFLWR 315 C ++ MTS+V++ N+SQN++ DD Q+F R D I + + FL R Sbjct: 156 CATIFALSTMTSSVQIYNLSQNIQEDDLQQLQLFTEYGRLAMDEIFQKPFQTLMFLVR 213 >BC053508-1|AAH53508.1| 412|Homo sapiens ARL6IP2 protein protein. Length = 412 Score = 30.7 bits (66), Expect = 7.0 Identities = 14/34 (41%), Positives = 22/34 (64%) Frame = -3 Query: 479 CISVSKRHVMTSTVKLGNMSQNVRCDDFFVTQIF 378 C +V MTS+V++ N+SQN++ DD Q+F Sbjct: 16 CATVFALSTMTSSVQVYNLSQNIQEDDLQHLQLF 49 >AK026946-1|BAB15598.1| 579|Homo sapiens protein ( Homo sapiens cDNA: FLJ23293 fis, clone HEP10514. ). Length = 579 Score = 30.7 bits (66), Expect = 7.0 Identities = 14/34 (41%), Positives = 22/34 (64%) Frame = -3 Query: 479 CISVSKRHVMTSTVKLGNMSQNVRCDDFFVTQIF 378 C +V MTS+V++ N+SQN++ DD Q+F Sbjct: 187 CATVFALSTMTSSVQVYNLSQNIQEDDLQHLQLF 220 >AF449187-2|AAM97341.1| 579|Homo sapiens ARL6IP2 protein. Length = 579 Score = 30.7 bits (66), Expect = 7.0 Identities = 14/34 (41%), Positives = 22/34 (64%) Frame = -3 Query: 479 CISVSKRHVMTSTVKLGNMSQNVRCDDFFVTQIF 378 C +V MTS+V++ N+SQN++ DD Q+F Sbjct: 187 CATVFALSTMTSSVQVYNLSQNIQEDDLQHLQLF 220 >AF449187-1|AAM97342.1| 583|Homo sapiens ARL6IP2 protein. Length = 583 Score = 30.7 bits (66), Expect = 7.0 Identities = 14/34 (41%), Positives = 22/34 (64%) Frame = -3 Query: 479 CISVSKRHVMTSTVKLGNMSQNVRCDDFFVTQIF 378 C +V MTS+V++ N+SQN++ DD Q+F Sbjct: 187 CATVFALSTMTSSVQVYNLSQNIQEDDLQHLQLF 220 >AC016995-1|AAX88950.1| 579|Homo sapiens unknown protein. Length = 579 Score = 30.7 bits (66), Expect = 7.0 Identities = 14/34 (41%), Positives = 22/34 (64%) Frame = -3 Query: 479 CISVSKRHVMTSTVKLGNMSQNVRCDDFFVTQIF 378 C +V MTS+V++ N+SQN++ DD Q+F Sbjct: 187 CATVFALSTMTSSVQVYNLSQNIQEDDLQHLQLF 220 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 117,622,321 Number of Sequences: 237096 Number of extensions: 2513830 Number of successful extensions: 12083 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 11955 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12083 length of database: 76,859,062 effective HSP length: 89 effective length of database: 55,757,518 effective search space used: 10816958492 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -