BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_FL5_J13 (840 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_08_0106 + 14842748-14843085,14843122-14843250,14844145-148442... 31 1.1 12_02_0667 + 21682386-21682944,21683042-21683201,21683419-216834... 30 2.0 04_04_1385 - 33157557-33157655,33157752-33158201,33158864-331590... 30 2.0 04_04_1128 + 31103582-31103709,31105231-31105344,31105906-311064... 29 3.5 04_04_0233 + 23801944-23802598,23802914-23803047,23803548-238037... 29 4.6 03_05_0431 + 24221881-24224586 29 6.1 10_08_0683 - 19860777-19861070,19861677-19861874,19862498-198626... 28 8.1 >10_08_0106 + 14842748-14843085,14843122-14843250,14844145-14844211, 14847177-14847324,14847998-14848097,14848306-14848384, 14848527-14848687,14848829-14848908,14849319-14849475, 14849575-14849723,14849909-14850076,14850426-14850719, 14851002-14851046,14851213-14851462,14851707-14851835, 14852799-14853039,14853977-14854642 Length = 1066 Score = 31.1 bits (67), Expect = 1.1 Identities = 17/47 (36%), Positives = 26/47 (55%) Frame = +3 Query: 261 SSATPDRSSHPGTVVPEVANRHQPHEKRSGALQKGSPSEHHFEHPTP 401 SS DRS+ P P+ +R PH + SG+ +K S S+ + + P P Sbjct: 849 SSQPADRSAPPPPASPDRHSRRSPH-RSSGSGKKRSSSDRYDDLPLP 894 >12_02_0667 + 21682386-21682944,21683042-21683201,21683419-21683467, 21683570-21683683,21683794-21684294,21684594-21684980, 21685074-21685172,21685380-21685478,21685817-21685890, 21686387-21687023 Length = 892 Score = 30.3 bits (65), Expect = 2.0 Identities = 14/36 (38%), Positives = 21/36 (58%), Gaps = 3/36 (8%) Frame = -1 Query: 450 AKESDGTNGGGVCAPTTEW---DARSDVRRATPFEE 352 ++E G GGG P ++ D+RS RR+T F+E Sbjct: 3 SREESGNGGGGGATPAADYRSSDSRSSSRRSTRFKE 38 >04_04_1385 - 33157557-33157655,33157752-33158201,33158864-33159004, 33159058-33159329,33160371-33160821 Length = 470 Score = 30.3 bits (65), Expect = 2.0 Identities = 17/62 (27%), Positives = 27/62 (43%) Frame = -3 Query: 691 GAGCVSEHYACIRHDRGVCKFCRELPYCGGTVCFDYKALDRVVLE*TRRGRVPFLYGDGM 512 GA C +HY+C H+ +C + KAL R + + + FL+G+G Sbjct: 411 GATCCDDHYSCCPHEYPICNVQQGTCLMAKDSPLAVKALKRTL----AKPNLSFLFGNGK 466 Query: 511 SS 506 S Sbjct: 467 KS 468 >04_04_1128 + 31103582-31103709,31105231-31105344,31105906-31106446, 31106911-31107003,31107041-31107194,31107296-31107498 Length = 410 Score = 29.5 bits (63), Expect = 3.5 Identities = 18/47 (38%), Positives = 24/47 (51%), Gaps = 2/47 (4%) Frame = -3 Query: 703 GFQVGAGCVSEHYACIRHDRGVCKFCRE--LPYCGGTVCFDYKALDR 569 G +VG GC+ C G C+ CR+ YC G V F Y ++DR Sbjct: 101 GDEVGVGCMVN--TC-----GGCESCRDGCENYCSGGVVFTYNSVDR 140 >04_04_0233 + 23801944-23802598,23802914-23803047,23803548-23803730, 23804145-23804318 Length = 381 Score = 29.1 bits (62), Expect = 4.6 Identities = 18/49 (36%), Positives = 23/49 (46%), Gaps = 4/49 (8%) Frame = +1 Query: 235 YSCRKMSLLHRRLQIA----VATLGQWFRKWRIDINPTKSAAVLFKRGR 369 +S L+HR L A VA + R WR + P + AA L RGR Sbjct: 89 FSALPPELVHRALAAAGASDVAAASRACRAWRDALRPLREAAALHARGR 137 >03_05_0431 + 24221881-24224586 Length = 901 Score = 28.7 bits (61), Expect = 6.1 Identities = 14/33 (42%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Frame = -2 Query: 548 ARSRTVFIWG-RNVIPLSRVTPRYLTFETHGMG 453 AR+RTVF WG +V + + PR + F++ G G Sbjct: 175 ARNRTVFCWGDESVSGVIGLAPRNVRFQSIGAG 207 >10_08_0683 - 19860777-19861070,19861677-19861874,19862498-19862659, 19862763-19862911,19863089-19863236,19863317-19863385, 19863471-19863719,19863937-19864131,19864444-19864560, 19864978-19866537 Length = 1046 Score = 28.3 bits (60), Expect = 8.1 Identities = 14/44 (31%), Positives = 18/44 (40%) Frame = +3 Query: 270 TPDRSSHPGTVVPEVANRHQPHEKRSGALQKGSPSEHHFEHPTP 401 +P RS H P + QP+ S LQ P H +P P Sbjct: 45 SPSRSFHGYPSAPPPQPQPQPYAHHSAPLQPYPPPPQHHAYPPP 88 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,323,896 Number of Sequences: 37544 Number of extensions: 568716 Number of successful extensions: 1437 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1380 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1435 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2326952232 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -