BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_FL5_J12 (890 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF592538-1|ABQ95984.1| 582|Tribolium castaneum beta-N-acetylglu... 25 0.80 AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. 23 3.2 AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. 23 4.3 >EF592538-1|ABQ95984.1| 582|Tribolium castaneum beta-N-acetylglucosaminidase NAG3 protein. Length = 582 Score = 25.0 bits (52), Expect = 0.80 Identities = 14/69 (20%), Positives = 27/69 (39%), Gaps = 1/69 (1%) Frame = +3 Query: 177 GYKAGMTHVVREPDRPGSKINKKEIVEAVTIIETPPMVCVGVVGYIETPHGLRAL-LTVW 353 G K + ++ +P+ K+N E E + V + + HGL L +W Sbjct: 135 GIKLSINIILSDPNTNKLKLNTNESYELTVLKSDSLAVRLSAANFFGARHGLETLNQLIW 194 Query: 354 AEHMSEDCR 380 + + + R Sbjct: 195 FDEVVNELR 203 >AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. Length = 712 Score = 23.0 bits (47), Expect = 3.2 Identities = 13/37 (35%), Positives = 18/37 (48%) Frame = +3 Query: 147 SKPVHLTAFIGYKAGMTHVVREPDRPGSKINKKEIVE 257 S P HL GY + + R PD+ KIN K ++ Sbjct: 594 SHPFHLH---GYAFNVVGIGRSPDQNVKKINLKHALD 627 >AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. Length = 717 Score = 22.6 bits (46), Expect = 4.3 Identities = 13/37 (35%), Positives = 18/37 (48%) Frame = +3 Query: 147 SKPVHLTAFIGYKAGMTHVVREPDRPGSKINKKEIVE 257 S P HL GY + + R PD+ KIN K ++ Sbjct: 594 SHPFHLH---GYAFNVIGIGRSPDQNVKKINLKHALD 627 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 155,102 Number of Sequences: 336 Number of extensions: 2989 Number of successful extensions: 5 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 24720487 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -