BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_FL5_J12 (890 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ438610-5|CAD27477.1| 135|Anopheles gambiae hypothetical prote... 25 2.3 AF444783-1|AAL37904.1| 1356|Anopheles gambiae Trex protein. 23 9.4 AB090819-2|BAC57914.1| 1022|Anopheles gambiae reverse transcript... 23 9.4 >AJ438610-5|CAD27477.1| 135|Anopheles gambiae hypothetical protein protein. Length = 135 Score = 25.4 bits (53), Expect = 2.3 Identities = 16/61 (26%), Positives = 30/61 (49%), Gaps = 1/61 (1%) Frame = -1 Query: 218 VRFSNHVGHTGLITDKS-SQMNRFARVVFRERLDLTTMTTGPLFGIESHRPMXRVLKIFC 42 VR G +G ++ + + + F+ + +++ D+T TT F +R +L IFC Sbjct: 59 VRVRQLAGCSGYVSPRGGTNSDDFSPYIKQDKKDITFSTTQDNFPTPHNRITIVLLPIFC 118 Query: 41 A 39 A Sbjct: 119 A 119 >AF444783-1|AAL37904.1| 1356|Anopheles gambiae Trex protein. Length = 1356 Score = 23.4 bits (48), Expect = 9.4 Identities = 10/25 (40%), Positives = 13/25 (52%) Frame = +2 Query: 302 CWIH*DPSWTTRSVDCLGGAYV*RL 376 C + D SW++ VDC Y RL Sbjct: 762 CTCYHDQSWSSNVVDCSRAGYDDRL 786 >AB090819-2|BAC57914.1| 1022|Anopheles gambiae reverse transcriptase protein. Length = 1022 Score = 23.4 bits (48), Expect = 9.4 Identities = 7/19 (36%), Positives = 13/19 (68%) Frame = +3 Query: 327 GLRALLTVWAEHMSEDCRR 383 G+R ++WAE + +CR+ Sbjct: 770 GIRYASSIWAESLKFECRK 788 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 669,969 Number of Sequences: 2352 Number of extensions: 13477 Number of successful extensions: 12 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 95920632 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -