BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_FL5_J09 (855 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY584475-1|AAS93634.1| 209|Tribolium castaneum homothorax protein. 25 0.58 AJ518941-1|CAD57735.1| 456|Tribolium castaneum homothorax protein. 25 0.58 DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 23 4.1 AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor ... 23 4.1 U09586-3|AAC47272.1| 470|Tribolium castaneum integrase protein. 21 9.4 AF228509-1|AAF69136.1| 325|Tribolium castaneum prothoraxless pr... 21 9.4 >AY584475-1|AAS93634.1| 209|Tribolium castaneum homothorax protein. Length = 209 Score = 25.4 bits (53), Expect = 0.58 Identities = 17/45 (37%), Positives = 22/45 (48%) Frame = +3 Query: 39 RSDIESRERVPGPVTSQPESRKAPPSPRLLFSLYINDIPRSPXDP 173 RS+ +S G S P+ R PPS L + +ND RSP P Sbjct: 55 RSNADSTSHTDG--ASTPDVR--PPSSSLSYGGPVNDDVRSPGTP 95 >AJ518941-1|CAD57735.1| 456|Tribolium castaneum homothorax protein. Length = 456 Score = 25.4 bits (53), Expect = 0.58 Identities = 17/45 (37%), Positives = 22/45 (48%) Frame = +3 Query: 39 RSDIESRERVPGPVTSQPESRKAPPSPRLLFSLYINDIPRSPXDP 173 RS+ +S G S P+ R PPS L + +ND RSP P Sbjct: 211 RSNADSTSHTDG--ASTPDVR--PPSSSLSYGGPVNDDVRSPGTP 251 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 22.6 bits (46), Expect = 4.1 Identities = 15/56 (26%), Positives = 24/56 (42%), Gaps = 3/56 (5%) Frame = +1 Query: 250 TAATTMGQWFRKWRIDINPTKSTAVLFKRGRPPNTTL---SIPLPTRRVNNPAPAV 408 TAATT+G+ ++ ++P+ S TT + LP V P P + Sbjct: 1283 TAATTIGEGQPSKKVTVSPSASVPAKIASFDDTFTTTYKEDVTLPCLAVGLPPPVI 1338 >AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor protein protein. Length = 585 Score = 22.6 bits (46), Expect = 4.1 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = -1 Query: 303 VNVDAPLPEPLSHGGSC 253 +NVD P P +GG+C Sbjct: 221 LNVDDCKPNPCQNGGTC 237 >U09586-3|AAC47272.1| 470|Tribolium castaneum integrase protein. Length = 470 Score = 21.4 bits (43), Expect = 9.4 Identities = 9/30 (30%), Positives = 16/30 (53%) Frame = +1 Query: 538 LGRLYPMICRRSKMSLRNKVTLYKTCIRPV 627 LGR++ CR + S N ++ + C+ V Sbjct: 304 LGRIFRAYCRENHASWVNHLSNIEDCLNYV 333 >AF228509-1|AAF69136.1| 325|Tribolium castaneum prothoraxless protein. Length = 325 Score = 21.4 bits (43), Expect = 9.4 Identities = 11/51 (21%), Positives = 22/51 (43%) Frame = +2 Query: 287 GASTLTPRKAQRCSSKGVALRTPR*ASLSRLGASITPPPPFAQSRCSTSPY 439 GA+ P+ +R +++ + TPR A+ P + ++ PY Sbjct: 31 GAAVQVPQGGRRRAARPGVVTTPRWGCARASSATTMGGPRYGRAAAQGMPY 81 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 187,955 Number of Sequences: 336 Number of extensions: 4439 Number of successful extensions: 11 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 23659332 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -