BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_FL5_J06 (888 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY928182-1|AAX22219.1| 335|Anopheles gambiae phenoloxidase inhi... 24 5.4 AF281078-2|AAF82132.1| 755|Anopheles gambiae vitellogenin 2 pro... 23 9.4 AF281078-1|AAF82131.1| 2051|Anopheles gambiae vitellogenin 1 pro... 23 9.4 >AY928182-1|AAX22219.1| 335|Anopheles gambiae phenoloxidase inhibitor protein protein. Length = 335 Score = 24.2 bits (50), Expect = 5.4 Identities = 17/65 (26%), Positives = 27/65 (41%), Gaps = 1/65 (1%) Frame = +3 Query: 93 CSPSTRKMSPKCLLQPPILGQNHVNFQMETYSLQTTC*WYPCDQLASYLGKTCS-GCSCC 269 CS S S KC+ P + ++ ++ + T + D AS KTC+ C Sbjct: 42 CSGSCLSFSYKCVPVPASASEGFISVPVKPVPIDTANRFGADDGGASLTQKTCALNGEYC 101 Query: 270 RSHRE 284 +H E Sbjct: 102 LTHME 106 >AF281078-2|AAF82132.1| 755|Anopheles gambiae vitellogenin 2 protein. Length = 755 Score = 23.4 bits (48), Expect = 9.4 Identities = 17/63 (26%), Positives = 27/63 (42%), Gaps = 1/63 (1%) Frame = -1 Query: 336 YSTLTEGP**DDEHISGVLDGYDSTSSQNKFF-PGTTQVDHMGTISTSFVENRSPSGS*H 160 Y EGP D + ++ Y+ +N F P D + S+S ++ S S S Sbjct: 325 YDKYPEGPADDRQVFVDLVYSYNMAHDKNNFVRPANETDDSSSSSSSSSSDSDSDSSSSS 384 Query: 159 DSA 151 DS+ Sbjct: 385 DSS 387 >AF281078-1|AAF82131.1| 2051|Anopheles gambiae vitellogenin 1 protein. Length = 2051 Score = 23.4 bits (48), Expect = 9.4 Identities = 17/63 (26%), Positives = 27/63 (42%), Gaps = 1/63 (1%) Frame = -1 Query: 336 YSTLTEGP**DDEHISGVLDGYDSTSSQNKFF-PGTTQVDHMGTISTSFVENRSPSGS*H 160 Y EGP D + ++ Y+ +N F P D + S+S ++ S S S Sbjct: 325 YDKYPEGPADDRQVFVDLVYSYNMAHDKNNFVRPANETDDSSSSSSSSSSDSDSDSSSSS 384 Query: 159 DSA 151 DS+ Sbjct: 385 DSS 387 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 724,211 Number of Sequences: 2352 Number of extensions: 16245 Number of successful extensions: 46 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 46 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 46 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 95507181 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -