BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_FL5_J04 (874 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_42548| Best HMM Match : DNA_binding_1 (HMM E-Value=5.2) 48 8e-06 SB_8782| Best HMM Match : CN_hydrolase (HMM E-Value=0) 48 8e-06 SB_19326| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_11184| Best HMM Match : CN_hydrolase (HMM E-Value=4.4e-10) 40 0.003 SB_34841| Best HMM Match : ResIII (HMM E-Value=1.6) 31 1.2 SB_33872| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.8 SB_27173| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.8 SB_8338| Best HMM Match : PA (HMM E-Value=5.7e-10) 29 3.8 SB_24587| Best HMM Match : ResIII (HMM E-Value=0.82) 29 5.0 SB_47836| Best HMM Match : F5_F8_type_C (HMM E-Value=0.022) 29 6.6 SB_4447| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.6 SB_58044| Best HMM Match : Vitellogenin_N (HMM E-Value=0.022) 29 6.6 SB_33687| Best HMM Match : Filament (HMM E-Value=0.1) 28 8.7 SB_15536| Best HMM Match : MdcD (HMM E-Value=3.9) 28 8.7 >SB_42548| Best HMM Match : DNA_binding_1 (HMM E-Value=5.2) Length = 101 Score = 48.4 bits (110), Expect = 8e-06 Identities = 26/92 (28%), Positives = 44/92 (47%) Frame = +1 Query: 55 MENETHSLESIINNNLTGRDLEEFNRIHFGRRNNLEIKLKESSIXXXXXXXXXXXXXXFP 234 M E SL + NL DL+E RI +G + ++ L +++ Sbjct: 1 MAAEFESLNKTLEKNLPAEDLKEVKRILYGNPVS-DLSLPAAAVSVAAELDFELAGYKID 59 Query: 235 AKDEQTRPPRIVKVGIIQHSIAVPTDRPVNEQ 330 A E+ R PR+V++G +Q+ I PT+ P+ +Q Sbjct: 60 AAAEELRQPRLVRIGAVQNKIVEPTNMPIAKQ 91 >SB_8782| Best HMM Match : CN_hydrolase (HMM E-Value=0) Length = 242 Score = 48.4 bits (110), Expect = 8e-06 Identities = 47/170 (27%), Positives = 78/170 (45%), Gaps = 6/170 (3%) Frame = +1 Query: 265 IVKVGIIQHSIAVPTDRPVNEQKKAIFNKVKKIIDVAGQEGVNIICFQELWNMPFAFCTR 444 + ++G++Q +AV ++ N Q+ K+K+ + G I+ E +N P+ Sbjct: 5 VFRIGLVQ--LAVTANKLQNLQRAR--EKIKEAVAA----GAKIVALPECFNSPYG---- 52 Query: 445 EKQPWCEFAESAEDGPTTTFLRELAIRYAMVIVS-SILERDEKHSDILWNTAVVISDTGN 621 Q + ++AE G ++ L E+A IV SI ER L+NT++ +GN Sbjct: 53 -TQYFKDYAEEIP-GESSNMLAEVAKETGAYIVGGSIPERASNRK--LYNTSLSYDPSGN 108 Query: 622 VIGKHRKNH-----IPRVGDFNESNYYMEGNTGHPVFAXRYGKIAVXICF 756 ++GKHRK H +P F ES G + Y KI + IC+ Sbjct: 109 LMGKHRKIHLFDIDVPGKIRFQESEVLSPGE-NLTILDTEYCKIGIGICY 157 >SB_19326| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 40.7 bits (91), Expect = 0.002 Identities = 37/130 (28%), Positives = 64/130 (49%), Gaps = 1/130 (0%) Frame = +1 Query: 256 PPRIVKVGIIQHSIAVPTDRPVNEQKKAIFNKVKKIIDVAGQEGVNIICFQELWNMPFAF 435 P + ++G++Q +AV ++ N Q+ K+K+ + G I+ E +N P+ Sbjct: 4 PILVFRIGLVQ--LAVTANKLQNLQRAR--EKIKEAVAA----GAKIVALPECFNSPYG- 54 Query: 436 CTREKQPWCEFAESAEDGPTTTFLRELAIRYAMVIVS-SILERDEKHSDILWNTAVVISD 612 Q + ++AE G ++ L E+A IV SI ER L+NT++ Sbjct: 55 ----TQYFKDYAEEIP-GESSNMLAEVAKETGAYIVGGSIPERASNGK--LYNTSLSYDP 107 Query: 613 TGNVIGKHRK 642 +GN++GKHRK Sbjct: 108 SGNLMGKHRK 117 >SB_11184| Best HMM Match : CN_hydrolase (HMM E-Value=4.4e-10) Length = 128 Score = 39.9 bits (89), Expect = 0.003 Identities = 34/105 (32%), Positives = 49/105 (46%), Gaps = 8/105 (7%) Frame = +1 Query: 466 FAESAED--GPTTTFLRELAIRYAMVIVS-SILERDEKHSDILWNTAVVISDTGNVIGKH 636 F + AE+ G ++ L E+A IV SI ER L+NT++ +GN++GKH Sbjct: 12 FKDYAEEIPGESSNMLAEVAKETGAYIVGGSIPERASNGK--LYNTSLSYDPSGNLMGKH 69 Query: 637 RKNH-----IPRVGDFNESNYYMEGNTGHPVFAXRYGKIAVXICF 756 RK H +P F ES G + Y KI + IC+ Sbjct: 70 RKIHLFDIDVPGKIRFQESEVLSPGE-NLTILDTEYCKIGIGICY 113 >SB_34841| Best HMM Match : ResIII (HMM E-Value=1.6) Length = 949 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/47 (25%), Positives = 27/47 (57%), Gaps = 1/47 (2%) Frame = +1 Query: 235 AKDEQTRPPRIVKVGIIQHSIAVPTDRPVNEQKKA-IFNKVKKIIDV 372 A D + P VK H + +PT++P+ E + + +++K+ ++ +V Sbjct: 762 AHDHRNNPSLAVKAQTYHHYLCIPTEKPIEEWRPSELWHKLDRLAEV 808 >SB_33872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 716 Score = 29.5 bits (63), Expect = 3.8 Identities = 24/58 (41%), Positives = 32/58 (55%), Gaps = 8/58 (13%) Frame = +1 Query: 589 NTAVVISDTGNVIGK---HRKNHIPRVGDFNE----SNYYMEGN-TGHPVFAXRYGKI 738 NTA +IS+TG+VI K H K + P D + Y GN TG PV+A YG++ Sbjct: 52 NTAKIISNTGDVIYKTRTHEKVYEPSEKDPSAIPPFLAYSPSGNVTGDPVYA-NYGRV 108 >SB_27173| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1206 Score = 29.5 bits (63), Expect = 3.8 Identities = 12/47 (25%), Positives = 26/47 (55%), Gaps = 1/47 (2%) Frame = +1 Query: 235 AKDEQTRPPRIVKVGIIQHSIAVPTDRPVNEQKKA-IFNKVKKIIDV 372 AKD + P VK H + +P ++P+ E + + + +K+ ++ +V Sbjct: 823 AKDHRNNPRLAVKAQTYHHYLCIPAEKPIEEWRPSELGHKLDRLAEV 869 >SB_8338| Best HMM Match : PA (HMM E-Value=5.7e-10) Length = 326 Score = 29.5 bits (63), Expect = 3.8 Identities = 24/58 (41%), Positives = 32/58 (55%), Gaps = 8/58 (13%) Frame = +1 Query: 589 NTAVVISDTGNVIGK---HRKNHIPRVGDFNE----SNYYMEGN-TGHPVFAXRYGKI 738 NTA +IS+TG+VI K H K + P D + Y GN TG PV+A YG++ Sbjct: 143 NTAKIISNTGDVIYKTRTHEKVYEPSEKDPSAIPPFLAYSPSGNVTGDPVYA-NYGRV 199 >SB_24587| Best HMM Match : ResIII (HMM E-Value=0.82) Length = 250 Score = 29.1 bits (62), Expect = 5.0 Identities = 12/47 (25%), Positives = 26/47 (55%), Gaps = 1/47 (2%) Frame = +1 Query: 235 AKDEQTRPPRIVKVGIIQHSIAVPTDRPVNEQKKA-IFNKVKKIIDV 372 A D + P VK H + +PT++P+ E + + + +K+ ++ +V Sbjct: 177 AHDHRNNPRLAVKAQTYHHYLCIPTEKPIEEWRPSELGHKLDRLAEV 223 >SB_47836| Best HMM Match : F5_F8_type_C (HMM E-Value=0.022) Length = 1002 Score = 28.7 bits (61), Expect = 6.6 Identities = 26/83 (31%), Positives = 39/83 (46%), Gaps = 5/83 (6%) Frame = -2 Query: 429 EGHIPQLLETD--DVNTLLAGNIDDLLDFIENCFLLLVDWTIGGHRDGMLNYSYLHNSRR 256 +GH+ LLE + D L+ ++LLD LL V++ GH G+L +L Sbjct: 312 KGHLVGLLEVEFLDKEHLVGLLEEELLDKGHLVGLLEVEFLDKGHLVGLLEVEFLDKGHL 371 Query: 255 SGLL---VLGRESVCGDVEVSLL 196 GLL L + + G +EV L Sbjct: 372 VGLLEEEFLDKGQLVGLLEVEFL 394 >SB_4447| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 770 Score = 28.7 bits (61), Expect = 6.6 Identities = 15/37 (40%), Positives = 18/37 (48%) Frame = -2 Query: 426 GHIPQLLETDDVNTLLAGNIDDLLDFIENCFLLLVDW 316 G +P + +NTLL GN D F NC LL W Sbjct: 723 GLVPYWTKLFGINTLLVGNARDSHLFCRNCSGLLPYW 759 >SB_58044| Best HMM Match : Vitellogenin_N (HMM E-Value=0.022) Length = 1671 Score = 28.7 bits (61), Expect = 6.6 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = -2 Query: 576 RMLLVPF*YRGHDHHCVPDGEFPKE 502 R L+ PF +R +DH V D FPK+ Sbjct: 74 RKLIKPFYFRQYDHGSVVDAIFPKD 98 >SB_33687| Best HMM Match : Filament (HMM E-Value=0.1) Length = 700 Score = 28.3 bits (60), Expect = 8.7 Identities = 15/43 (34%), Positives = 22/43 (51%) Frame = +1 Query: 565 EKHSDILWNTAVVISDTGNVIGKHRKNHIPRVGDFNESNYYME 693 +K D LW A + D KH++N I R +F E ++Y E Sbjct: 391 QKRFDTLWVKAKSMMDEET---KHKENAIKRSKEFEERSHYFE 430 >SB_15536| Best HMM Match : MdcD (HMM E-Value=3.9) Length = 146 Score = 28.3 bits (60), Expect = 8.7 Identities = 9/28 (32%), Positives = 15/28 (53%) Frame = -3 Query: 461 HHGCFSLVQNAKGIFHNSWKQMMLTPSW 378 HH CF ++ +A + Q ++PSW Sbjct: 44 HHACFGIIPSALSVLVERGDQEAVSPSW 71 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 25,304,347 Number of Sequences: 59808 Number of extensions: 537072 Number of successful extensions: 1547 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 1364 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1544 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2503194881 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -