BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_FL5_I23 (924 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g05965.1 68418.m00660 hypothetical protein 30 2.5 At4g36150.1 68417.m05145 disease resistance protein (TIR-NBS-LRR... 29 5.8 >At5g05965.1 68418.m00660 hypothetical protein Length = 131 Score = 29.9 bits (64), Expect = 2.5 Identities = 18/61 (29%), Positives = 28/61 (45%) Frame = +3 Query: 300 DNRSVNVWKNENVQYGKRPYPGAKHYCNERRTERSAWSAPAPPGLRPDRRSLSVLRHRGS 479 D RS + K E+ Y Y G + + + RT+ S+ S P DR ++ RG+ Sbjct: 65 DERSSHE-KRESSYYSSSIYYGGQQHYSPPRTDGSSTSPSHQPKETNDRTDITTSTSRGN 123 Query: 480 W 482 W Sbjct: 124 W 124 >At4g36150.1 68417.m05145 disease resistance protein (TIR-NBS-LRR class), putative domain signature TIR-NBS-LRR exists, suggestive of a disease resistance protein. Length = 1179 Score = 28.7 bits (61), Expect = 5.8 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = -3 Query: 151 SRPVDGLFAFSGFVNISHVINHLAG*QSLTKH 56 SR +D F G+ + SH+ HL G L +H Sbjct: 1058 SRKIDSDHVFIGYTSSSHITKHLEGSLKLKEH 1089 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,422,823 Number of Sequences: 28952 Number of extensions: 226024 Number of successful extensions: 602 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 583 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 602 length of database: 12,070,560 effective HSP length: 81 effective length of database: 9,725,448 effective search space used: 2197951248 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -